mirror of
https://github.com/electron/electron.git
synced 2026-04-10 03:01:51 -04:00
3fa3e91f90ccb23f88d156fc8671ec4abfb652ae
37 Commits
| Author | SHA1 | Message | Date | |
|---|---|---|---|---|
|
|
809ab09b6f |
chore: bump chromium to 145.0.7596.0 (main) (#49224)
* chore: bump chromium in DEPS to 145.0.7588.0 * fix(patch-conflict): update scroll_bounce_flag for split overscroll methods Chromium split IsElasticOverscrollEnabled() into two methods: IsElasticOverscrollEnabledOnRoot() and IsElasticOverscrollSupported(). Updated patch to apply the scroll-bounce command-line switch to both methods. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7233733 * fix(patch-conflict): update exclusive_access patch context Upstream refactored the profile variable declaration. Updated patch to match new surrounding context with brace-style if statement. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239252 * fix(patch-conflict): update screen capture kit non-shareable filter Upstream refactored PiP window exclusion to use GetWindowsToExclude() helper function. Updated patch to combine non-shareable window filtering with the new helper's output. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7274596 * fix(patch-conflict): update corner smoothing CSS property id position Upstream added new internal overscroll CSS properties. Updated patch to add kElectronCornerSmoothing after the new entries. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234051 * fix(patch-conflict): update permission patches for new permission types Upstream added new permission types: LOCAL_NETWORK, LOOPBACK_NETWORK, and GEOLOCATION_APPROXIMATE. Updated Electron permission patches to include these new types and renumber Electron-specific permissions. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7231952 * fix(patch-conflict): update memory query fallback for new function signature Upstream added AmountOfTotalPhysicalMemory() with PCHECK. Updated patch to maintain fallback logic with correct ByteSize return type. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254886 * chore: update patch hunk headers * fix(patch): update reclient-configs patch to use new file mode The fix_add_python_remote_wrapper patch was using 'copy from' mode which caused inconsistent behavior between local and CI git versions. Changed to 'new file' mode for consistent patch application. * fix(patch-conflict): remove duplicate GEOLOCATION_APPROXIMATE case Upstream moved GEOLOCATION_APPROXIMATE earlier in the switch statement in GetPermissionString(). The 3-way merge kept both the old and new positions, causing a duplicate case error. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6397637 * chore: update libcxx filenames for new headers * chore: bump chromium in DEPS to 145.0.7590.0 * chore: update patch hunk headers * fix(patch): update memory fallback return type to ByteSize Upstream changed the return type from ByteCount to ByteSize. * fix: suppress nodiscard warning in node_file.cc libc++ added [[nodiscard]] to std::filesystem::copy_options operator|= which causes build failures with -Werror. * 7229082: update CopyFromSurface to use CopyFromSurfaceResult Upstream changed CopyFromSurface callback to return base::expected<viz::CopyOutputBitmapWithMetadata, std::string> instead of SkBitmap, enabling better error handling. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7229082 * 7254070: add ip_address_space param to OnLocalNetworkAccessPermissionRequired Upstream added IPAddressSpace parameter to check address space for proper permission handling in Local Network Access. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254070 * 7136679: add spelling_markers param to RequestCheckingOfText Upstream added spelling_markers parameter to report misspelling ranges from Blink to Spellcheck to IME. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7136679 * 7240487: remove second param from RegisterWebSafeIsolatedScheme Upstream removed the schemes_okay_to_appear_as_origin_headers_ parameter. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7240487 * 7254577: use explicit WebElement constructor WebElement default constructor now requires explicit construction rather than brace initialization. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254577 * 7256335: remove override from CreateGlobalFeaturesForTesting Upstream removed BrowserProcess::CreateGlobalFeaturesForTesting virtual method so the override specifier is no longer valid. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7256335 * chore: add missing SingleThreadTaskRunner include A transitive include of SingleThreadTaskRunner was removed upstream, requiring an explicit include. Ref: Unable to locate specific CL (transitive include change) * 7260483: add LOCAL_NETWORK, LOOPBACK_NETWORK permission type cases Upstream added new permission types for Local Network Access split permissions. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7260483 * chore: update patch hunk headers * 7264893: update postMessage tests for file: origin serialization change Chromium now serializes file: origins as 'null' in MessageEvent per spec. This is a security improvement aligning with the HTML spec behavior. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893 * fix: add paths to custom scheme URLs in protocol tests Custom scheme URLs without paths (e.g. test-scheme://foo) cause a DCHECK crash in ASAN builds when CorsURLLoader tries to log the request via GenerateRequestLine -> PathForRequest, which asserts that the path is non-empty. Adding trailing slashes ensures URLs have valid paths. * chore: bump chromium in DEPS to 145.0.7592.0 * chore: update patches (trivial only) * chore: bump chromium in DEPS to 145.0.7594.0 * chore: bump chromium in DEPS to 145.0.7596.0 * chore: update accelerator.patch no manual changes; patch applied with fuzz 2 (offset 1 line) * chore: update patches (trivial only) * chore: node ./script/gen-libc++-filenames.js --------- Co-authored-by: Alice Zhao <alicelovescake@anthropic.com> Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Charles Kerr <charles@charleskerr.com> |
||
|
|
29e0948f7b |
chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0 * chore: bump chromium in DEPS to 143.0.7493.0 * chore: update mas_avoid_private_macos_api_usage.patch.patch Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087 * chore: update add_didinstallconditionalfeatures.patch no manual changes; patch applied with fuzz Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411 * chore: update printing.patch Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117 * chore: update allow_in-process_windows_to_have_different_web_prefs.patch patch reapplied manually due to context shear Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411 * chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch patch reapplied manually due to context shear Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290 * chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch patch manually reapplied for files moved upstream Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087 * chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch no manual changes; patch applied with fuzz [spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186 * chore: update patches * chore: fix broken includes in ElectronBrowserMainParts Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087 * chore: bump chromium in DEPS to 143.0.7495.0 * chore: fixup patch indices * chore: bump chromium in DEPS to 143.0.7497.0 * chore: fixup patch indices * 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision) https://chromium-review.googlesource.com/c/chromium/src/+/7085081 * 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common https://chromium-review.googlesource.com/c/chromium/src/+/7081087 * test: fix failing spec --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Charles Kerr <charles@charleskerr.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> |
||
|
|
471a14432f |
chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0 * 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651 * 7013047: Fix various C++23 build errors in //chrome Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047 * 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850 * 7007933: Remove superfluous mojom includes in //content/public headers Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933 * 7023196: Trim os_crypt/sync visibility list Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196 * 7008912: Remove GURL::*_piece() method Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912 * 7003989: Add wrapper struct for CopyFromSurface output Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989 * 7017889: [MemoryPressureListener] Remove type aliases Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889 * 7027780: Delete viz::ResourceSizes Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780 Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572 * 6495189: [api] Delete old String::Write* APIs Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189 * chore: update patches * chore: run script/gen-libc++-filenames.js --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: David Sanders <dsanders11@ucsbalum.com> |
||
|
|
d920c82fc4 |
chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0
* chore: bump chromium in DEPS to 142.0.7430.0
* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508
* https://chromium-review.googlesource.com/c/chromium/src/+/6955633
* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820
* chore: export patches
* chore: remove patch that keeley says is ok to remove in comments
* chore: bump chromium in DEPS to 142.0.7432.0
* chore: export patches
* chore: bump chromium in DEPS to 142.0.7434.0
* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697
* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272
* chore: export patches
* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086
* 6951252: Correct PersistentCache backed code cache context grouping
* chore: bump chromium in DEPS to 142.0.7436.0
* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628
* chore: export patches
* chore: resolve patch conflict with main
* chore: merge conflict with main
* chore: bump chromium in DEPS to 142.0.7438.0
* chore: bump chromium in DEPS to 142.0.7440.0
* chore: bump chromium in DEPS to 142.0.7442.0
* chore: bump chromium in DEPS to 142.0.7444.0
* chore: bump chromium in DEPS to 143.0.7445.0
* chore: bump chromium in DEPS to 143.0.7447.0
* chore: bump chromium in DEPS to 143.0.7449.0
* chore: bump chromium in DEPS to 143.0.7451.0
* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364
* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521
* chore: update chromium patches
* chore: update chromium patches
* chore: update patches
* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166
* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453
* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307
* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166
* ci: ignore missing dir for strip_universal_deep
* fix: js2c compilation failure
https://chromium-review.googlesource.com/c/chromium/src/+/6950738
See patch description explaining MacOS 26 SDK headers incompatibility.
* fixup! chore: export patches
* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933
* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114
* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238
* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937
* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403
* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307
* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010
* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738
* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633
This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.
* Revert "build: use macos 15 minimum"
This reverts commit
|
||
|
|
5d5e672f17 |
chore: bump chromium to 141.0.7361.0 (main) (#48054)
* chore: bump chromium in DEPS to 141.0.7352.0 * chore: update patches * 6830573: Revert 'Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable' | https://chromium-review.googlesource.com/c/chromium/src/+/6830573 * chore: bump chromium in DEPS to 141.0.7354.0 * chore: bump chromium in DEPS to 141.0.7356.0 * chore: bump chromium in DEPS to 141.0.7357.0 * chore: bump chromium in DEPS to 141.0.7359.0 * chore: bump chromium in DEPS to 141.0.7361.0 * 6838518: [Mac] Correctly deallocate sandbox error buffers and prevent crash resulting from nullptr assignment | https://chromium-review.googlesource.com/c/chromium/src/+/6838518 * 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973 * 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565 * chore: update patches * fixup! 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973 * fixup! 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565 * fix: unsafe buffer warning in fix_properly_honor_printing_page_ranges.patch * fix: FTBFS in src_remove_dependency_on_wrapper-descriptor-based_cppheap.patch This change should be upstreamed. Fixes this error: ../../third_party/electron_node/src/env.cc:606:3: error: no matching function for call to 'Wrap' 606 | v8::Object::Wrap<v8::CppHeapPointerTag::kDefaultTag>( | ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ../../v8/include/v8-object.h:1076:14: note: candidate function template not viable: cannot convert argument of incomplete type 'void *' to 'v8::Object::Wrappable *' for 3rd argument 1076 | void Object::Wrap(v8::Isolate* isolate, const v8::Local<v8::Object>& wrapper, | ^ 1077 | v8::Object::Wrappable* wrappable) { | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ../../v8/include/v8-object.h:1084:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const PersistentBase<Object>' for 2nd argument 1084 | void Object::Wrap(v8::Isolate* isolate, const PersistentBase<Object>& wrapper, | ^ ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ ../../v8/include/v8-object.h:1093:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const BasicTracedReference<Object>' for 2nd argument 1093 | void Object::Wrap(v8::Isolate* isolate, | ^ 1094 | const BasicTracedReference<Object>& wrapper, | ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1 error generated. * [v8-init] Access crash key only from main thread | https://chromium-review.googlesource.com/c/chromium/src/+/6827167 * chore: e patches all * chore: remove chore_restore_some_deprecated_wrapper_utility_in_gin.patch from patches this remove line got re-added when rebasing roller/chromium/main * chore: e patches all * fix: include base/time/time.h when using base::Time * chore: update patches * Make --host-rules an alias for --host-resolver-rules. Refs https://chromium-review.googlesource.com/c/chromium/src/+/4867872 * ci: update BUILD_TOOLS_SHA Refs https://github.com/electron/build-tools/pull/746 * [Fontations] Remove Fontations suffix from font names Refs https://chromium-review.googlesource.com/c/chromium/src/+/6835930 * temp: debug macOS addon build failure * Revert "temp: debug macOS addon build failure" This reverts commit 40bc8abab65dc83e17c4ab97cb6e7522a193fb44. * test: run tests with Xcode 16.4 * ci: fix tccdb update for macOS 15 * spec: disable opening external application for loadURL on macOS opening unknown external application will bring up dialog to choose apps from application store which will break our other test suites that want to capture screen for pixel matching. The loadURL spec that tests bad-scheme://foo is sufficient that we hit the permission handler for openExternal since at that point we already know the runtime gave up on handling the scheme. * chore: rebase patches * chore: disable codesiging tests * ci: update ScreenCaptureApprovals.plist for /bin/bash * ci: try updating tcc permissions * ci: update TCC permissions Refs https://www.rainforestqa.com/blog/macos-tcc-db-deep-dive * chore: test with 1st quadrant of the window * chore: adjust for macOS 15 menubar height --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Keeley Hammond <khammond@slack-corp.com> Co-authored-by: Keeley Hammond <vertedinde@electronjs.org> Co-authored-by: Charles Kerr <charles@charleskerr.com> Co-authored-by: deepak1556 <hop2deep@gmail.com> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> |
||
|
|
c569d5e4ba |
chore: bump chromium to 140.0.7312.0 (main) (#47862)
* chore: bump chromium in DEPS to 140.0.7312.0 * 6769540: Move NetworkTrafficAnnotationTag out of PreconnectManager. Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769540 * 6771377: Roll libc++ from 3eda1e62e799 to 569aa83b4bbc (7 revisions) Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771377 * 6771398: Remove unnecessary std::optional wrappers in ResolveHostClient Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771398 * chore: update patches * 6776165: Use shared session bus for MPRIS Refs https://chromium-review.googlesource.com/c/chromium/src/+/6776165 --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: David Sanders <dsanders11@ucsbalum.com> |
||
|
|
47572286f3 |
chore: bump chromium to 135.0.7015.0 (main) (#45500)
* https://chromium-review.googlesource.com/c/chromium/src/+/6230977 * chore: bump chromium to 135.0.7012.0 * chore: update accelerator.patch Support parsing Ctrl+Alt shortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/6238137 * 6234236: Reapply bindings: Pass CppHeap on Isolate creation | https://chromium-review.googlesource.com/c/chromium/src/+/6234236 * 6234614: [ios blink] Move to use external begin frame source | https://chromium-review.googlesource.com/c/chromium/src/+/6234614 * chore: update chromium/feat_add_streaming-protocol_registry_to_multibuffer_data_source.patch no manual changes; patch applied with fuzz * chore: update chromium/build_libc_as_static_library.patch no manual changes; patch applied with fuzz * chore: remove chromium/cherry-pick-dd8e2822e507.patch landed upstream * 6188884: Grit: Remove output_all_resource_defines from list of valid attributes. | https://chromium-review.googlesource.com/c/chromium/src/+/6188884 * 6226981: [views-ax] Remove View::GetAccessibleNodeData() method | https://chromium-review.googlesource.com/c/chromum/src/+/6226981 * 6214895: [views-ax] Deprecate View::NotifyAccessibilityEvent | https://chromium-review.googlesource.com/c/chromium/src/+/6214895 * 6196494: Remove ImageView::SetImage() with ImageSkia param | https://chromium-review.googlesource.com/c/chromium/src/+/6196494 * 6236267: [cleanup] Remove unused PrinterBasicInfo fields | https://chromium-review.googlesource.com/c/chromium/src/+/6236267 * refactor: remove status, isDefault properties from PrinterInfo Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6236267 * chore: lint * fixup: added mas bypass to new file added in https://chromium-review.googlesource.com/c/chromium/src/+/6208630 see slack for more context * chore: node script/gen-libc++-filenames.js * chore: e patches all * fix: duplicate crdtp symbols * chore: update patches * fixup! [Media Features] Remove launched features --------- Co-authored-by: alice <alice@makenotion.com> Co-authored-by: Charles Kerr <charles@charleskerr.com> Co-authored-by: deepak1556 <hop2deep@gmail.com> |
||
|
|
75eac86506 |
chore: bump chromium to 134.0.6968.0 (main) (#45172)
* chore: bump chromium in DEPS to 134.0.6948.0 * chore: update can_create_window.patch https://chromium-review.googlesource.com/c/chromium/src/+/6151982 no patch code changes, but had to manually apply due to upstream context shear * chore: update proxy_config_monitor.patch no manual changes; patch applied with fuzz 2 Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6126219 * chore: update build_add_electron_tracing_category.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6149256 * chore: update adjust_accessibility_ui_for_electron.patch https://chromium-review.googlesource.com/c/chromium/src/+/6105650 no patch code changes, but had to manually apply due to upstream context shear * chore: e patches all * chore: use fully-qualified path for all.gn Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6154997 * chore: do not use a variable when assigning rtc_use_h264 Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6154997 * Move GlobalShortcutListenerLinux to //ui/base Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6097375 * [MPArch Guest View] Make WebPreferences queried per frame tree root Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6096390 * [Status Icons] Allow vector resources https://chromium-review.googlesource.com/c/chromium/src/+/6139403 * [Extensions] Move MatchOriginAsFallbackBehavior to Mojom Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6141793 * Remove StrongAlias::Hasher Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6132291 * Rename text-change and select-change methods and related stuff Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6148816 * [Code Health] Remove stale feature EnableWebUsbOnExtensionServiceWorker https://chromium-review.googlesource.com/c/chromium/src/+/6115161 * [Extensions Cleanup] Move creation of tab-based ports to factory method https://chromium-review.googlesource.com/c/chromium/src/+/6143725 * refactor: add StatusIconGtk::SetIcon() Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6139403 copied from chrome/browser/status_icons/status_icon.cc * refactor: add TrayIconLinux::GetIcon() Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6139403 * chore: update feat_allow_usage_of_sccontentsharingpicker_on_supported_platforms.patch remove unused filter_ field * chore: bump chromium in DEPS to 134.0.6950.0 * chore: bump chromium in DEPS to 134.0.6952.0 * chore: bump chromium in DEPS to 134.0.6954.0 * chore: bump chromium in DEPS to 134.0.6956.0 * chore: update Chromium patches * 6165749: Check scanout support in RenderableGpuMemoryBufferPool | https://chromium-review.googlesource.com/c/chromium/src/+/6165749 * 6106730: [Win] Use DXGI swapchains and DCOMP visuals in software mode | https://chromium-review.googlesource.com/c/chromium/src/+/6106730 * chore: update patches * chore: bump chromium in DEPS to 134.0.6958.0 * chore: bump chromium in DEPS to 134.0.6960.0 * chore: update chromium patches * 6168371: Remove extensions GlobalShortcutListener wrapper | https://chromium-review.googlesource.com/c/chromium/src/+/6168371 * chore: update patches * 6161637: WebUI: Leverage build_webui() in chrome://translate-internals | https://chromium-review.googlesource.com/c/chromium/src/+/6161637 * chore: bump chromium in DEPS to 134.0.6962.0 * 6177329: Remove policy.used_policy_certificates pref on ChromeOS | https://chromium-review.googlesource.com/c/chromium/src/+/6177329 * 6180524: Simplify logic in components/os_crypt/sync/BUILD.gn | https://chromium-review.googlesource.com/c/chromium/src/+/6180524 * 6144831: Enforce --disallow-v8-feature-flag-overrides in the renderer | https://chromium-review.googlesource.com/c/chromium/src/+/6144831 * chore: update patches * chore: bump chromium in DEPS to 134.0.6964.0 * 6181010: Ensure busy cursor does not show via LaunchWithoutSandbox | https://chromium-review.googlesource.com/c/chromium/src/+/6181010 * chore: update patches * chore: bump chromium in DEPS to 134.0.6966.0 * 6180598: [api] Remove Reallocate | https://chromium-review.googlesource.com/c/v8/v8/+/6180598 * 6170781: [Refactor] Move UninstallExtension to ExtensionRegistrar. | https://chromium-review.googlesource.com/c/chromium/src/+/6170781 * chore: update filenames.libcxx.gni * 6168207: cdm: Remove widevine_cdm_version.h | https://chromium-review.googlesource.com/c/chromium/src/+/6168207 * chore: bump chromium in DEPS to 134.0.6968.0 * 6030552: [macOS] Allow using vibrancy with NativeWidgetNSWindowBridge | https://chromium-review.googlesource.com/c/chromium/src/+/6030552 * fix: use explicit copy to replace realloc impl https://chromium-review.googlesource.com/c/v8/v8/+/6180598 https://issues.chromium.org/issues/331326406 As per recommendation, "File an issue with Node to explicitly copy,because they copy under the hood anyway" * fixup! 6106730: [Win] Use DXGI swapchains and DCOMP visuals in software mode | https://chromium-review.googlesource.com/c/chromium/src/+/6106730 * fix: undefine win32 StrCat https://chromium-review.googlesource.com/c/chromium/src/+/6172292 * fix: //device/vr:directx_helpers breaking the build https://chromium-review.googlesource.com/c/chromium/src/+/6064548 Upstreamed in https://chromium-review.googlesource.com/c/chromium/src/+/6186102 * fix: avoid calling ui::Layer::SetFillsBoundsOpaquely https://chromium-review.googlesource.com/c/chromium/src/+/6175787 The layer opacity is determined by the background color's alpha value * fix: build with proprietary_codecs The explicit setting of rtc_use_h264 is no longer needed since https://webrtc-review.googlesource.com/c/src/+/62380 * fix: increase empty trace file size threshold https://chromium-review.googlesource.com/c/chromium/src/+/6176642 Traces now contain a net-constants property to allow them to be converted to a net log. These contain ~1240 new properties with formatted JSON data. * fix: node tests missing resource management globals https://chromium-review.googlesource.com/c/chromium/src/+/6174695 * fixup! fix: use explicit copy to replace realloc impl * chore: disable focus handling test due to win32/ia32 regression --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Charles Kerr <charles@charleskerr.com> Co-authored-by: Keeley Hammond <khammond@slack-corp.com> Co-authored-by: VerteDinde <vertedinde@electronjs.org> Co-authored-by: Samuel Maddock <smaddock@slack-corp.com> Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org> |
||
|
|
30fbeec036 |
chore: bump chromium to 131.0.6734.0 (main) (#43769)
* chore: bump chromium in DEPS to 130.0.6723.4
* chore: bump chromium in DEPS to 131.0.6724.0
* chore: update patches
* chore: update libc++ filenames
* 5844369: controlledframe: Disable Web Bluetooth for <webview> & <controlledframe>
https://chromium-review.googlesource.com/c/chromium/src/+/5844369
* (multiple CLs): Use an opaque type for FrameTreeNode IDs
5807683: Use an opaque type for FrameTreeNode IDs, part 1 | https://chromium-review.googlesource.com/c/chromium/src/+/5807683
5829746: Use an opaque type for FrameTreeNode IDs, part 2 | https://chromium-review.googlesource.com/c/chromium/src/+/5829746
5836903: Use an opaque type for FrameTreeNode IDs, part 7 | https://chromium-review.googlesource.com/c/chromium/src/+/5836903
5837249: Use an opaque type for FrameTreeNode IDs, part 8 | https://chromium-review.googlesource.com/c/chromium/src/+/5837249
5836564: Use an opaque type for FrameTreeNode IDs, part 12 | https://chromium-review.googlesource.com/c/chromium/src/+/5836564
5837180: Use an opaque type for FrameTreeNode IDs, part 15 | https://chromium-review.googlesource.com/c/chromium/src/+/5837180
* 5822889: [task] Make GetForegroundTaskRunner non-virtual
https://chromium-review.googlesource.com/c/v8/v8/+/5822889
* 5833297: Remove unused inner WebContents attach params
https://chromium-review.googlesource.com/c/chromium/src/+/5833297
* 5806403: Shift PowerMonitor to non static
https://chromium-review.googlesource.com/c/chromium/src/+/5806403
* 5666874: [3/N] Remove old OnPowerChange in PowerObserver
https://chromium-review.googlesource.com/c/chromium/src/+/5666874
* 5829085: [v8] Differentiate between UserVisible and BestEffort task runners
https://chromium-review.googlesource.com/c/chromium/src/+/5829085
* 5791112: [webrtc] Use `c/b/permissions/system` for system permissions
https://chromium-review.googlesource.com/c/chromium/src/+/5791112
* 5825636: [Extensions] Create WebContentsObservers with ExtensionsBrowserClient
https://chromium-review.googlesource.com/c/chromium/src/+/5825636
* fixup! (multiple CLs): Use an opaque type for FrameTreeNode IDs
* fixup! 5791112: [webrtc] Use `c/b/permissions/system` for system permissions https://chromium-review.googlesource.com/c/chromium/src/+/5791112
* chore: bump chromium in DEPS to 131.0.6726.0
* chore: update patches
* chore: update libc++ filenames
*
|
||
|
|
c3b4cd987c |
chore: bump chromium to 127.0.6521.0 (main) (#42118)
* chore: bump chromium in DEPS to 126.0.6470.0
* 5492605: Migrate TODOs referencing old crbug IDs to the new issue tracker IDs | https://chromium-review.googlesource.com/c/chromium/src/+/5492605
* 5513277: Move subresource-filter-ruleset to GCS | https://chromium-review.googlesource.com/c/chromium/src/+/5513277
* 5512656: Remove CustomizeChromeSupportsChromeRefresh2023 | https://chromium-review.googlesource.com/c/chromium/src/+/5512656
* 5516009: Accept mouse events in inactive window for Top Chrome WebUIs | https://chromium-review.googlesource.com/c/chromium/src/+/5516009
* 5376861: Change references to RWHVB in RWHIER and RenderWidgetTargeter to RWHVI. | https://chromium-review.googlesource.com/c/chromium/src/+/5376861
* 5490530: Use partition_alloc PA_BUILDFLAG(...) outside PA. #cleanup | https://chromium-review.googlesource.com/c/chromium/src/+/5490530
* 5296870: network: Allow trusted loaders to learn the sent request cookies. | https://chromium-review.googlesource.com/c/chromium/src/+/5296870
* 5453438: Delegate delegated ink trails to RWHI from RWHIER. | https://chromium-review.googlesource.com/c/chromium/src/+/5453438
* chore: update patches
* chore: bump chromium in DEPS to 126.0.6472.0
* chore: bump chromium in DEPS to 126.0.6474.0
* chore: update patches
* chore: bump chromium in DEPS to 126.0.6476.0
* chore: bump chromium in DEPS to 126.0.6478.0
* chore: bump chromium in DEPS to 126.0.6478.3
* chore: bump chromium in DEPS to 126.0.6478.8
* update patches
* only disable enterprise_cloud_content_analysis
* 5403888: [api] support v8::Data in v8::TracedReference and v8::EmbedderGraph
https://chromium-review.googlesource.com/c/v8/v8/+/5403888
* chore: bump chromium in DEPS to 127.0.6484.0
* chore: bump chromium in DEPS to 127.0.6485.0
* 5539004: Use NOTREACHED_IN_MIGRATION() in remaining chrome/ | https://chromium-review.googlesource.com/c/chromium/src/+/5539004
* src: cast to v8::Value before using v8::EmbedderGraph::V8Node | https://github.com/nodejs/node/pull/52638/files
* chore: update patches
* chore: update v8 patches
* chore: bump chromium in DEPS to 127.0.6486.0
* chore: bump chromium in DEPS to 127.0.6488.0
* chore: bump chromium in DEPS to 127.0.6490.0
* chore: bump chromium in DEPS to 127.0.6492.0
* chore: update patches
For some reason, `feat_expose_raw_response_headers_from_urlloader.patch` got messed up in an earlier commit.
* chore: update patches
printing.patch was updated due to https://chromium-review.googlesource.com/c/chromium/src/+/5535938
* 5527572: Move Connectors prefs files to components/enterprise/connectors/
https://chromium-review.googlesource.com/c/chromium/src/+/5527572
* chore: bump chromium in DEPS to 127.0.6494.0
* chore: bump chromium in DEPS to 127.0.6495.0
* chore: bump chromium in DEPS to 127.0.6496.0
* 5465511: [api] Mark v8::ObjectTemplate::SetAccessor(..) for deprecation
https://chromium-review.googlesource.com/c/v8/v8/+/5465511
* chore: revert v8 deprecation
See patch message for more details.
https://chromium-review.googlesource.com/c/v8/v8/+/5526611
* chore: update patches
* 5538771: Remove srcdoc else-if block in CalculateOrigin()
https://chromium-review.googlesource.com/c/chromium/src/+/5538771
* 5522321: [devtools] Support saving base64 encoded files via host bindings
https://chromium-review.googlesource.com/c/chromium/src/+/5522321
* 5376861: Change references to RWHVB in RWHIER and RenderWidgetTargeter to RWHVI.
https://chromium-review.googlesource.com/c/chromium/src/+/5376861
* 5530163: [media] Use VideoFrame::Plane typed enum instead of nameless enum
https://chromium-review.googlesource.com/c/chromium/src/+/5530163
* 5463431: iwa: Only create IsolatedWebAppURLLoaderFactory for subresources in IWAs
https://chromium-review.googlesource.com/c/chromium/src/+/5463431
* fixup! 5465511: [api] Mark v8::ObjectTemplate::SetAccessor(..) for deprecation https://chromium-review.googlesource.com/c/v8/v8/+/5465511
* 5512176: Remove OnEnvironmentEstimationComplete()
https://chromium-review.googlesource.com/c/chromium/src/+/5512176
* 5528282: Move Web Speech API .mojom files to //media/mojo/mojom
https://chromium-review.googlesource.com/c/chromium/src/+/5528282
* 5513740: Reland "[Extensions] Restructure extensions::ProcessMap"
https://chromium-review.googlesource.com/c/chromium/src/+/5513740
* 5483406: [PEPC] Make PEPC permission subscription take into account device status
https://chromium-review.googlesource.com/c/chromium/src/+/5483406
* 5526034: [DoH] Remove kDnsOverHttps feature flag
https://chromium-review.googlesource.com/c/chromium/src/+/5526034
The title is a bit misleading. They removed handling for the feature flag and generally intend to remove it but haven't yet.
I only changed our code to address the flag that was removed. A quick search on GitHub for `DnsOverHttpsFallback` yielded a few results, but they were all C++ chromium code or patches, 0 app code or discussion results. Since I couldn't find any evidence of this flag being used in developer applications, I've chosen to exclude this change from the breaking changes docs.
* chore: revert v8 removal
https://chromium-review.googlesource.com/c/v8/v8/+/5497515
See patch message for more details.
* chore: cherry-pick Node.js patch for V8 API removal fix
Node.js PR: https://github.com/nodejs/node/pull/52996
V8 API Removal CL: https://chromium-review.googlesource.com/c/v8/v8/+/5539888
See the patch description for more details.
* 5492183: Extensions: CodeHealth: Give enums some class
https://chromium-review.googlesource.com/c/chromium/src/+/5492183
* fixup! 5528282: Move Web Speech API .mojom files to //media/mojo/mojom https://chromium-review.googlesource.com/c/chromium/src/+/5528282
* 5514687: Reland "Add a secret handshake to the base::Feature constructor"
https://chromium-review.googlesource.com/c/chromium/src/+/5514687
* fixup! 5530163: [media] Use VideoFrame::Plane typed enum instead of nameless enum https://chromium-review.googlesource.com/c/chromium/src/+/5530163
* 5466238: PDF Viewer: add metrics to record if PDF is opened with a11y
https://chromium-review.googlesource.com/c/chromium/src/+/5466238
* 5502081: Migrate OnDisplayRemoved to OnDisplaysRemoved
https://chromium-review.googlesource.com/c/chromium/src/+/5502081
* 5539888: [api] Remove several APIs deprecated in version 12.6
https://chromium-review.googlesource.com/c/v8/v8/+/5539888
This commit essentially only removes the `only_terminate_in_safe_scope` isolate creation parameter. This undoes some work that was originally done in #35766.
* 5498236: Make browser_tests force full async initialization for OSCrypt Async
https://chromium-review.googlesource.com/c/chromium/src/+/5498236
* fixup! 5528282: Move Web Speech API .mojom files to //media/mojo/mojom https://chromium-review.googlesource.com/c/chromium/src/+/5528282
* 5545807: Migrate most remaining NOTREACHED()
https://chromium-review.googlesource.com/c/chromium/src/+/5545807
I took a systematic approach to modifying all of our uses of `NOTREACHED` that were causing errors:
* If there was a `return` or `break` (etc.) immediately after `NOTREACHED`, I removed the control flow instruction and left the `NOTREACHED` unmodified
* All other instances were migrated to `NOTREACHED_IN_MIGRATION`
We should revisit pretty much all usage of `NOTREACHED` as an upgrade follow-up item.
* fixup! 5526034: [DoH] Remove kDnsOverHttps feature flag https://chromium-review.googlesource.com/c/chromium/src/+/5526034
Turns out the feature flags were removed in the `.cc` file, but not the
`.h` feature list file. This means that the feature flags are pretty
much officially gone. (The leftover symbols in the header are likely an
oversight from what I can gather.)
We may potentially decide to put this in the breaking changes doc if we
decide this feature flag is important enough to highlight.
* chore: bump chromium in DEPS to 127.0.6498.3
* chore: bump chromium in DEPS to 127.0.6500.0
* chore: bump chromium in DEPS to 127.0.6502.0
* chore: bump chromium in DEPS to 127.0.6504.0
* chore: bump chromium in DEPS to 127.0.6505.0
* chore: bump chromium in DEPS to 127.0.6508.0
* build: use Sha256Sum in script/sysroots.json
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5506275
* chore: update chore_add_electron_deps_to_gitignores.patch
Xref: no manual changes; patch applied with fuzz 2
* chore: update feat_allow_code_cache_in_custom_schemes.patch
Xref: no manual changes; patch applied with fuzz 1
* chore: e patches all
* fixup! build: use Sha256Sum in script/sysroots.json
`sync` succeeds now
* chore: replace absl::optional with std::optional
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5253843
* chore: update CalculatePreferredSize() to new upstream semantics
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5459174
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5541220
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5514708
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5504212
Xref: https://chromium-review.googlesource.com/516542
* chore: replace absl::optional with std::optional
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5296147
* chore: add kPip to enumeration as a no-op
https://chromium-review.googlesource.com/c/chromium/src/+/5546257
* [Autofill] Remove RenderFrame::ElementBoundsInWindow()
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5553982
* chore: fix feat_add_streaming-protocol_registry_to_multibuffer_data_source.patch
need new header to pick up definition of BLINK_PLATFORM_EXPORT macro
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5463143
* chore: bump chromium in DEPS to 127.0.6510.0
* chore: update patches
* chore: fix include path for native_web_keyboard_event.h
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5541976
* chore: add currently-unused should_include_device_status arg to GetPermissionStatusForCurrentDocument()
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5545382
* chore: bump chromium in DEPS to 127.0.6512.0
* chore: update mas_avoid_private_macos_api_usage.patch.patch
No manual changes; patch applied with fuzz 1
* chore: update feat_add_streaming-protocol_registry_to_multibuffer_data_source.patch
No manual changes; patch applied with fuzz 1
* chore: update webview_fullscreen.patch
No manual changes; patch applied with fuzz 1
* chore=: remove cherry-pick-22db6918bac9.patch
already present upstream
* chore: remove nonexistent patchfiles from .patches
* chore: remove cherry-pick-3e037e195e50.patch
no longer needed; merged upstream
* Update namespace for files moved to //components/input
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5563251
* Require client for InitParams to always specify an ownership mode.
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5532482
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5578714
* chore: e patches all
* fixup! Update namespace for files moved to //components/input
* chore: remove profile_keyed_service_factory, profile_selections from chromium_src
already being linked in via chrome browser for printing
* chore: bump chromium in DEPS to 127.0.6515.0
* chore: bump chromium in DEPS to 127.0.6516.0
* chore: update render_widget_host_view_base.patch
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5547803
patch applied manually due to simple upstream shear
* chore: update feat_allow_code_cache_in_custom_schemes.patch
No manual changes; patch applied with fuzz 1
* chore: e patches all
* Pull RWHIER and RWT to //content/common/input.
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5397681
* chore: bump chromium in DEPS to 127.0.6517.0
* chore: update patches
* fixup: Update namespace for files moved to //components/input
* Remove 0-arg (default) constructor for views::Widget::InitParams.
https://chromium-review.googlesource.com/c/chromium/src/+/5578714
* fixup: only disable enterprise_cloud_content_analysis
The original commit
|
||
|
|
9b0409f7c9 |
chore: bump chromium to 126.0.6445.0 (main) (#41868)
* chore: bump chromium in DEPS to 125.0.6421.0
* chore: bump chromium in DEPS to 125.0.6422.0
* Add ENABLE_BASE_TRACING flags for compatibility with enable_base_tracing = false on Windows
https://chromium-review.googlesource.com/c/chromium/src/+/5434658
* chore: update patches
* fixup: Add ENABLE_BASE_TRACING flags for compatibility with enable_base_tracing = false on Windows
* chore: bump chromium in DEPS to 126.0.6423.0
* chore: update patches
* 5426599: Next generation control of unsafe-buffers-usage plugin
https://chromium-review.googlesource.com/c/chromium/src/+/5426599
* chore: bump chromium in DEPS to 126.0.6425.0
* chore: update patches
* Roll clang+rust llvmorg-19-init-7229-g315c88c5-2 : llvmorg-19-init-8091-gab037c4f-1 / ceab6128fa48a616bfd3e3adf4bc80133b8ee223-1 : ab71ee7a9214c2793108a41efb065aa77aeb7326-1
https://chromium-review.googlesource.com/c/chromium/src/+/5444328
Also see https://issues.chromium.org/issues/332931387
* 5445074: [Views AX] Move AXEventNotificationDetails to ui/accessibility/
https://chromium-review.googlesource.com/c/chromium/src/+/5445074
Also
5455993: [Views AX] Rename AXEventNotificationDetails to AXUpdatesAndEvents | https://chromium-review.googlesource.com/c/chromium/src/+/5455993
* Pass IsolationInfo to ContentBrowserClient::WillCreateURLLoaderFactory()
https://chromium-review.googlesource.com/c/chromium/src/+/5405301
* chore: bump chromium in DEPS to 126.0.6427.0
* chore: update patches
* chore: remove no longer needed patch
perfetto is now turned on so this patch is no longer needed.
* chore: bump chromium in DEPS to 126.0.6429.0
* chore: bump chromium in DEPS to 126.0.6431.0
* chore: bump chromium in DEPS to 126.0.6433.0
* 5466654: Do not create a console if logging to a handle
https://chromium-review.googlesource.com/c/chromium/src/+/5466654
* chore: fixup patch indices
* Address Linux NonClientFrameView Changes
- https://chromium-review.googlesource.com/c/chromium/src/+/5180720
- https://chromium-review.googlesource.com/c/chromium/src/+/5367794
* chore: bump chromium in DEPS to 126.0.6435.0
* chore: bump chromium in DEPS to 126.0.6437.0
* chore: update patches
* chore: bump chromium in DEPS to 126.0.6439.0
* chore: bump chromium in DEPS to 126.0.6441.0
* 5477689: components/crash/content/tools: Format with yapf | https://chromium-review.googlesource.com/c/chromium/src/+/5477689
* 5485006: Remove enable_print_content_analysis GN flag | https://chromium-review.googlesource.com/c/chromium/src/+/5485006
* chore: update chromium patches
* chore: bump chromium in DEPS to 126.0.6443.0
* 5465608: Convert DCHECKs near RenderWidgetHost, DelegatedFrameHost to CHECK | https://chromium-review.googlesource.com/c/chromium/src/+/5465608
* 5492605: Migrate TODOs referencing old crbug IDs to the new issue tracker IDs | https://chromium-review.googlesource.com/c/chromium/src/+/5492605
* chore: update patches
* chore: bump chromium in DEPS to 126.0.6445.0
* chore: update patches
* 5468588: Fullscreen: Encapsulate ExclusiveAccessBubble params in a struct | https://chromium-review.googlesource.com/c/chromium/src/+/5468588
* fixup! 5485006: Remove enable_print_content_analysis GN flag | https://chromium-review.googlesource.com/c/chromium/src/+/5485006
* 5461340: `size_t` in `mojo::DataPipe[Consumer|Producer]Handle`: /components. | https://chromium-review.googlesource.com/c/chromium/src/+/5461340
* 5480213: Add an EvictIds struct to FrameEvictorClient | https://chromium-review.googlesource.com/c/chromium/src/+/5480213
* 4341506: [api] Deprecate Isolate::IdleNotificationDeadline | https://chromium-review.googlesource.com/c/v8/v8/+/4341506
* 5300826: [v8-tasks] Add source location to v8::TaskRunner, step 4/4. | https://chromium-review.googlesource.com/c/v8/v8/+/5300826
* partially revert is_newly_created to allow for browser initiated about:blank loads
* add dep on app_launch_prefetch
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5420149
* install sysroots from electron not from chrome
We should add a new var upstream for `download_sysroots` so that we can skip downloading chromes at all.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5462469
* refactor: make UpdateFrameHints an override
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5473548
* fix ppapi
* refactor: update namespace for pwm switches
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5444617
* 5459367: WebSQL: Restrict WebSQL service creation to Android only | https://chromium-review.googlesource.com/c/chromium/src/+/5459367
* 5455853: Revert "[Clipboard] Don't add meta charset tag for async write() method on Mac." | https://chromium-review.googlesource.com/c/chromium/src/+/5455853
* fixup! refactor: update namespace for pwm switches
|
||
|
|
1a0991a9b9 |
chore: bump chromium to 122.0.6261.6 (main) (#40949)
* chore: bump chromium in DEPS to 122.0.6239.2 * chore: update patches * refactor: extensions replaced StringPiece with string_view Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5171926 * chore: bump chromium in DEPS to 122.0.6240.0 * chore: update patches * chore: bump chromium in DEPS to 122.0.6241.5 * chore: bump chromium in DEPS to 122.0.6245.0 * chore: bump chromium in DEPS to 122.0.6247.0 * chore: bump chromium in DEPS to 122.0.6249.0 * chore: bump chromium in DEPS to 122.0.6251.0 * 5192010: Rename {absl => std}::optional in //chrome/ https://chromium-review.googlesource.com/c/chromium/src/+/5192010 * 5109767: CodeHealth: Fix leaked raw_ptr in Linux ProcessSingleton https://chromium-review.googlesource.com/c/chromium/src/+/5109767 * 5105227: [media_preview] Show requested device in permission bubble https://chromium-review.googlesource.com/c/chromium/src/+/5105227 * chore: bump chromium in DEPS to 122.0.6253.0 * chore: update patches * 5180720: Polish tiled browser window UI on Linux | https://chromium-review.googlesource.com/c/chromium/src/+/5180720 * chore: update patches * chore: bump chromium in DEPS to 122.0.6255.0 * chore: update patches * 5186276: [autopip] Make "allow once" per navigation | https://chromium-review.googlesource.com/c/chromium/src/+/5186276 * chore: bump chromium in DEPS to 122.0.6257.0 * chore: bump chromium in DEPS to 122.0.6259.0 * chore: update patches * 5190661: Automated T* -> raw_ptr<T> rewrite "refresh" | https://chromium-review.googlesource.com/c/chromium/src/+/5190661 * 5206106: Make sure RenderFrameHosts are active when printing | https://chromium-review.googlesource.com/c/chromium/src/+/5206106 * 5202674: Reland "Automated T* -> raw_ptr<T> rewrite 'refresh'" https://chromium-review.googlesource.com/c/chromium/src/+/5202674 * fixup CodeHealth: Fix leaked raw_ptr in Linux ProcessSingleton https://chromium-review.googlesource.com/c/chromium/src/+/5109767 * fixup 5206106: Make sure RenderFrameHosts are active when printing * Make legacy ToV8() helpers private to ScriptPromiseResolver, their only user https://chromium-review.googlesource.com/c/chromium/src/+/5207474 * fixup CodeHealth: Fix leaked raw_ptr in Linux ProcessSingleton * fixup 5186276: [autopip] Make "allow once" per navigation https://chromium-review.googlesource.com/c/chromium/src/+/5186276 * chore: update patches after rebase * chore: bump chromium in DEPS to 122.0.6260.0 * 5191363: Mark LOG(FATAL) [[noreturn]] https://chromium-review.googlesource.com/c/chromium/src/+/5191363 * fixup 5186276: [autopip] Make "allow once" per navigation https://chromium-review.googlesource.com/c/chromium/src/+/5186276 * fixup Make legacy ToV8() helpers private to ScriptPromiseResolver https://chromium-review.googlesource.com/c/chromium/src/+/5207474 * chore: update patches * chore: bump chromium in DEPS to 122.0.6261.0 * chore: update patches * chore: restore patch that was mistakenly removed * 5181931: Improve LoginHandler (Part 9 / N) https://chromium-review.googlesource.com/c/chromium/src/+/5181931 * Dispatch SiteInstanceGotProcess() only when both process and site are set. https://chromium-review.googlesource.com/c/chromium/src/+/5142354 * 5171446: [AsyncSB] Pass navigation_id into CreateURLLoaderThrottles https://chromium-review.googlesource.com/c/chromium/src/+/5171446 * 5213708: Move DownloadTargetInfo into components/download https://chromium-review.googlesource.com/c/chromium/src/+/5213708 * extensions: Add a loader for Controlled Frame embedder scripts https://chromium-review.googlesource.com/c/chromium/src/+/5202765 * [CSC][Zoom] Add initial_zoom_level to DisplayMediaInformation https://chromium-review.googlesource.com/c/chromium/src/+/5168626 * chore: bump chromium in DEPS to 123.0.6262.0 * chore: bump chromium in DEPS to 122.0.6261.6 * fix: suppress clang -Wimplicit-const-int-float-conversion * fixup 5191363: Mark LOG(FATAL) [[noreturn]] for Windows https://chromium-review.googlesource.com/c/chromium/src/+/5191363 * 5167921: Remove Widget::IsTranslucentWindowOpacitySupported https://chromium-review.googlesource.com/c/chromium/src/+/5167921 Also 5148392: PinnedState: Support pinned state in PlatformWindowState | https://chromium-review.googlesource.com/c/chromium/src/+/5148392 * fixup: 5180720: Polish tiled browser window UI on Linux https://chromium-review.googlesource.com/c/chromium/src/+/5180720 * 5170669: clipboard: Migrate DOMException constructors to RejectWith- https://chromium-review.googlesource.com/c/chromium/src/+/5170669 * 5178824: [Fullscreen] Record UKM data https://chromium-review.googlesource.com/c/chromium/src/+/5178824 * chore: update patches after rebase --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com> Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: VerteDinde <vertedinde@electronjs.org> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> |
||
|
|
c5b9f766f3 |
chore: bump chromium to 117.0.5923.0 (main) (#39304)
* chore: bump chromium in DEPS to 117.0.5921.0 * chore: update chromium patches * 4721409: Remove redundant ARC configuration in /components | https://chromium-review.googlesource.com/c/chromium/src/+/4721409 * 4643750: Add V8_LOW_PRIORITY_TQ for main thread | https://chromium-review.googlesource.com/c/chromium/src/+/4643750 * 4022621: Re-register status item when owner of status watcher is changed | https://chromium-review.googlesource.com/c/chromium/src/+/4022621 * chore: update V8/boringssl patches * fixup! 4643750: Add V8_LOW_PRIORITY_TQ for main thread | https://chromium-review.googlesource.com/c/chromium/src/+/4643750 * chore: bump chromium in DEPS to 117.0.5923.0 * build [debug]: remove assert 4722125: Update enterprise content analysis buildflags usage | https://chromium-review.googlesource.com/c/chromium/src/+/4722125 * chore: manually rollback to 117.0.5921.0 * build [arc]: ARC conversion in auto_updater * build [arc]: ARC conversion in browser/api * build [arc]: ARC conversion in notifications/mac * build [arc]: ARC conversion in in_app_purchase * build [arc]: ARC conversion in browser/ui * build [arc]: ARC conversion in ui/cocoa * build [arc]: ARC conversion in shell/common * build [arc]: ARC conversion in OSR * build [arc]: ARC conversion in login_helper * build [arc]: ARC conversion in app_mas * build [arc]: fix up ARC syntax (thanks @codebytere!) * 4726946: [Extensions] Work around dangling BrowserContext pointer. | https://chromium-review.googlesource.com/c/chromium/src/+/4726946 --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Keeley Hammond <vertedinde@electronjs.org> Co-authored-by: VerteDinde <keeleymhammond@gmail.com> |
||
|
|
cfc0826b65 |
chore: bump chromium to 117.0.5913.0 (main) (#39172)
* chore: bump chromium in DEPS to 117.0.5899.0 * 4686653: webui: Filter out non-chrome scheme URLs in WebUIConfigMap https://chromium-review.googlesource.com/c/chromium/src/+/4686653 * 4696355: Remove deprecated version of base::CommandLine::CopySwitchesFrom() https://chromium-review.googlesource.com/c/chromium/src/+/4696355 * chore: fixup patch indices * 4603888: Reland "Enable raw_ref check on linux" https://chromium-review.googlesource.com/c/chromium/src/+/4603888 * chore: bump chromium in DEPS to 117.0.5901.0 * chore: update patches * chore: bump chromium in DEPS to 117.0.5903.0 * chore: bump chromium in DEPS to 117.0.5903.2 * chore: bump chromium in DEPS to 117.0.5905.0 * 4706792: Printing: Add debug code for a DispatchBeforePrintEvent() failure https://chromium-review.googlesource.com/c/chromium/src/+/4706792 * 4704786: Refactor libunwind build rules/flags https://chromium-review.googlesource.com/c/chromium/src/+/4704786 * 4701710: [Linux Ui] Set toolkit dark preference based on FDO dark preference https://chromium-review.googlesource.com/c/chromium/src/+/4701710 * chore: fixup patch indices * chore: bump chromium in DEPS to 117.0.5907.0 * chore: bump chromium in DEPS to 117.0.5909.2 * chore: update patches * chore: bump chromium in DEPS to 117.0.5911.0 * chore: update patches * chore: build-what-we-include * fix: set allowFileAccess on devtools extensions correctly Ref: https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/4714725 * 4670615: Reland "[iterator-helpers] Shipping iterator helpers" https://chromium-review.googlesource.com/c/v8/v8/+/4670615 --------- Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com> Co-authored-by: Samuel Attard <marshallofsound@electronjs.org> |
||
|
|
9645f7f6d8 |
chore: bump chromium to 117.0.5884.1 (main) (#38969)
* chore: bump chromium in DEPS to 117.0.5866.0 * chore: bump chromium in DEPS to 117.0.5868.0 * chore: update mas_no_private_api.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4634925 Minor manual patch syncing due to upstream code shear * chore: update mas_disable_remote_layer.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4647191 Manually sync patch to minor upstream code shear * chore: update mas_disable_remote_accessibility.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4641746 No manual changes; patch applied with fuzz * chore: update mas_avoid_usage_of_private_macos_apis.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4634925 Manually sync base/process/launch_mac.cc to minor upstream shear Manually sync base/mac/foundation_util.mm to upstream changes: _CFIsObjC use has been removed upstream, so we no longer need to remove it 🎉 * chore: update printing.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4658496 Manually sync patch to minor upstream code shear * chore: update disable_color_correct_rendering.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4625254 Manually sync patch to minor upstream code shear * chore: update feat_expose_raw_response_headers_from_urlloader.patch Xref: services/network/public/cpp/resource_request.cc No manual changes; patch applied with fuzz * chore: update add_electron_deps_to_license_credits_file.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4634961 No manual changes; patch applied with fuzz * chore: update build_only_use_the_mas_build_config_in_the_required_components.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4648411 No manual changes; patch applied with fuzz * chore: update patches * fixup! chore: update add_electron_deps_to_license_credits_file.patch chore: license files must be an array * chore: bump chromium in DEPS to 117.0.5870.0 * chore: update patches * chore: run ./script/gen-libc++-filenames.js * chore: update json_parse_errors_made_user-friendly.patch Xref: https://chromium-review.googlesource.com/c/v8/v8/+/4652014 v8 error message changed upstream; update Node test to match it * chore: bump chromium in DEPS to 117.0.5872.0 * chore: update patches * chore: explicitly cast x11::Window to unsigned int Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4661049 This is an `enum class Window : uint32_t` defined in ui/gfx/x/xproto.h. Previous versions of clang let this implicit cast happen, but it generates a warning in the new clang roll. * chore: remove unused #include Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4650453 header was removed upstream, so FTBFS unless removed here * chore: add include guard patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4628373 h/t @jkleinsc * chore: bump chromium in DEPS to 117.0.5874.0 * chore: update render_widget_host_view_mac.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4661244 Manually sync patch to minor upstream code * chore: update mas_disable_remote_accessibility.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4653209 Manually sync patch to upstream code shear * chore: update build_only_use_the_mas_build_config_in_the_required_components.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4653209 Manually sync patch to minor upstream code shear * chore: update GetInitiatorProcessId() Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4641991 trivial upstream naming change: s/ProcessID/ProcessId/ * chore: sync to upstream SetInputRegion() changes Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4665245 Simple upstream chang: SetInputRegion() used to take a gfx::Rect* where `nullptr` meant "no opaque region". The function signature changed to absl::optional<gfx::Rect> w/the same meaning. * chore: sync to upstream SetOpaqueRegion() changes Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4656738 Simple upstream chang: SetOpaqueRegion() used to take a vector<Rect>* where `nullptr` meant "no opaque region". The function signature changed to absl::optional<std::vector<gfx::Rect>> w/the same meaning. * chore: update patches * chore: bump chromium in DEPS to 117.0.5876.0 * chore: update mas_disable_remote_accessibility.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4658375 We no longer need to patch out a field that's now removed upstream. RenderWidgetHostNSViewBridgeOwner.remote_accessibility_element_ * chore: update feat_filter_out_non-shareable_windows_in_the_current_application_in.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4658680 Manually sync patch to upstream code shear (ARC adoption). * chore: update patches * fix: -Werror,-Wshadow error in Node.js * chore: bump chromium in DEPS to 117.0.5878.0 * chore: bump chromium in DEPS to 117.0.5880.0 * chore: bump chromium in DEPS to 117.0.5880.4 * chore: update patches * 4658680: Convert /content/browser to use ARC https://chromium-review.googlesource.com/c/chromium/src/+/4658680 * 4669995: Remove CFToNSCast and NSToCFCast https://chromium-review.googlesource.com/c/chromium/src/+/4669995 * WIP: 4658680: Convert /content/browser to use ARC https://chromium-review.googlesource.com/c/chromium/src/+/4658680 * chore: update printing patch after rebase * chore: bump chromium in DEPS to 117.0.5882.0 * Revert "WIP: 4658680: Convert /content/browser to use ARC" This reverts commit |
||
|
|
d02c9f8bc6 |
chore: bump chromium to 111.0.5544.3 (main) (#36820)
* chore: bump chromium in DEPS to 111.0.5522.0 * chore: bump chromium in DEPS to 111.0.5524.0 * chore: bump chromium in DEPS to 111.0.5526.0 * chore: bump chromium in DEPS to 111.0.5528.0 * chore: update patches/chromium/mas_avoid_usage_of_private_macos_apis.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4132807 Fix simple code shear * chore: update patches/chromium/unsandboxed_ppapi_processes_skip_zygote.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4130675 Fix simple code shear * chore: update patches/chromium/hack_plugin_response_interceptor_to_point_to_electron.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4144281 Fix simple code shear; applied cleanly w/patch-fuzz * chore: update patches/chromium/disable_unload_metrics.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4126173 Fix simple code shear; applied cleanly w/patch-fuzz * chore: update patches/chromium/feat_add_data_parameter_to_processsingleton.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4144281 Fix simple code shear; applied cleanly w/patch-fuzz * chore: update patches/chromium/preconnect_manager.patch https://chromium-review.googlesource.com/c/chromium/src/+/4144281 Fix simple code shear; applied cleanly w/patch-fuzz * chore: update patches/v8/force_cppheapcreateparams_to_be_noncopyable.patch https://chromium-review.googlesource.com/c/v8/v8/+/3533019 Fix simple code shear; applied cleanly w/patch-fuzz * chore: update patches * chore: update patches/chromium/add_maximized_parameter_to_linuxui_getwindowframeprovider.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4128765 Upstream added a new call to HeaderContext(), whose signature we have patched * chore: bump chromium in DEPS to 111.0.5530.0 * chore: update patches * Move ChildProcessHost* from content/common to content/browser Xref: Move ChildProcessHost* from content/common to content/browser * Remove RenderViewHostChanged Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4134103 [upstream removal of RenderViewHostChanged] Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4092763 Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4093234 Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4133892 Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4134103 [examples of upstream code adjusting to the change] Upstream handles this change in roughly two approaches: 1. Move the code over to RenderFrameHostChanged(old_host, new_host) but test for new_host->IsInPrimaryMainFrame() before acting 2. Migrate to the PrimaryPageChanged(page) API and use page.GetMainDocument() to get the RenderFrameHost. I've chosen 1. because electron_api_web_contents needed that pointer to old_host to call RemoveInputEventListener(), but I may be missing some context & would appreciate review on this commit. * Make electron/shell/browser/relauncher_win.cc use <winternl.h> Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4129135 Many internal Windows types are now available in winternl.h so upstrem no longer defines the types themselves. * Move ChildProcessHost* from content/common to content/browser Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4134795 * fixup! Make electron/shell/browser/relauncher_win.cc use <winternl.h> winternl.h does not define the field we need, so clone the struct Chromium was using into unnamed namespace * fixup! Move ChildProcessHost* from content/common to content/browser chore: update #includes too * chore: bump chromium in DEPS to 111.0.5532.0 * chore: sync patches/chromium/pepper_plugin_support.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4133323 manually reync patch; no code changes * chore: sync patches/chromium/mas_no_private_api.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4143865 the content/common/pseudonymization_salt.cc patch is no longer needed * chore: sync patches/chromium/mas_disable_remote_accessibility.patch patch-fuzz update; no manual changes * chore: sync patches/chromium/build_do_not_depend_on_packed_resource_integrity.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4111725 manually reync patch; no code changes * chore: sync patches/chromium/create_browser_v8_snapshot_file_name_fuse.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4133323 manually reync patch; no code changes * chore: sync patches/v8/fix_build_deprecated_attribute_for_older_msvc_versions.patch Xref: https://chromium-review.googlesource.com/c/v8/v8/+/4127230 patch-fuzz update; no manual changes * chore: rebuild patches * fixup! Remove RenderViewHostChanged Use PrimaryPageChanged() * chore: remove unused method TabsUpdateFunction::OnExecuteCodeFinished() Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4133991 This private, already-unused function showed up as a FTBFS because it took a base::ListValue parameter and ListValue was removed upstream. * task posting v3: remove includes of runner handles and IWYU task runners Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4133323 * chore: lint * chore: more lint * fixup! task posting v3: remove includes of runner handles and IWYU task runners macOS, too * fixup! task posting v3: remove includes of runner handles and IWYU task runners * chore: bump chromium in DEPS to 111.0.5534.0 * chore: sync patches/chromium/allow_new_privileges_in_unsandboxed_child_processes.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4141862 patch-fuzz update; no manual changes * chore: sync patches/chromium/logging_win32_only_create_a_console_if_logging_to_stderr.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4153110 Sync to minor upstream changes. Add const correctness. * chore: sync electron/patches/chromium/feat_configure_launch_options_for_service_process.patch https://chromium-review.googlesource.com/c/chromium/src/+/4141862 patch-fuzz update; no manual changes * chore: patches/v8/fix_build_deprecated_attribute_for_older_msvc_versions.patch sync https://chromium-review.googlesource.com/c/v8/v8/+/4147787 patch-fuzz update; no manual changes * chore: update patches * chore: bump chromium in DEPS to 111.0.5536.0 * chore: sync patches/chromium/allow_new_privileges_in_unsandboxed_child_processes.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4141863 Sync with upstream code changes. Minor code golf for readability. Note: upstream is laying groundwork for being able to work off of env vars instead of switches. Doesn't affect us yet but worth being aware of. > + // Environment variables could be supported in the future, but are not > + // currently supported when launching with the zygote. * chore: update patches/chromium/feat_expose_raw_response_headers_from_urlloader.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4126836 patch-fuzz update; no manual changes * chore: sync electron/patches/chromium/feat_configure_launch_options_for_service_process.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/4141863 manual sync * chore: sync electron/patches/v8/fix_build_deprecated_attribute_for_older_msvc_versions.patch https://chromium-review.googlesource.com/c/v8/v8/+/4147788 fuzz-patch * chore: rebuild patches * chore: bump chromium in DEPS to 111.0.5538.0 * chore: bump chromium in DEPS to 111.0.5540.0 * chore: update patches * Remove sdk_forward_declarations https://chromium-review.googlesource.com/c/chromium/src/+/4166680 * task posting v3: Remove task runner handles from codebase entirely Refs https://chromium-review.googlesource.com/c/chromium/src/+/4150928 * Cleanup child_process_launcher_helper* Refs https://chromium-review.googlesource.com/c/chromium/src/+/4141863 * fix: utilityprocess spec on macOS * fix: build on windows Refs https://chromium-review.googlesource.com/c/chromium/src/+/4141863 * chore: fix lint * chore: bump chromium 111.0.5544.3 * chore: gen filenames.libcxx.gni * Add check for Executable+Writable handles in renderer processes. Refs https://chromium-review.googlesource.com/c/chromium/src/+/3774416 * fixup! Add check for Executable+Writable handles in renderer processes. * 4143761: [110] Disable SwiftShader for WebGL on M1 Macs. https://chromium-review.googlesource.com/c/chromium/src/+/4143761 (cherry picked from commit |
||
|
|
16f459228b |
chore: bump chromium to 108.0.5329.0 (main) (#35628)
Co-authored-by: Samuel Attard <sattard@salesforce.com> Co-authored-by: VerteDinde <vertedinde@electronjs.org> Co-authored-by: Keeley Hammond <khammond@slack-corp.com> Co-authored-by: Jeremy Rose <jeremya@chromium.org> |
||
|
|
08ccc81574 |
chore: bump chromium to 107.0.5274.0 (main) (#35375)
* chore: bump chromium in DEPS to 106.0.5247.1 * chore: update can_create_window.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3805043 content/renderer/render_view_impl.cc was removed * chore: update patches/chromium/printing.patch Normal code shear. * chore: update patches/chromium/add_contentgpuclient_precreatemessageloop_callback.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3764862 fix minor code shear that caused the patch to not apply * chore: update patches/chromium/picture-in-picture.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3781646 Normal code shear. * chore: update patches/chromium/allow_disabling_blink_scheduler_throttling_per_renderview.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3805043 content/renderer/render_view_impl.cc was removed Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3792324 Normal code shear. * chore: update patches/chromium/feat_add_streaming-protocol_registry_to_multibuffer_data_source.patch Normal code shear. * chore: update patches/chromium/fix_patch_out_profile_refs_in_accessibility_ui.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3798548 Normal code shear. * chore: update patches/chromium/build_disable_print_content_analysis.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3810473 Normal code shear. * chore: short-circuit_permissions_checks_in_mediastreamdevicescontroller.patch Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3807504 Normal code shear. * chore: update patches * chore: bump chromium in DEPS to 106.0.5249.0 * chore: bump chromium in DEPS to 107.0.5250.0 * chore: bump chromium in DEPS to 107.0.5252.0 * chore: bump chromium in DEPS to 107.0.5254.0 * chore: bump chromium in DEPS to 107.0.5256.1 * chore: update v8 patches * chore: update chromium patches * [CodeHealthRotation] base::Value::Dict (v2) migration for //c/b/ui/zoom Refs https://chromium-review.googlesource.com/c/chromium/src/+/3778239 * Add support for snapped window states for lacros https://chromium-review.googlesource.com/c/chromium/src/+/3810538 * webui: Migrate /chrome/browser/ui/webui URLDataSources to GetMimeType(GURL) Refs https://chromium-review.googlesource.com/c/chromium/src/+/3774560 * Provide explicit template arguments to blink::AssociatedInterfaceRegistry::AddInterface Refs https://chromium-review.googlesource.com/c/chromium/src/+/3773459 * Make WebScriptExecutionCallback base::OnceCallback Refs https://chromium-review.googlesource.com/c/chromium/src/+/3676532 https://chromium-review.googlesource.com/c/chromium/src/+/3724623 https://chromium-review.googlesource.com/c/chromium/src/+/3675752 * Add implementation of reduce accept language service Refs https://chromium-review.googlesource.com/c/chromium/src/+/3687391 * Add PermissionResult in //content/public. Refs https://chromium-review.googlesource.com/c/chromium/src/+/3807504 * [Extensions] Add new Webstore domain to extension URLs and clients Refs https://chromium-review.googlesource.com/c/chromium/src/+/3793043 * chore: update node patches * chore: fix lint * chore: update filenames.libcxx.gni * fixup! Make WebScriptExecutionCallback base::OnceCallback * chore: bump chromium in DEPS to 107.0.5266.1 * chore: bump chromium in DEPS to 107.0.5268.0 * chore: bump chromium in DEPS to 107.0.5270.1 * chore: update patches * 3848842: [DevTools] Added 'printing-in-progress' error code. https://chromium-review.googlesource.com/c/chromium/src/+/38488 * 3855766: PA: Move the allocator shim files into partition_allocator/shim/ | https://chromium-review.googlesource.com/c/chromium/src/+/3855766 * Change gfx::Rect to blink::mojom::WindowFeatures in AddNewContents and some related functions. https://chromium-review.googlesource.com/c/chromium/src/+/3835666 * Use base::FunctionRef for the various ForEachRenderFrameHost helpers. https://chromium-review.googlesource.com/c/chromium/src/+/3767487 * [loader] Send cached metadata as part of OnReceiveResponse https://chromium-review.googlesource.com/c/chromium/src/+/3811219 * 3832927: [json-schema-compiler] Support abs::optional<int> https://chromium-review.googlesource.com/c/chromium/src/+/3832927 * Use unique_ptr for BrowserPluginGuestDelegate::CreateNewGuestWindow https://chromium-review.googlesource.com/c/chromium/src/+/3847070 * 3847044: [Android] Dismiss select popup upon entering fullscreen https://chromium-review.googlesource.com/c/chromium/src/+/3847044 * chore: update patches * chore: add missing header * Migration of chrome/ BrowserContextKeyedServiceFactory to ProfileKeyedServiceFactory Part 12 https://chromium-review.googlesource.com/c/chromium/src/+/3804581 * 3786946: cast pwrite64 arg to long to avoid compilation error on arm https://chromium-review.googlesource.com/c/linux-syscall-support/+/3786946 * chore: update patches after rebase * 3846114: float: Implement for lacros p2. https://chromium-review.googlesource.com/c/chromium/src/+/3846114 * 3825237: Enable -Wunqualified-std-cast-call https://chromium-review.googlesource.com/c/chromium/src/+/3825237 * chore: bump chromium in DEPS to 107.0.5272.0 * chore: update patches * 3835746: Rename PepperPluginInfo to ContentPluginInfo https://chromium-review.googlesource.com/c/chromium/src/+/3835746 * 3852542: Plumb drag-image rect from blink to browser to RenderWidgetHostImpl https://chromium-review.googlesource.com/c/chromium/src/+/3852542 * 3826169: [json-schema-compiler] Support abs::optional<bool> https://chromium-review.googlesource.com/c/chromium/src/+/3826169 Also 3840687: [json-schema-compiler] Support abs::optional<double> https://chromium-review.googlesource.com/c/chromium/src/+/3840687 * 3857319: Reland "Remove PrefService::Get" https://chromium-review.googlesource.com/c/chromium/src/+/3857319 * 3854614: Rework LinuxUi ownership and creation https://chromium-review.googlesource.com/c/chromium/src/+/3854614 * chore: bump chromium in DEPS to 107.0.5274.0 * 3866104: [DownloadBubble] Change download notifications in exclusive_access https://chromium-review.googlesource.com/c/chromium/src/+/3866104 * chore: update patches * chore: disable optimization guide for preconnect feature * 3860569: Enable -Wshadow on Linux. https://chromium-review.googlesource.com/c/chromium/src/+/3860569 * chore: update patches after rebase * fixup: update to accomodate Wc++98-compat-extra-semi flag * Revert "fixup! Make WebScriptExecutionCallback base::OnceCallback" This reverts commit 0866fe8648671f04e4ea45ceed85db6e4a3b260b. * fixup! Make WebScriptExecutionCallback base::OnceCallback * fixup! Make WebScriptExecutionCallback base::OnceCallback * 3840937: [sandbox] Merge V8_SANDBOXED_POINTERS into V8_ENABLE_SANDBOX https://chromium-review.googlesource.com/c/v8/v8/+/3840937 * fixup! chore: update can_create_window.patch * chore: update patches * 53946: Track SSL_ERROR_ZERO_RETURN explicitly. https://boringssl-review.googlesource.com/c/boringssl/+/53946 * fixup: Migration of chrome/ BrowserContextKeyedServiceFactory to ProfileKeyedServiceFactory Part 12 https://chromium-review.googlesource.com/c/chromium/src/+/3804581 * 3805932: [headless] Added print compositor support for OOPIF printing. https://chromium-review.googlesource.com/c/chromium/src/+/3805932 Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Charles Kerr <charles@charleskerr.com> Co-authored-by: deepak1556 <hop2deep@gmail.com> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> |
||
|
|
97b353a30a | chore: bump chromium to 106.0.5216.0 (main) (#34993) | ||
|
|
f3e0517b6e |
chore: bump chromium to 102.0.4999.0 (main) (#33731)
* chore: bump chromium in DEPS to 102.0.4999.0 * 3576640: Set OOM handler during V8 initialization https://chromium-review.googlesource.com/c/chromium/src/+/3576640 * 3574964: Remove deprecated base::Value usage in print_settings_conversion code. https://chromium-review.googlesource.com/c/chromium/src/+/3574964 * 3570062: Replicate Active state to render process for all RenderViews. https://chromium-review.googlesource.com/c/chromium/src/+/3570062 * chore: fixup patch indices * 3380402: Remove legacy SwiftShader https://chromium-review.googlesource.com/c/chromium/src/+/3380402 * 3570254: [Local Fonts] Rename permission name from FONT_ACCESS to LOCAL_FONTS. https://chromium-review.googlesource.com/c/chromium/src/+/3570254 * 3572172: Rename or remove several parameters involved in creation of MimeHandler streams https://chromium-review.googlesource.com/c/chromium/src/+/3572172 * fix: add missing base/bits include * chore: fix lint * chore: remove ia32 Linux support * chore: patch out swift-format cipd dep on macOS * build: apply patch better * build: reset all caches * build: update zip manifests to remove swiftshared libraries Refs: https://chromium-review.googlesource.com/c/chromium/src/+/3380402 * Revert "build: update zip manifests to remove swiftshared libraries" This reverts commit 6aeec01ef1a79425a7b7d8c1cfb131a26b91c494. * Revert "3380402: Remove legacy SwiftShader" This reverts commit 4c7eebbbf2d0a459cc192959e17ae20f970c2da2. * build: remove unused swiftshader egl libraries Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: Samuel Attard <sattard@salesforce.com> |
||
|
|
3da598015b |
chore: bump chromium to 100.0.4894.0 (main) (#32852)
* chore: bump chromium in DEPS to 100.0.4880.0 * resolve conflicts * chore: update patches * fix patch * PIP20: add a new DocumentOverlayWindowViews subtype https://chromium-review.googlesource.com/c/chromium/src/+/3252789 * Clean up PictureInPictureWindowManager::EnterPictureInPicture() https://chromium-review.googlesource.com/c/chromium/src/+/3424145 * Remove StoragePartitionId. https://chromium-review.googlesource.com/c/chromium/src/+/2811120 * Remove FLoC code https://chromium-review.googlesource.com/c/chromium/src/+/3424359 * media: Make AddSupportedKeySystems() Async https://chromium-review.googlesource.com/c/chromium/src/+/3430502 * [Extensions] Move some l10n file util methods to //extensions/browser https://chromium-review.googlesource.com/c/chromium/src/+/3408192 * chore: IWYU * Reland "webhid: Grant permissions for policy-allowed devices" https://chromium-review.googlesource.com/c/chromium/src/+/3444147 * Migrate base::Value::GetList() to base::Value::GetListDeprecated(): 2/N. https://chromium-review.googlesource.com/c/chromium/src/+/3435727 https://chromium-review.googlesource.com/c/chromium/src/+/3440910 https://chromium-review.googlesource.com/c/chromium/src/+/3440088 * [text blink period] Cache blink period instead of fetching from defaults https://chromium-review.googlesource.com/c/chromium/src/+/3419059 * chore: update picture-in-picture.patch https://chromium-review.googlesource.com/c/chromium/src/+/3252789 * ci: update to Xcode 13.2.1 https://chromium-review.googlesource.com/c/chromium/src/+/3437552 * chore: bump chromium in DEPS to 100.0.4882.1 * chore: update patches * chore: bump chromium in DEPS to 100.0.4884.0 * chore: update patches * chore: bump chromium in DEPS to 100.0.4886.0 * chore: update patches * Refactor DownloadManager to use StoragePartitionConfig https://chromium-review.googlesource.com/c/chromium/src/+/3222011 * Remove ToWebInputElement() in favor of new WebNode::DynamicTo<> helpers. https://chromium-review.googlesource.com/c/chromium/src/+/3433852 * refactor: autofill to use the color pipeline https://bugs.chromium.org/p/chromium/issues/detail?id=1249558 https://bugs.chromium.org/p/chromium/issues/detail?id=1003612 * [ProcessSingleton] Add many more trace events to cover all scenarios https://chromium-review.googlesource.com/c/chromium/src/+/3429325 * fixup! PIP20: add a new DocumentOverlayWindowViews subtype * chore: bump chromium in DEPS to 100.0.4888.0 * chore: update patches * chore: update picture-in-picture.patch * fixup! refactor: autofill to use the color pipeline * ci: fixup fix sync (cherry picked from commit c1e3e395465739bce5ca8e1c5ec1f5bd72b99ebd) * chore: bump chromium in DEPS to 100.0.4889.0 * chore: update patches * chore: fix feat_add_data_transfer_to_requestsingleinstancelock.patch * fixup! PIP20: add a new DocumentOverlayWindowViews subtype * Remove remaining NativeTheme::GetSystemColor() machinery. https://chromium-review.googlesource.com/c/chromium/src/+/3421719 * ci: fetch proper esbuild for macos * ci: fixup fetch proper esbuild for macos * fix: failing Node.js test on outdated CurrentValueSerializerFormatVersion * chore: bump chromium in DEPS to 100.0.4892.0 * 3460365: Set V8 fatal error callbacks during Isolate initialization https://chromium-review.googlesource.com/c/chromium/src/+/3460365 * 3454343: PIP20: use permanent top controls https://chromium-review.googlesource.com/c/chromium/src/+/3454343 * 3465574: Move most of GTK color mixers to ui/color/. https://chromium-review.googlesource.com/c/chromium/src/+/3465574 * chore: fixup patch indices * 3445327: [locales] Remove locales reference https://chromium-review.googlesource.com/c/chromium/src/+/3445327 * 3456548: [DBB][#7] Blue border falls back to all tab if cropped-to zero pixels https://chromium-review.googlesource.com/c/chromium/src/+/3456548 * 3441196: Convert GuestView's remaining legacy IPC messages to Mojo https://chromium-review.googlesource.com/c/chromium/src/+/3441196 * 3455491: Don't include run_loop.h in thread_task_runner_handle.h https://chromium-review.googlesource.com/c/chromium/src/+/3455491 * fixup! 3454343: PIP20: use permanent top controls * 3442501: Add missing includes of //base/observer_list.h https://chromium-review.googlesource.com/c/chromium/src/+/3442501 * 3437552: mac: Deploy a new hermetic build of Xcode 13.2.1 13C100 https://chromium-review.googlesource.com/c/chromium/src/+/3437552 * chore: bump chromium in DEPS to 100.0.4894.0 * fixup! 3460365: Set V8 fatal error callbacks during Isolate initialization * chore: update patches * 3425231: Use DnsOverHttpsConfig where appropriate https://chromium-review.googlesource.com/c/chromium/src/+/3425231 * test: disable test-heapsnapshot-near-heap-limit-worker.js As a result of CLs linked in https://bugs.chromium.org/p/v8/issues/detail?id=12503, heap snapshotting near the heap limit DCHECKS in Node.js specs. This will likely require a larger refactor in Node.js so i've disabled the test for now and opened an upstream issue on node-v8 issue at https://github.com/nodejs/node-v8/issues/218. * Port all usage of NativeTheme color IDs to color pipeline https://bugs.chromium.org/p/chromium/issues/detail?id=1249558 * chore: update patches after rebase * ci: use gen2 machine for more disk space * ci: don't try to make root volume writeable * ci: use older xcode/macos for tests * fix: html fullscreen transitions stacking (cherry picked from commit 5e10965cdd7b2a024def5fc568912cefd0f05b44) * ci: speed up woa testing (cherry picked from commit 75c33c48b032137794f5734348a9ee3daa60d9de) (cherry picked from commit |
||
|
|
28ada6ea8b |
chore: bump chromium to 100.0.4857.0 (main) (#32419)
* chore: bump chromium in DEPS to 99.0.4819.0 * chore: update patches * chore: bump chromium in DEPS to 99.0.4824.0 * chore: update patches * chore: bump chromium in DEPS to 99.0.4827.0 * chore: update patches * 3352511: PiP: Add inkdrop and pointer cursor to PiP window buttons https://chromium-review.googlesource.com/c/chromium/src/+/3352511 * 3309164: webhid: Show FIDO devices in the chooser if allowed https://chromium-review.googlesource.com/c/chromium/src/+/3309164 * 3297868: hid: Add experimental HIDDevice.forget() https://chromium-review.googlesource.com/c/chromium/src/+/3297868 * 3362491: [Extensions] Move i18n API to //extensions https://chromium-review.googlesource.com/c/chromium/src/+/3362491 * MCC Refactor step0: Allow embedders to register associated_interface binders with RenderFrameHostImpl::associated_registry_. https://chromium-review.googlesource.com/c/chromium/src/+/3281481 * 3352616: [Gtk] Remove libgtk from the link-line https://chromium-review.googlesource.com/c/chromium/src/+/3352616 * 3249211: Clear-Site-Data support for partitioned cookies https://chromium-review.googlesource.com/c/chromium/src/+/3249211 * [Extensions][COIL] Use [allow|block]list in //extensions/common https://chromium-review.googlesource.com/c/chromium/src/+/3372668 * Begin ScopedUserPrefUpdate migration to modern base::Value https://chromium-review.googlesource.com/c/chromium/src/+/3376154 * [Code Health] Refactor PrefService GetDict + GetList to use base::Value https://chromium-review.googlesource.com/c/chromium/src/+/3343526 * 3354997: [CodeHealth] Remove deprecated SetDictionary method https://chromium-review.googlesource.com/c/chromium/src/+/3354997 * 3287323: Add LacrosPrefStore for lacros settings https://chromium-review.googlesource.com/c/chromium/src/+/3287323 * 3365916: [PA] Clean up remaining lazy commit code https://chromium-review.googlesource.com/c/chromium/src/+/3365916 * [MPArch] Target the external protocol error at the responsible frame. https://chromium-review.googlesource.com/c/chromium/src/+/3011560 * Pass origin to RegisterNonNetworkSubresourceURLLoaderFactories https://chromium-review.googlesource.com/c/chromium/src/+/3350608 * Linux: Send OSCrypt raw encryption key to the Network Service https://chromium-review.googlesource.com/c/chromium/src/+/3320484 * [PlzServiceWorker] Remove remaining references to PlzServiceWorker. https://chromium-review.googlesource.com/c/chromium/src/+/3359441 * chore: fixup for lint * 3327621: Fix tablet mode detection for Win 11. https://chromium-review.googlesource.com/c/chromium/src/+/3327621 * 3342428: ax_mac: move AXTextMarker conversion utils under ui umbrella https://chromium-review.googlesource.com/c/chromium/src/+/3342428 * 3353974: Mac: Use base::Feature for overlay features https://chromium-review.googlesource.com/c/chromium/src/+/3353974 * chore: bump chromium in DEPS to 99.0.4828.0 * chore: update patches * chore: bump chromium in DEPS to 99.0.4837.0 * chore: update patches * chore: update patches * 3379142: Drop FALLTHROUGH macro Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3379142 * 3381749: C++17: Allow use of std::map::try_emplace and std::map::insert_or_assign Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3381749 * chore: bump chromium in DEPS to 99.0.4839.0 * chore: update patches * chore: bump chromium in DEPS to 99.0.4840.0 * chore: bump chromium in DEPS to 99.0.4844.0 * 3395881: [api] Deprecate Local<v8::Context> v8::Object::CreationContext() Ref: https://chromium-review.googlesource.com/c/v8/v8/+/3395881 * chore: update patches * chore: bump chromium in DEPS to 100.0.4845.0 * chore: update patches * chore: bump chromium in DEPS to 100.0.4847.0 * chore: update patches * chore: bump chromium in DEPS to 100.0.4849.0 * chore: update patches * chore: bump chromium in DEPS to 100.0.4851.0 * chore: bump chromium in DEPS to 100.0.4853.0 * update patches * chore: update patches * update patches * 3383599: Fonts Access: Remove prototype that uses a font picker. https://chromium-review.googlesource.com/c/chromium/src/+/3383599 * 3404768: Remove ALLOW_UNUSED macros https://chromium-review.googlesource.com/c/chromium/src/+/3404768 * 3374762: Remove ignore_result.h https://chromium-review.googlesource.com/c/chromium/src/+/3374762 * 3399305: [unseasoned-pdf] Apply proper frame offsets for touch selections https://chromium-review.googlesource.com/c/chromium/src/+/3399305 * 3402210: [Extensions] Don't trigger unload event for already unloaded extension https://chromium-review.googlesource.com/c/chromium/src/+/3402210 * 3410912: Combine URLLoaderClient OnReceiveResponse and OnStartLoadingResponseBody. https://chromium-review.googlesource.com/c/chromium/src/+/3410912 * 3370428: Make the AuthSchemes policy support dynamic refresh https://chromium-review.googlesource.com/c/chromium/src/+/3370428 * 3407603: Finish ScopedUserPrefUpdate migration to modern base::Value https://chromium-review.googlesource.com/c/chromium/src/+/3407603 * 3378352: ozone/x11: move code from //ui/p/x11 to //ui/ozone/p/x11 https://chromium-review.googlesource.com/c/chromium/src/+/3378352 * 3370810: Delete chrome/service, AKA the Cloud Print service process. https://chromium-review.googlesource.com/c/chromium/src/+/3370810 * chore: bump chromium in DEPS to 100.0.4855.0 * chore: update patches * fixup! 3370810: Delete chrome/service, AKA the Cloud Print service process. * revert 3348007 to fix windows build * 3318572: [Code health] Fix gn check errors in //extensions/browser:* https://chromium-review.googlesource.com/c/chromium/src/+/3318572 * fix printing.patch * fix iwyu issue * 3408515: win: Make ShorcutOperation an enum class and modernize names https://chromium-review.googlesource.com/c/chromium/src/+/3408515 * 3388333: [UIA] Remove dead code accessibility_misc_utils.h/cc https://chromium-review.googlesource.com/c/chromium/src/+/3388333 * fix windows build? i hope * patch gn visibility of //ui/ozone/platform/x11 * missing include base/logging.h * use BUILDFLAG for USE_NSS_CERTS https://chromium-review.googlesource.com/c/chromium/src/+/3379123 * defined(OS_*) ==> BUILDFLAG(IS_*) https://bugs.chromium.org/p/chromium/issues/detail?id=1234043 * fixup! 3404768: Remove ALLOW_UNUSED macros * another attempt to fix windows build * temporarily disable the custom scheme service worker test https://github.com/electron/electron/issues/32664 * fix loading mv3 extensions not sure what cl broke this unfort. * fixup! 3404768: Remove ALLOW_UNUSED macros * patch nan https://chromium-review.googlesource.com/c/v8/v8/+/3395880 * fix node test * fix nullptr in FindPdfFrame * patch perfetto to fix build issue on win-ia32 |
||
|
|
b0f315a637 |
chore: bump chromium to 99.0.4767.0 (main) (#31986)
* chore: bump chromium in DEPS to 98.0.4726.0 * 3292117: Remove unneeded base/compiler_specific.h includes in //chrome. https://chromium-review.googlesource.com/c/chromium/src/+/3292117 * 3289198: Enables calculating line, word and sentence boundaries on the browser https://chromium-review.googlesource.com/c/chromium/src/+/3289198 * 3276176: Remove expired gdi-text-printing flag and associated code. https://chromium-review.googlesource.com/c/chromium/src/+/3276176 * 3240963: content: allow embedder to prevent locking scheme registry https://chromium-review.googlesource.com/c/chromium/src/+/3240963 * 3269899: Rename WebContentsImpl::GetFrameTree to GetPrimaryFrameTree https://chromium-review.googlesource.com/c/chromium/src/+/3269899 * chore: fixup patch indices * 3276279: Enable -Wshadow by default for the "chromium code" config. https://chromium-review.googlesource.com/c/chromium/src/+/3276279 * 3279737: appcache: Remove WebPreference/WebSetting https://chromium-review.googlesource.com/c/chromium/src/+/3279737 * 3275564: [api] Advance API deprecation for APIs last marked in v9.6 https://chromium-review.googlesource.com/c/v8/v8/+/3275564 * 3261873: Clean up WebScriptSource constructors https://chromium-review.googlesource.com/c/chromium/src/+/3261873 * 3279346: appcache: Remove ConsoleMessage appcache field https://chromium-review.googlesource.com/c/chromium/src/+/3279346 * 3264212: Move legacy file loading to legacy_test_runner https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/3264212 Both Persistence and UI have been removed from globals, but the issues they seemed to be patching are no longer reproducible from what I can tell, and so we can just delete these and re-evaluate if something surfaces. * 3290415: x11: remove the USE_X11 define. https://chromium-review.googlesource.com/c/chromium/src/+/3290415 * chore: bump Chromium to 98.0.4728.0 * 3179530: Defer system calls in PrintingContext for OOP printing https://chromium-review.googlesource.com/c/chromium/src/+/3179530 * 3299445: Consolidate is_win conditionals in chrome/test/BUILD.gn. https://chromium-review.googlesource.com/c/chromium/src/+/3299445 * chore: update patch indices * 3223975: Break PrintJobWorker OOP logic into separate class https://chromium-review.googlesource.com/c/chromium/src/+/3223975 * chore: bump chromium in DEPS to 98.0.4730.0 * 3279001: Remove support for font-family: -webkit-pictograph https://chromium-review.googlesource.com/c/chromium/src/+/3279001 * chore: fixup patch indices * chore: bump chromium in DEPS to 98.0.4732.0 * chore: update patches * chore: bump chromium in DEPS to 98.0.4734.0 * chore: bump chromium in DEPS to 98.0.4736.0 * chore: update patches * chore: update printing patch for miracle ptr * chore: add noexcept to fix clang error * chore: bump chromium in DEPS to 98.0.4738.0 * chore: update patches * chore: bump chromium in DEPS to 98.0.4740.0 * chore: bump chromium in DEPS to 98.0.4742.0 * chore: bump chromium in DEPS to 98.0.4744.0 * chore: bump chromium in DEPS to 98.0.4746.0 * chore: bump chromium in DEPS to 98.0.4748.0 * chore: bump chromium in DEPS to 98.0.4750.0 * chore: update patches * 3293841: Remove File Handling permissions code Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3293841 * chore: update patches 3311700: Move the PpapiPluginSandboxedProcessLauncherDelegate | https://chromium-review.googlesource.com/c/chromium/src/+/3311700 * 3289260: [CodeHealth]: Remove uses of Notification Service Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3289260 * 3301600: Disable scripted print in fenced frames Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3301600 * chore: add missing thread_restrictions headers * 3305132: Rewrite most `Foo* field_` pointer fields to `raw_ptr<Foo> field_`. Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3305132 * fix: add ppapi_sandbox header for linux 3311700: Move the PpapiPluginSandboxedProcessLauncherDelegate | https://chromium-review.googlesource.com/c/chromium/src/+/3311700 * chore: manually bump chromium in DEPS to 98.0.4757.0 * chore: update patches * 3321044: Remove DictionaryValue::Clear() Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3321044 * chore: update printing.patch Refs: - 3304556: [code health] Remove notification observation from PrintJob. | https://chromium-review.googlesource.com/c/chromium/src/+/3304556 - 3305095: [code health] Remove NotificationService from PrintViewManagerBase. | https://chromium-review.googlesource.com/c/chromium/src/+/3305095 * build: add v8-embedder-state headers to GN patch * chore: bump chromium in DEPS to 99.0.4767.0 * chore: update patches * chore: rename CookiePartitionKeychain ...to CookiePartitionKeyCollection * chore: update video consumers * refactor: use newer base::Value API * 3232598: Convert net::DnsOverHttpsServerConfig into a class | https://chromium-review.googlesource.com/c/chromium/src/+/3232598 * 3327865: Remove the default WebContentsUserData ctor. | https://chromium-review.googlesource.com/c/chromium/src/+/3327865 * 3302814: DevTools: Add getPreference binding | https://chromium-review.googlesource.com/c/chromium/src/+/3302814 * 3301474: [tq][runtime] Use build flags for JS context promise hooks | https://chromium-review.googlesource.com/c/v8/v8/+/3301474 * oops 😵💫 * 3272411: Reland "base/allocator: Enable PartitionAlloc-Everywhere on macOS" | https://chromium-review.googlesource.com/c/chromium/src/+/3272411 build: turn PartitionAlloc back off on mac for now * fix: WCO method got renamed * 3344749: Revert "Stop using NSRunLoop in renderer process" https://chromium-review.googlesource.com/c/chromium/src/+/3344749 * 3288746: [serial] Fix BluetoothSerialDeviceEnumerator threading issues. https://chromium-review.googlesource.com/c/chromium/src/+/3288746 * Revert "3288746: [serial] Fix BluetoothSerialDeviceEnumerator threading issues." This reverts commit 5cc69f102e43ca72ac9ef45063711bcc7d849740. * chore: disable serial device enumerator sequence dcheck * fix: comment out line in DeviceService dtor * fixup! 3279001: Remove support for font-family: -webkit-pictograph * fixup! 3279346: appcache: Remove ConsoleMessage appcache field * chore: update patches after rebase Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com> Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com> Co-authored-by: VerteDinde <khammond@slack-corp.com> Co-authored-by: clavin <clavin@electronjs.org> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> Co-authored-by: Jeremy Rose <jeremya@chromium.org> |
||
|
|
bd10b19b0c |
chore: bump chromium to 98.0.4706.0 (main) (#31555)
* chore: bump chromium in DEPS to 97.0.4678.0
* chore: bump chromium in DEPS to 97.0.4679.0
* chore: bump chromium in DEPS to 97.0.4680.0
* chore: bump chromium in DEPS to 97.0.4681.0
* chore: bump chromium in DEPS to 97.0.4682.0
* chore: update patches
* 3234737: Disable -Wunused-but-set-variable
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3234737
* 3216953: Reland "Move task-related files from base/ to base/task/"
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3216953
* 3202710: TimeDelta factory function migration.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3202710
* 3226841: Rename WCO::RenderProcessGone to PrimaryMainFrameRenderProcessGone
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3226841
* 3212165: blink/gin: changes blink to load snapshot based on runtime information
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3212165
* 3220292: Deprecate returning a GURL from GURL::GetOrigin()
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3220292
* 3231995: build: Enable -Wbitwise-instead-of-logical everywhere except iOS and Windows
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3231995
* 3205121: Remove base::DictionaryValue::GetDouble
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3205121
* 3208413: [flags] Make --js-flags settings have priority over V8 features
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3208413
* chore: bump chromium in DEPS to 97.0.4683.0
* chore: update patches
* 3188834: Combine RWHVBase GetCurrentDeviceScaleFactor/GetDeviceScaleFactor
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3188834
* chore: update process_singleton patches
* chore: bump chromium in DEPS to 97.0.4684.0
* chore: update patches
* chore: bump chromium in DEPS to 97.0.4685.0
* chore: update patches
* chore: bump chromium in DEPS to 97.0.4686.0
* chore: update patches
* chore: bump chromium in DEPS to 97.0.4687.0
* chore: update patches
* chore: bump chromium in DEPS to 97.0.4688.0
* chore: update patches
* 3247722: Use correct source_site_instance if navigating via context menu
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3247722
Update signature of HandleContextMenu()
* 3247722: Use correct source_site_instance if navigating via context menu
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3247722
Update signature of HandleContextMenu()
* 3223422: Remove PP_ISOLATEDFILESYSTEMTYPE_PRIVATE_PLUGINPRIVATE enum option
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3223422
sync pepper_plugin_support.patch with upstream
* chore: bump chromium in DEPS to 97.0.4689.0
* 3247791: ax_mac_merge: Merge AX Math attribute implementations
Xref: ax_mac_merge: Merge AX Math attribute implementations
chore: fix minor patch shear in #includes
* 3243425: Add VisibleTimeRequestTrigger helper class
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3243425
chore: fix minor patch shear in #includes
* chore: regen chromium patches
* fixup! 3247722: Use correct source_site_instance if navigating via context menu
* chore: bump chromium in DEPS to 97.0.4690.0
* 3188659: Window Placement: make GetScreenInfo(s) const
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3188659
simple sync GetScreenInfo with upstream refactor
* chore: update patches
* chore: bump chromium in DEPS to 97.0.4690.4
* chore: bump chromium in DEPS to 97.0.4692.0
* 3198073: ozone: //content: clean up from USE_X11
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3198073
Fixing patch shear. Nothing to see here.
* 3252338: Remove label images checkbox from chrome://accessibility page
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3252338
Part of our a11y patch is no longer needed due to upstream label removal
* 3258183: Remove DISALLOW_IMPLICIT_CONSTRUCTORS() definition
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3258183
Replace our use of the macro with explicitly-deleted class methods.
See https://chromium-review.googlesource.com/c/chromium/src/+/3256952
for upstream examples of this same replacement.
* chore: update patches
* 3247295: Unwind SecurityStyleExplanations
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3247295
update GetSecurityStyle() signature and impl to match upstream changes
* 3259578: media: grabs lock to ensure video output when occluded
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3259578
Add stub for new upstream virtual method OnCapturerCountChanged()
* fixup! 3247295: Unwind SecurityStyleExplanations
* 3238504: Fix up drag image is not shown from bookmark bar
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3238504
SetDragImage() no longer takes a widget argument
* 3217452: [devtools] Add getSyncInformation host binding
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/3217452
Add stub for new upstream method GetSyncInformation(). Stub sends info back to caller saying that syncing is disabled.
* chore: bump chromium in DEPS to 98.0.4693.0
* chore: bump chromium in DEPS to 98.0.4694.0
* chore: bump chromium in DEPS to 98.0.4695.0
* chore: bump chromium in DEPS to 98.0.4696.0
* chore: bump chromium in DEPS to 98.0.4697.0
* chore: bump chromium in DEPS to 98.0.4699.0
* chore: bump chromium in DEPS to 98.0.4701.0
* chore: bump chromium in DEPS to 98.0.4703.0
* chore: bump chromium in DEPS to 98.0.4705.0
* chore: bump chromium in DEPS to 98.0.4706.0
* chore: update patches
* 3279210: Rename "base/macros.h" => "base/ignore_result.h"
https://chromium-review.googlesource.com/c/chromium/src/+/3279210
* 3259964: Remove all DISALLOW_COPY_AND_ASSIGNs
https://chromium-review.googlesource.com/c/chromium/src/+/3259964
* 3269029: blink/gin: sets histogram callbacks during isolate creation
https://chromium-review.googlesource.com/c/chromium/src/+/3269029
* fixup after rebase
* [content] Make ContentMainParams and MainFunctionParams move-only
https://chromium-review.googlesource.com/c/chromium/src/+/3244976
* 3255305: Stop sending the securityStateChanged event and unwind
https://chromium-review.googlesource.com/c/chromium/src/+/3255305
* [Blink] Add promise support to WebLocalFrame::RequestExecuteScript()
https://chromium-review.googlesource.com/c/chromium/src/+/3230010
* 3256162: Simplify RWHV Show and ShowWithVisibility handling
https://chromium-review.googlesource.com/c/chromium/src/+/3256162
* 3263824: ozone: //ui/base: clean up from USE_X11 1/*
https://chromium-review.googlesource.com/c/chromium/src/+/3263824
* Request or cancel RecordContentToPresentationTimeRequest during capture
https://chromium-review.googlesource.com/c/chromium/src/+/3256802
* appcache: remove BrowsingData/quota references
https://chromium-review.googlesource.com/c/chromium/src/+/3255725
* [Autofill] Don't show Autofill dropdown if overlaps with permissions
https://chromium-review.googlesource.com/c/chromium/src/+/3236729
* Rename to_different_document to should_show_loading_ui in LoadingStateChanged() callbacks
https://chromium-review.googlesource.com/c/chromium/src/+/3268574
* cleanup patch
* fixup [content] Make ContentMainParams and MainFunctionParams move-only
* 3279210: Rename "base/macros.h" => "base/ignore_result.h"
https://chromium-review.googlesource.com/c/chromium/src/+/3279210
* ozone: //chrome/browser clean up from USE_X11
https://chromium-review.googlesource.com/c/chromium/src/+/3186490
Refs: https://github.com/electron/electron/issues/31382
* chore: update support_mixed_sandbox_with_zygote.patch
* Enable -Wunused-but-set-variable.
Refs https://chromium-review.googlesource.com/c/chromium/src/+/3234737
* fixup! ozone: //ui/base: clean up from USE_X11 1/*
* fixup! ozone: //chrome/browser clean up from USE_X11
* chore: fix deprecation warning in libuv
* chore: fixup for lint
* 3251161: Reland "Make the Clang update.py script require Python 3"
https://chromium-review.googlesource.com/c/chromium/src/+/3251161
* fixup: Enable -Wunused-but-set-variable.
* [base][win] Rename DIR_APP_DATA to DIR_ROAMING_APP_DATA
https://chromium-review.googlesource.com/c/chromium/src/+/3262369
* Replace sandbox::policy::SandboxType with mojom Sandbox enum
https://chromium-review.googlesource.com/c/chromium/src/+/3213677
* fixup: [content] Make ContentMainParams and MainFunctionParams move-only
* build: ensure angle has a full git checkout available to it
* fixup: [base][win] Rename DIR_APP_DATA to DIR_ROAMING_APP_DATA
* fixup lint
* [unseasoned-pdf] Dispatch 'afterprint' event in PDF plugin frame
https://chromium-review.googlesource.com/c/chromium/src/+/3223434
* fixup: [Autofill] Don't show Autofill dropdown if overlaps with permissions
* 3217591: Move browser UI CSS color parsing to own file part 2/2
https://chromium-review.googlesource.com/c/chromium/src/+/3217591
* Make kNoSandboxAndElevatedPrivileges only available to utilities
https://chromium-review.googlesource.com/c/chromium/src/+/3276784
* 3211575: [modules] Change ScriptOrModule to custom Struct
https://chromium-review.googlesource.com/c/v8/v8/+/3211575
* Address review feedback
* chore: update patches
* 3211575: [modules] Change ScriptOrModule to custom Struct
https://chromium-review.googlesource.com/c/v8/v8/+/3211575
* fix: unused variable compat
* chore: remove redundant patch
* fixup for 3262517: Re-enable WindowCaptureMacV2
https://chromium-review.googlesource.com/c/chromium/src/+/3262517
* chore: cleanup todo
The functions added in https://chromium-review.googlesource.com/c/chromium/src/+/3256802 are not used by offscreen rendering.
* fixup: update mas_no_private_api.patch
* 3216879: [PA] Make features::kPartitionAllocLazyCommit to be PartitionOptions::LazyCommit
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/3216879 Fixes up commit
|
||
|
|
49e62f1261 |
chore: bump chromium to 95.0.4629.0 (main) (#30676)
* chore: bump chromium in DEPS to 95.0.4620.0
* chore: update patches
* 3076261: Move args_ to private in ExtensionFunction
https://chromium-review.googlesource.com/c/chromium/src/+/3076261
* [GURL -> SiteForCookies] content/public/browser/content_browser_client.h
https://chromium-review.googlesource.com/c/chromium/src/+/3107759
* chore: fix -Wunreachable-code-return in node
* Tracing to diagnose ContentScriptTracker-related bad message reports
https://chromium-review.googlesource.com/c/chromium/src/+/3057922
* chore: bump chromium in DEPS to 95.0.4621.0
* chore: update patches
* Remove title from the URL format on Windows.
https://chromium-review.googlesource.com/c/chromium/src/+/3108445
* chore: bump chromium in DEPS to 95.0.4623.0
* Revert "chore: disable v8 oilpan"
This reverts commit 5d255cf1d8e8efbb906047937a713279e5f800d0.
(cherry picked from commit
|
||
|
|
64ba8feb93 |
chore: bump chromium to 94.0.4584.0 (main) (#30030)
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com> Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> Co-authored-by: deepak1556 <hop2deep@gmail.com> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com> Co-authored-by: Jeremy Rose <jeremya@chromium.org> |
||
|
|
1bfc16b65a | docs: expand description of isolate_holder.patch (#29209) | ||
|
|
cdf04f3ae7 |
chore: bump chromium to 92.0.4488.0 (master) (#28676)
* chore: bump chromium in DEPS to 92.0.4478.0 * chore: update chromium patches * chore: update v8 patches * fix: add scale parameter to LookupIconFromFilepath Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2748317 Follow up: https://github.com/electron/electron/issues/28678 * build: depend on gtkprint config for gtk_util.h Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2824022 * build: add missing print_job_constants header Refs: unknown * chore: bump chromium in DEPS to 92.0.4479.0 * update patches * chore: bump chromium in DEPS to 92.0.4480.0 * chore: bump chromium in DEPS to 92.0.4481.0 * chore: bump chromium in DEPS to 92.0.4482.2 * chore: bump chromium in DEPS to 92.0.4483.0 * chore: update patches * chore: bump chromium in DEPS to 92.0.4484.0 * chore: bump chromium in DEPS to 92.0.4485.0 * fix patches * update patches * 2810414: [LSC] Add PRESUBMIT check for ASCIIToUTF16("...") and UTF8ToUTF16("...") https://chromium-review.googlesource.com/c/chromium/src/+/2810414 * 2781233: NotificationService: Plumb document_url for non-persistent notifications. https://chromium-review.googlesource.com/c/chromium/src/+/2781233 * fixup! 2810414: [LSC] Add PRESUBMIT check for ASCIIToUTF16("...") and UTF8ToUTF16("...") * 2836669: Refactor GTK build target and dependencies https://chromium-review.googlesource.com/c/chromium/src/+/2836669 * chore: bump chromium in DEPS to 92.0.4486.0 * update patches * fix DecrementCapturerCount patch * explicitly include badging.mojom.h * include ui/gtk/gtk_ui_factory.h for BuildGtkUi() * fixup! 2810414: [LSC] Add PRESUBMIT check for ASCIIToUTF16("...") and UTF8ToUTF16("...") * iwyu fix for base::size * iwyu for TRACE_EVENT0 * 2799631: Use structured interface for DevTools messages https://chromium-review.googlesource.com/c/chromium/src/+/2799631 * 2801573: Convert enum to enum class for Widget::InitParams::Activatable https://chromium-review.googlesource.com/c/chromium/src/+/2801573 * 2805764: Add ContentBrowserClient support for service worker-scoped binders https://chromium-review.googlesource.com/c/chromium/src/+/2805764 * fixup! 2799631: Use structured interface for DevTools messages * fixup! 2805764: Add ContentBrowserClient support for service worker-scoped binders * oops, use of linux_ui after std::move * fix devtools message handling for null params * disable node test parallel/test-debug-args https://chromium-review.googlesource.com/c/v8/v8/+/2843348 * fix gn check * chore: bump chromium in DEPS to 92.0.4487.0 * chore: update patches * chore: bump chromium in DEPS to 92.0.4488.0 * update patches * Remove vpython use from Chromium DEPS file https://chromium-review.googlesource.com/c/chromium/src/+/2810121 * Partial revert "workaround: disable CFG longjmp protection for Windows on Arm" https://chromium-review.googlesource.com/c/chromium/src/+/2788210 Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com> Co-authored-by: deepak1556 <hop2deep@gmail.com> Co-authored-by: Jeremy Rose <nornagon@nornagon.net> |
||
|
|
22a70eb803 |
chore: bump chromium to 92.0.4475.0 (master) (#28462)
* chore: bump chromium in DEPS to 91.0.4464.0 * chore: rebuild chromium/dcheck.patch with import-patches -3 Mechanical only; no code changes * chore: remove content_browser_main_loop.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2725153 The function being patched (BrowserMainLoop::MainMessageLoopRun()) no longer exists. NB: if removing this introduces regressions the likely fix will be to add a similar patch for ShellBrowserMainParts::WillRunMainMessageLoop() which has similar code and was added at the same time this was removed. * chore: rebuild chromium/put_back_deleted_colors_for_autofill.patch with import-patches -3 Mechanical only; no code changes * chore: rebuild chromium/disable_color_correct_rendering.patch with import-patches -3 Mechanical only; no code changes * chore: rebuild chromium/eat_allow_disabling_blink_scheduler_throttling_per_renderview.patch with patch Mechanical only; no code changes * chore: rebuild chromium/gpu_notify_when_dxdiag_request_fails.patch with import-patches -3 Mechanical only; no code changes * chore: rebuild chromium/ui_gtk_public_header.patch manually no code changes * chore: rebuild chromium/web_contents.patch with import-patches -3 Mechanical only; no code changes * chore: remove v8/skip_global_registration_of_shared_arraybuffer_backing_stores.patch Refs: https://chromium-review.googlesource.com/c/v8/v8/+/2763874 This patch has been merged upstream * chore: export patches * chore: update add_trustedauthclient_to_urlloaderfactory.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2757969 Sync with removal of render_frame_id_ * chore: sync chromium/put_back_deleted_colors_for_autofill.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2785841 SkColorFromColorId() no longer takes theme, scheme args * chore: sync chromium/put_back_deleted_colors_for_autofill.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2772143 Change new calls to GetDarkSchemeColor to fit our patched call signature * chore: update add_trustedauthclient_to_urlloaderfactory.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2757969 Sync with removal of render_frame_id_ in our mojom * chore: update chromium/frame_host_manager.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2740008 UrlInfo ctor now takes UrlInfo::OriginIsolationRequest instead of a bool * chore: update chromium/revert_remove_contentrendererclient_shouldfork.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2755314 Upstream has removed `history_list_length_` which we were comparing to 0 to calculate our `is_initial_navigation` bool when calling ShouldFork(). ShouldFork() is ours and none of the code paths actually use that param, so this commit removes it altogether. * chore: update permissions_to_register Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2789074 Replace all uses of APIPermission::ID enum with Mojo type * refactor: update return type of PreMainMessageLoopRun() Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2725153 Used to return void; now returns an int errorcode. Note: 2725153 also has some nice doc updates about Browser's "stages" * refactor: sync ElectronBrowserMainParts to MainParts changes Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2725153 RunMainMessageLoopParts has been replaced with WillRunMainMessageLoop so `BrowserMainLoop::result_code_` is no longer available to us for our exit_code_ pointer. This variable held a dual role: (1) of course, hold the exit code, but also (2) was a nullptr before the message loop was ready, indicating to anyone calling SetExitCode() that we were still in startup and could just exit() without any extra steps. exit_code_ still fulfills these two roles but is now a base::Optional. * chore: update ElectronBrowserMainParts::PreDefaultMainMessageLoopRun Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2725153 BrowserMainParts::BrowsePreDefaultMainMesssageLoopRun() has been removed; move that work to the new WillRunMainMessageLoop(). * refactor: stop using CallbackList; it has been removed. Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2785973 * refactor: update use of threadpools. Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2773408 The upstream code is still in flux (e.g. reverts and re-lands) but the tl;dr for this commit is (1) include thread_pool.h if you're using it and (2) don't instantiate pools directly. * refactor: remove routing_id from CreateLoaderAndStart Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2762858 NB: One logic branch in ProxyingURLLoaderFactory::CreateLoaderAndStart calls std::make_unique<InProgressRequest>, which needs a routing_id. This PR uses the member field `routing_id_` since there's no longer one being passed into CreateLoaderAndStart. * refactor: sync to upstream ParittionOptions churn Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2771318 PartitionOptions' enums have changed. * refactor: update Manifest::Location usage Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2771320 tldr: s/Manifest::FOO/ManifestLocation::kFoo/ * chore: bump chromium in DEPS to 91.0.4465.0 * update patches * refactor: update extensions::Manifest to upstream Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2771320 - extensions::Manifest::COMPONENT + extensions::mojom::ManifestLocation::kExternalComponent * refactor: sync with upstream UrlInfo ctor changes Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2740008 UrlInfo ctor now takes UrlInfo::OriginIsolationRequest instead of a bool * chore: update invocation of convert_protocol_to_json.py Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2792623 python3 is being used in parts of the upstream build, but the copy of convert_protocol_to_json.py invoked in v8/third_party/inspector_protocol is not python3-friendly. Node has a py2+3-friendly version of it in its tools directory, so call it instead. * chore: use extensions::mojom::APIPermissionID Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2791122 tldr: - extensions::APIPermission::kFoo + extensions::mojom::APIPermissionID::kFoo * chore: Remove support for TLS1.0/1.1 in SSLVersionMin policy Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2765737 Remove TLS v1.0 & 1.1 from our SSLProtocolVersionFromString() function. This is the same change made upstream at https://chromium-review.googlesource.com/c/chromium/src/+/2765737/8/chrome/browser/ssl/ssl_config_service_manager_pref.cc * fixup! chore: update ElectronBrowserMainParts::PreDefaultMainMessageLoopRun * chore: Use IDType for permission change subscriptions. Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2791431 tldr: {Subscribe,Unsubscribe}PermissionStatusChange's tag type used to be an int; now it's the new SubscriptionId type (which is an IdType64). * chore: sync PowerMonitor code to upstream refactor Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2752635 tldr: PowerMonitor has been split into PowerStateObserver, PowerSuspendObserver, and PowerThermalObserver to reduce number of tasks posted to consumers who only need notifications for one of those things instead of all of them. * chore: use PartitionOptions's new Cookies field Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2771318 * Revert "refactor: remove routing_id from CreateLoaderAndStart" This reverts commit 8c9773b87a3c84f9073a47089eb2b6889d745245. 8c9773b was only a partial fix; reverting to start & try again. * update patches * chore: bump chromium in DEPS to 91.0.4466.0 * chore: update chromium/accelerator.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2795472 tldr: sync patch with upstream renamed variable & macro names. * chore: update chromium/gtk_visibility.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2796200 tldr: no code changes; just updating the diff to apply cleanly. note: ooh upstream Wayland hacking! * chore: update chromium/picture-in-picture.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2710023 tldr: no code changes; just updating the diff to apply cleanly. * chore: update chromium/worker_feat_add_hook_to_notify_script_ready.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2775573 tldr: no code changes; just updating the diff to apply cleanly. * chore: export_all_patches * chore: update chromium/feat_add_set_theme_source_to_allow_apps_to.patch Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2796511 tldr: NotifyObservers has been renamed to NotifyOnNativeThemeUpdated, so update the invocation in our patch. * chore: update ElectronBrowserClient w/upstream API Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2797454 tldr: GetDevToolsManagerDelegate() was returning an owned raw pointer. Replaced it with CreateDevToolsManagerDelegate() which uses unique_ptr<>. * chore: handle new content::PermissionType::FILE_HANDLING in toV8() Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2762201 `file-handling` string confirmed in https://chromium-review.googlesource.com/c/chromium/src/+/2762201/18/chrome/browser/ui/webui/settings/site_settings_helper.cc * refactor: remove routing_id from CreateLoaderAndStart pt 1 Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2762858 Part 1: the easiest ones * 2796724: Support Python3 https://chromium-review.googlesource.com/c/infra/luci/python-adb/+/2796724 * chore: bump chromium in DEPS to 91.0.4468.0 * 2668974: WebShare: Implement SharingServicePicker https://chromium-review.googlesource.com/c/chromium/src/+/2668974 * 2802766: Apply modernize-make-unique to media/ https://chromium-review.googlesource.com/c/chromium/src/+/2802766 * 2802823: Apply modernize-make-unique to gpu/ https://chromium-review.googlesource.com/c/chromium/src/+/2802823 * 2803041: Apply modernize-make-unique to remaining files https://chromium-review.googlesource.com/c/chromium/src/+/2803041 * 2798873: Convert GtkKeyBindingsHandler build checks to runtime checks https://chromium-review.googlesource.com/c/chromium/src/+/2798873 * 2733595: [ch-r] Parse ACCEPT_CH H2/3 frame and restart with new headers if needed https://chromium-review.googlesource.com/c/chromium/src/+/2733595 * chore: update patch indices * 2795107: Remove unused PermissionRequest IDs. https://chromium-review.googlesource.com/c/chromium/src/+/2795107 * chore: bump chromium in DEPS to 91.0.4469.0 * chore: fixup patch indices * chore: bump chromium in DEPS to 91.0.4469.5 * PiP 1.5: Add microphone, camera, and hang up buttons to the PiP window https://chromium-review.googlesource.com/c/chromium/src/+/2710023 * fixup! refactor: remove routing_id from CreateLoaderAndStart * refactor: use URLLoaderNetworkServiceObserver for auth requests from SimpleURLLoader * fixup! chore: fixup patch indices * 2724817: Expand scope of wasm-eval to all URLs https://chromium-review.googlesource.com/c/chromium/src/+/2724817 * Fixup patch after rebase * chore: bump chromium in DEPS to 91.0.4472.0 * 2797341: [ozone/x11] Enabled the global shortcut listener. https://chromium-review.googlesource.com/c/chromium/src/+/2797341 * 2805553: Reland Add GTK ColorMixers to ColorPipeline P1 https://chromium-review.googlesource.com/c/chromium/src/+/2805553 * |
||
|
|
ca75bca667 |
chore: bump chromium to 90.0.4415.0 (master) (#27694)
* chore: bump chromium in DEPS to 520c02b46668fc608927e0fcd79b6a90885a48bf * chore: bump chromium in DEPS to 90.0.4414.0 * resolve chromium conflicts * resolve v8 conflicts * fix node gn files * 2673502: Remove RenderViewCreated use from ExtensionHost. https://chromium-review.googlesource.com/c/chromium/src/+/2673502 * 2676903: [mojo] Remove most legacy Binding classes. https://chromium-review.googlesource.com/c/chromium/src/+/2676903 * 2644847: Move self-deleting URLLoaderFactory base into //services/network. https://chromium-review.googlesource.com/c/chromium/src/+/2644847 * 2664006: Remove from mojo::DataPipe. https://chromium-review.googlesource.com/c/chromium/src/+/2664006 * 2674530: Remove CertVerifierService feature https://chromium-review.googlesource.com/c/chromium/src/+/2674530 * 2668748: Move OnSSLCertificateError to a new interface. https://chromium-review.googlesource.com/c/chromium/src/+/2668748 * 2672923: Remove RAPPOR reporting infrastructure. https://chromium-review.googlesource.com/c/chromium/src/+/2672923 * 2673502: Remove RenderViewCreated use from ExtensionHost. https://chromium-review.googlesource.com/c/chromium/src/+/2673502 * 2655126: Convert FrameHostMsg_ContextMenu and FrameMsg_ContextMenuClosed|CustomContextMenuAction to Mojo https://chromium-review.googlesource.com/c/chromium/src/+/2655126 * 2628705: Window Placement: Implement screen.isExtended and change event https://chromium-review.googlesource.com/c/chromium/src/+/2628705 * 2643161: Refactor storage::kFileSystem*Native* https://chromium-review.googlesource.com/c/chromium/src/+/2643161 * fix build * only remove the biggest subdir of //ios * chore: bump chromium in DEPS to 90.0.4415.0 * update patches * update sysroots * 2686147: Remove WebContentsObserver::RenderViewCreated(). https://chromium-review.googlesource.com/c/chromium/src/+/2686147 * 2596429: Fixing how extension's split and spanning modes affect OriginAccessList. https://chromium-review.googlesource.com/c/chromium/src/+/2596429 * 2686026: [mojo] Delete AssociatedInterfacePtr (replaced by AssociatedRemote) https://chromium-review.googlesource.com/c/chromium/src/+/2686026 * 2651705: Move ui/base/dragdrop/file_info to ui/base/clipboard https://chromium-review.googlesource.com/c/chromium/src/+/2651705 * 358217: drawBitmap is deprecated https://skia-review.googlesource.com/c/skia/+/358217 * fix gn check * 2678098: Use gen/front_end as input to generate_devtools_grd https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/2678098 * 2674530: Remove CertVerifierService feature https://chromium-review.googlesource.com/c/chromium/src/+/2674530 * fixup 2664006: Remove from mojo::DataPipe. https://chromium-review.googlesource.com/c/chromium/src/+/2664006 * fixup build_add_electron_tracing_category.patch * 2673415: [base] Prepare CrashReporterClient for string16 switch https://chromium-review.googlesource.com/c/chromium/src/+/2673415 * 2673413: Add CursorFactoryWin to handle Cursors on Windows https://chromium-review.googlesource.com/c/chromium/src/+/2673413 * 2668748: Move OnSSLCertificateError to a new interface. https://chromium-review.googlesource.com/c/chromium/src/+/2668748 * fix mas gn check * update patch after merge * Update node for .mjs files * build: load v8_prof_processor dependencies as ESM * chore: add patch to fix linux 32bit Co-authored-by: Jeremy Rose <nornagon@nornagon.net> Co-authored-by: Jeremy Rose <jeremya@chromium.org> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com> |
||
|
|
adf0a73543 |
chore: bump chromium to a264339194bfa02f5ecb3b8cba449 (master) (#27111)
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com> Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org> |
||
|
|
69f1731bbb |
chore: bump chromium to ec5bc1743792d64724693eb357083 (master) (#24984)
* chore: bump chromium in DEPS to cbdeef954dfc34e94c8ca9cf72ad326b4a121158 * chore: bump chromium in DEPS to 29723f905baeab1d4228eef2c31cdb341ebeffe0 * chore: bump chromium in DEPS to 44d6d78e852137fff58c14ed26ab1e803e5bf822 * update patches * chore: bump chromium in DEPS to 8a3a0fccb39d6b8334c9a0496c0d5056e50cdb3f * chore: update patches * refactor: fix PrintBackend::CreateInstance() calls Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2354541 * chore: bump chromium in DEPS to b9ebec3bcb1cabdd1426f367636f54cc98e0500e * chore: remove patches to code that was deleted upstream CL: https://chromium-review.googlesource.com/c/chromium/src/+/2360314 * Remove uses of kCGColorSpaceITUR_2020_PQ_EOTF/HLG CL: https://chromium-review.googlesource.com/c/chromium/src/+/2363950 just garden variety code shear * chore: update patch indices * Move ColorModel to //printing/mojom/print.mojom https://chromium-review.googlesource.com/c/chromium/src/+/2355083 sync with printing ColorModel changes: moved to mojo, different naming scheme * chore: bump chromium in DEPS to 56c4b4d2ce5ba941acd2e0fdb5100e8a48847134 * chore: bump chromium in DEPS to 130501f220b684a79dc82c17e236e63ac1f2a093 * Convert PrintHostMsg_DidGetPrintedPagesCount to Mojo https://chromium-review.googlesource.com/c/chromium/src/+/2326857 Update argument list to Print() * chore: update patch indices * DumpAccTree: convert utf16 to utf8 in PropertyFilter https://chromium-review.googlesource.com/c/chromium/src/+/2360218 * chore: bump chromium in DEPS to 3058368c6646e0dc8be6f8ea838b0343428b7998 * chore: bump chromium in DEPS to f51b4e6555364363c61438dac7afd988c8347bfc * chore: bump chromium in DEPS to 2dcc6f8fc23ac41b2499eb69dee0b4017e9d1046 * update patches * chore: bump chromium in DEPS to 2d8e98ecedc7e4905540b053bc1c87e964715be5 * update patches * 2345900: Move content::RecordContentToVisibleTimeRequest struct to mojo https://chromium-review.googlesource.com/c/chromium/src/+/2345900 * update patches * 2345900: Move content::RecordContentToVisibleTimeRequest struct to mojo https://chromium-review.googlesource.com/c/chromium/src/+/2345900 * 2367394: Remove net::LOAD_DO_NOT_SEND_COOKIES and net::LOAD_DO_NOT_SEND_AUTH_DATA. https://chromium-review.googlesource.com/c/chromium/src/+/2367394 * 2373227: [XProto] Consolidate all <X11/*> includes to //ui/gfx/x/x11.h https://chromium-review.googlesource.com/c/chromium/src/+/2373227 * fixup! 2373227: [XProto] Consolidate all <X11/*> includes to //ui/gfx/x/x11.h * chore: bump chromium in DEPS to c090e3f960520cbd2328608b97f87238c76d6143 * update patches * chore: bump chromium in DEPS to 13a25e0a755de9a14271022c595f3d2e29829e1a * chore: bump chromium in DEPS to 6adbb767b012c41efaeab0d1bdbb3eefed0977bc * chore: bump chromium in DEPS to 339ec5455c5932ef1322ea9953a6349b0732199e * chore: bump chromium in DEPS to 20291807c33f7ef4ef4f57d62075e099b027bfe6 * chore: bump chromium in DEPS to 226fbd1b8b17d4ac84fdb9548ef3a1c646878d47 * update patches * fixup disable_color_correct_rendering patch * chore: bump chromium in DEPS to 577c45979cad4359f2e206d68efd9317d3d79315 * update patches * viz: Rename RenderPass to CompositorRenderPass (and related types). https://chromium-review.googlesource.com/c/chromium/src/+/2380730 * chore: bump chromium in DEPS to 37e2ad5303f2c03a1b5d8eda65341bf2561196cd * update patches * add kOmitCookies_Electron * update patch * chore: bump chromium in DEPS to 256e42409ea63a7e71016de07818a983a97db463 * update patches * fix worker script ready hook https://chromium-review.googlesource.com/c/chromium/src/+/2335713 * Fixup printing page ranges patch * [printing] Move PrintMsg_PrintPages_Params to print.mojom https://chromium-review.googlesource.com/c/chromium/src/+/2340854 * Add MIME sniffer overloads that take base::StringPieces https://chromium-review.googlesource.com/c/chromium/src/+/2382896 * [printing] Move PrintHostMsg_PreviewIds to print.mojom https://chromium-review.googlesource.com/c/chromium/src/+/2379455 * fixup test due to new DCHECK https://chromium-review.googlesource.com/c/chromium/src/+/2333750 * stop sending cookies when useSessionCookies is false * chore: bump chromium in DEPS to dd429dbc556449951ee8160d8a4d61fd95a139d5 * update patches * chore: bump chromium in DEPS to 5202bde3f9f44c2065f5dacf27e7000dd19e4e4d * chore: bump chromium in DEPS to 099e8e07b89da65932431bb0fd51b6f7f5344c19 * chore: bump chromium in DEPS to 104e5da2a43b759732d5b94bfc750b3a9a639653 * chore: bump chromium in DEPS to a4519ce657af25834e355315fd7fefa77b13426a * update patches * Make FileURLLoaderFactory always owned by its |receivers_|. https://chromium-review.googlesource.com/c/chromium/src/+/2337411 * Make FileURLLoaderFactory always owned by its |receivers_|. https://chromium-review.googlesource.com/c/chromium/src/+/2337411 * chore: bump chromium in DEPS to 1b62e9e8c8eaf6b8e3a9c77ee67a4c1bfa6a4d6b * chore: update patches * fixup! Make FileURLLoaderFactory always owned by its |receivers_|. * chore: update patches - mac: Disable CoreServices _CSCheckFix. https://chromium-review.googlesource.com/c/chromium/src/+/2401334 - [XProto] Remove bad DCHECK in x11_error_tracker.cc https://chromium-review.googlesource.com/c/chromium/src/+/2402304 - Move content/browser/frame_host/* over to content/browser/renderer_host/ https://chromium-review.googlesource.com/c/chromium/src/+/2401303 * Refactor WebContentSettingsClient to dedupe AllowXYZ methods https://chromium-review.googlesource.com/c/chromium/src/+/2353552 * Introduce NonNetworkURLLoaderFactoryBase class. https://chromium-review.googlesource.com/c/chromium/src/+/2357559 * [XProto] Remove usage of all Xlib headers https://chromium-review.googlesource.com/c/chromium/src/+/2392140 * fixup! chore: update patches * chore: bump chromium in DEPS to c1df55fbeb8207d036a604f59e4ea4e8ee79930a * chore: update patches * Move content::WebPreferences struct to Blink https://chromium-review.googlesource.com/c/chromium/src/+/2397670 * chore: bump chromium in DEPS to 57a23ec4884fff6c2f8d9b8536131cdc9b551ec2 * Set appid on Pip windows. https://chromium-review.googlesource.com/c/chromium/src/+/2388274 * fixup! Set appid on Pip windows. * fix: add a patch to remove deprecated factory * chore: bump chromium in DEPS to 1a9ddb7ea43955877823d5c4dcbf241b64228635 * fix compilation on windows * chore: bump chromium in DEPS to 234e6c6a77f61ffad9335099d9b13892cf88fd44 * chore: update patches * chore: bump chromium in DEPS to 7631eb0a9f57a8a47d3c28e1d265961b3a4d6b2b * chore: update patches * chore: bump chromium in DEPS to f9c34cd485845b95c2d17a7f55fdf92cda9a1b3a * chore: update patches * chore: implement GetSurveyAPIKey Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2362182 * chore: replace CreateWebUIURLLoader with CreateWebUIURLLoaderFactory Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2358309 * chore: bump chromium in DEPS to 5bdbd2373da884adf41c087be1465fcc344d168c * chore: update node patches for common.gypi * chore: update patches * chore: non_network_url_loader_factory_base was moved Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2357431 * 2415752: Reland "Reland "OOR-CORS: Remove BlinkCORS supporting code outside Blink"" Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2415752 * chore: bump chromium in DEPS to b943d006a33ec5bc1743792d64724693eb357083 * fix: replace x11::None with x11::Window::None * chore: update patches * chore: update patches * fix: cast x11::Window to int * 2402123: Use end date when deleting http auth cache Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2402123 * 2320268: Migrate DragHostMsg_StartDragging to Mojo Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2320268 * 2401303: Move content/browser/frame_host/* over to content/browser/renderer_host/ https://chromium-review.googlesource.com/c/chromium/src/+/2401303 * chore: fix lint * chore: fix build * Update config.yml Co-authored-by: Electron Bot <anonymous@electronjs.org> Co-authored-by: Charles Kerr <charles@charleskerr.com> Co-authored-by: Jeremy Rose <nornagon@nornagon.net> Co-authored-by: John Kleinschmidt <jkleinsc@github.com> Co-authored-by: deepak1556 <hop2deep@gmail.com> Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com> Co-authored-by: Samuel Attard <sattard@slack-corp.com> |
||
|
|
2fb14f53fe | chore: bump chromium to 1a093e6a0cb5e72ba78990fe39824 (master) (#24575) | ||
|
|
dc72f74020 |
chore: bump chromium to 580fe983e138952553cd6af11ee8b (master) (#23379)
* chore: bump chromium in DEPS to 5ce64b91b4d6a78c97480059f15ff6469fc0918e * chore: bump chromium in DEPS to e74c73d0000f81b3f40a513176c8d024bba57d28 * chore: bump chromium in DEPS to 501640e650d4657ba63db65fa257e4a899168de7 * chore: bump chromium in DEPS to 00db20e1bc3d77706723a87ada3c1c647a1c37b7 * chore: update patches * refactor: AddNewContents now takes a target_url Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2167732 * chore: SetHostCleanupFinalizationGroupCallback has been removed from V8 * refactor: use WebInputEvent::Namespace types directly Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2160523 * refactor: FollowRedirect takes in cors exempt headers now Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2129787 * refactor: printing::DuplexMode moved to mojo Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2162388 * refactor: use MessagePortDescriptor instead of raw mojo::MessagePipeHandles Refs: https://chromium-review.googlesource.com/c/chromium/src/+/1952124 * chore: update patches * chore: bump chromium in DEPS to f1537676d613f3567cfb43adf577b3847fba4bc3 * chore: update patches * refactor: service_manager::BinderMapWithContext merged into mojo::BinderMap Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2174654 * chore: unused argument removed from ReadAvailableTypes in ui::Clipboard Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2173666 * chore: bump chromium in DEPS to 949888433ab935dd6125c107226a4c9d6da9bf48 * chore: update patches * update patches * chore: update sysroots * chore: bump chromium in DEPS to eaac5b5035fe189b6706e1637122e37134206059 * chore: bump chromium in DEPS to 258b54b903d33dab963adf59016691e6537f8b70 * build: update patches * refactor: cursor.mojom and cursor_types.mojom moved to //ui/base/cursor/mojom Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2172874 * chore: DesktopWindowTreeHostLinux becomes DesktopWindowTreeHostPlatform Refs: * refactor: LogErrorEventDescription moved from ui to x11 Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2164245 * chore: update patches * chore: bump chromium in DEPS to bd06abcfe807d4461683479237cdd920dafa52ca * chore: bump chromium in DEPS to 1afb0891e56f1e79d204db43ca053a46d0974511 * chore: bump chromium in DEPS to 5cb0f794bf7f155bf8c0a241b94e01c9d90c2744 * chore: bump chromium in DEPS to 37327ba3303234e1a3cd3310ca11a68e81b95123 * update patches * remove ClientSideDetectionService from browser_process Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2175320 * refactor: shuttle cursor changed event to WebContentsObserver Refs: https://chromium-review.googlesource.com/c/chromium/src/+/2172779 * chore: bump chromium in DEPS to 1d97904bb6936e106df13705208b73e47367c2b9 * avoid IPC crash introduced earlier in the roll Refs: |
||
|
|
49b47ee4ed | chore: bump chromium to f755b70e34659441e72c1a928a406 (master) (#21000) | ||
|
|
b6246dcf12 | chore: bump chromium to f5b345dd470f14eef6e44732ccf23 (master) (#20649) | ||
|
|
4b9da4dd0e | chore: remove mips64el patches as they've largely been upstreamed (#18628) |