mirror of
https://github.com/electron/electron.git
synced 2026-02-26 03:01:17 -05:00
Compare commits
122 Commits
v40.0.0-al
...
v38.1.0
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
8cd29d24b1 | ||
|
|
35639ad801 | ||
|
|
2d397883a5 | ||
|
|
79433861fe | ||
|
|
a7335142a4 | ||
|
|
d5907878bc | ||
|
|
0098160f2a | ||
|
|
207f64fec8 | ||
|
|
441cff700b | ||
|
|
9eede35fc1 | ||
|
|
6812b13161 | ||
|
|
a64175ff1c | ||
|
|
b34e618285 | ||
|
|
818743493d | ||
|
|
9e631b62d8 | ||
|
|
f28d08ad86 | ||
|
|
0c2271a515 | ||
|
|
cc67728226 | ||
|
|
1a38293926 | ||
|
|
2cb262b280 | ||
|
|
20a563c27d | ||
|
|
aa022ce30e | ||
|
|
fead821311 | ||
|
|
37b5a62daa | ||
|
|
3e0378340e | ||
|
|
2e5a0b7220 | ||
|
|
a6b0d27bb7 | ||
|
|
114a3b3971 | ||
|
|
641f60619f | ||
|
|
a130d4ebfe | ||
|
|
cea5034019 | ||
|
|
095ae30f6d | ||
|
|
35b3d25ee1 | ||
|
|
03a14844b1 | ||
|
|
fffe214702 | ||
|
|
bc56c6987f | ||
|
|
e3f358a45a | ||
|
|
89d5b6cd5b | ||
|
|
4fff74b73e | ||
|
|
74ad696f98 | ||
|
|
d05f99ff4c | ||
|
|
f6a2c13740 | ||
|
|
433f9f5e8c | ||
|
|
a7b6145f3b | ||
|
|
f3774d578d | ||
|
|
33f4808182 | ||
|
|
eb02db5185 | ||
|
|
c3f64712de | ||
|
|
df6ad9c970 | ||
|
|
729a67d0d7 | ||
|
|
ecf905decb | ||
|
|
4fea51017f | ||
|
|
d3059897ed | ||
|
|
f2d14ca29d | ||
|
|
9b1dfe90f4 | ||
|
|
a41ca28b63 | ||
|
|
8841e4be83 | ||
|
|
5c83e2b00c | ||
|
|
7930f4a20c | ||
|
|
3fefa06d34 | ||
|
|
e1e12318e2 | ||
|
|
edccb0a7ea | ||
|
|
83373c3679 | ||
|
|
9c4d783d1f | ||
|
|
139ab00d8c | ||
|
|
124bfd25f8 | ||
|
|
d5ce459cea | ||
|
|
ea0773c7c7 | ||
|
|
d426b92326 | ||
|
|
673ec5d39e | ||
|
|
bfdc318d56 | ||
|
|
41093c5ba6 | ||
|
|
22d6210c3c | ||
|
|
b20e91d86f | ||
|
|
658d52ecf1 | ||
|
|
53c17ea4f5 | ||
|
|
71af3e452f | ||
|
|
5081fbe830 | ||
|
|
a4a12fb35a | ||
|
|
564698e27f | ||
|
|
280f643862 | ||
|
|
e2689400aa | ||
|
|
f37f8d41c0 | ||
|
|
7d83554d0e | ||
|
|
8924d682be | ||
|
|
d6c5642155 | ||
|
|
789b4b026a | ||
|
|
44bd560068 | ||
|
|
2783f76f1f | ||
|
|
96957aebf3 | ||
|
|
e8c3b6fe66 | ||
|
|
58e0a96d21 | ||
|
|
b136dbc4cc | ||
|
|
2efd448a87 | ||
|
|
31e6800314 | ||
|
|
f1fef462c0 | ||
|
|
e08f057e91 | ||
|
|
f97bee6f04 | ||
|
|
0b77096f2a | ||
|
|
130f00dfcd | ||
|
|
3a6d7e0c22 | ||
|
|
7907443448 | ||
|
|
a425ddd08e | ||
|
|
9184541193 | ||
|
|
5edb807cff | ||
|
|
c65bfc1e5c | ||
|
|
85a8bfaa31 | ||
|
|
f6d054f0fb | ||
|
|
66a89ec38f | ||
|
|
6d3eeb46e4 | ||
|
|
34dcfb5422 | ||
|
|
e84f0e164e | ||
|
|
68c769de94 | ||
|
|
3eabf175b8 | ||
|
|
9c0ef6f9c6 | ||
|
|
c150a1e004 | ||
|
|
a8b8ad9ca9 | ||
|
|
4268bf91e4 | ||
|
|
79d6160bdc | ||
|
|
41ebb49703 | ||
|
|
c30eae3216 | ||
|
|
b89810f374 |
10
.github/ISSUE_TEMPLATE/bug_report.yml
vendored
10
.github/ISSUE_TEMPLATE/bug_report.yml
vendored
@@ -58,16 +58,6 @@ body:
|
||||
label: Last Known Working Electron version
|
||||
description: What is the last version of Electron this worked in, if applicable?
|
||||
placeholder: 16.0.0
|
||||
- type: dropdown
|
||||
attributes:
|
||||
label: Does the issue also appear in Chromium / Google Chrome?
|
||||
description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
|
||||
options:
|
||||
- I don't know how to test
|
||||
- "Yes"
|
||||
- "No"
|
||||
validations:
|
||||
required: true
|
||||
- type: textarea
|
||||
attributes:
|
||||
label: Expected Behavior
|
||||
|
||||
60
.github/actions/build-electron/action.yml
vendored
60
.github/actions/build-electron/action.yml
vendored
@@ -60,28 +60,14 @@ runs:
|
||||
sudo launchctl limit maxfiles 65536 200000
|
||||
fi
|
||||
|
||||
if [ "${{ inputs.is-release }}" = "true" ]; then
|
||||
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
|
||||
else
|
||||
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
|
||||
fi
|
||||
NINJA_SUMMARIZE_BUILD=1 e build
|
||||
cp out/Default/.ninja_log out/electron_ninja_log
|
||||
node electron/script/check-symlinks.js
|
||||
|
||||
# Upload build stats to Datadog
|
||||
if ! [ -z $DD_API_KEY ]; then
|
||||
if [ "$TARGET_PLATFORM" = "win" ]; then
|
||||
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
|
||||
else
|
||||
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
|
||||
fi
|
||||
else
|
||||
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
|
||||
fi
|
||||
- name: Verify dist.zip ${{ inputs.step-suffix }}
|
||||
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
|
||||
shell: bash
|
||||
run: |
|
||||
cd src
|
||||
cd src
|
||||
e build --target electron:electron_dist_zip
|
||||
if [ "${{ inputs.is-asan }}" != "true" ]; then
|
||||
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
|
||||
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
|
||||
@@ -89,10 +75,11 @@ runs:
|
||||
fi
|
||||
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
|
||||
fi
|
||||
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
|
||||
- name: Build Mksnapshot ${{ inputs.step-suffix }}
|
||||
shell: bash
|
||||
run: |
|
||||
cd src
|
||||
e build --target electron:electron_mksnapshot
|
||||
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
|
||||
# Remove unused args from mksnapshot_args
|
||||
SEDOPTION="-i"
|
||||
@@ -102,6 +89,7 @@ runs:
|
||||
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
|
||||
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
|
||||
|
||||
e build --target electron:electron_mksnapshot_zip
|
||||
if [ "${{ inputs.target-platform }}" = "win" ]; then
|
||||
cd out/Default
|
||||
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
|
||||
@@ -135,15 +123,13 @@ runs:
|
||||
shell: bash
|
||||
run: |
|
||||
cd src
|
||||
e build --target electron:electron_chromedriver
|
||||
e build --target electron:electron_chromedriver_zip
|
||||
|
||||
if [ "${{ inputs.is-asan }}" != "true" ]; then
|
||||
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
|
||||
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
|
||||
target_os="${target_os}_mas"
|
||||
fi
|
||||
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
|
||||
fi
|
||||
- name: Build Node.js headers ${{ inputs.step-suffix }}
|
||||
shell: bash
|
||||
run: |
|
||||
cd src
|
||||
e build --target electron:node_headers
|
||||
- name: Create installed_software.json ${{ inputs.step-suffix }}
|
||||
shell: powershell
|
||||
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
|
||||
@@ -163,11 +149,17 @@ runs:
|
||||
# Needed for msdia140.dll on 64-bit windows
|
||||
cd src
|
||||
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
|
||||
- name: Zip Symbols ${{ inputs.step-suffix }}
|
||||
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
|
||||
shell: bash
|
||||
run: |
|
||||
# Generate breakpad symbols on release builds
|
||||
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
|
||||
e build --target electron:electron_symbols
|
||||
fi
|
||||
cd src
|
||||
export BUILD_PATH="$(pwd)/out/Default"
|
||||
e build --target electron:licenses
|
||||
e build --target electron:electron_version_file
|
||||
if [ "${{ inputs.is-release }}" = "true" ]; then
|
||||
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
|
||||
else
|
||||
@@ -180,6 +172,18 @@ runs:
|
||||
cd src
|
||||
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
|
||||
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
|
||||
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
|
||||
shell: bash
|
||||
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
|
||||
run: |
|
||||
e build --target electron:hunspell_dictionaries_zip
|
||||
- name: Generate Libcxx ${{ inputs.step-suffix }}
|
||||
shell: bash
|
||||
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
|
||||
run: |
|
||||
e build --target electron:libcxx_headers_zip
|
||||
e build --target electron:libcxxabi_headers_zip
|
||||
e build --target electron:libcxx_objects_zip
|
||||
- name: Remove Clang problem matcher
|
||||
shell: bash
|
||||
run: echo "::remove-matcher owner=clang::"
|
||||
|
||||
1
.github/actions/checkout/action.yml
vendored
1
.github/actions/checkout/action.yml
vendored
@@ -172,6 +172,7 @@ runs:
|
||||
run: |
|
||||
rm -rf src/android_webview
|
||||
rm -rf src/ios/chrome
|
||||
rm -rf src/third_party/blink/web_tests
|
||||
rm -rf src/third_party/blink/perf_tests
|
||||
rm -rf src/chrome/test/data/xr/webvr_info
|
||||
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src
|
||||
|
||||
2
.github/actions/fix-sync/action.yml
vendored
2
.github/actions/fix-sync/action.yml
vendored
@@ -109,7 +109,7 @@ runs:
|
||||
deps-file: src/DEPS
|
||||
installation-dir: src/third_party/siso/cipd
|
||||
target-platform: ${{ inputs.target-platform }}
|
||||
package: build/siso/${platform}
|
||||
package: infra/build/siso/${platform}
|
||||
- name: Fixup angle git
|
||||
if: ${{ inputs.target-platform != 'linux' }}
|
||||
shell: bash
|
||||
|
||||
48
.github/actions/free-space-macos/action.yml
vendored
48
.github/actions/free-space-macos/action.yml
vendored
@@ -6,8 +6,6 @@ runs:
|
||||
- name: Free Space on MacOS
|
||||
shell: bash
|
||||
run: |
|
||||
echo "Disk usage before cleanup:"
|
||||
df -h
|
||||
sudo mkdir -p $TMPDIR/del-target
|
||||
|
||||
tmpify() {
|
||||
@@ -17,30 +15,28 @@ runs:
|
||||
}
|
||||
|
||||
strip_universal_deep() {
|
||||
if [ -d "$1" ]; then
|
||||
opwd=$(pwd)
|
||||
cd $1
|
||||
f=$(find . -perm +111 -type f)
|
||||
for fp in $f
|
||||
do
|
||||
if [[ $(file "$fp") == *"universal binary"* ]]; then
|
||||
if [ "`arch`" == "arm64" ]; then
|
||||
if [[ $(file "$fp") == *"x86_64"* ]]; then
|
||||
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
else
|
||||
if [[ $(file "$fp") == *"arm64e)"* ]]; then
|
||||
sudo lipo -remove arm64e "$fp" -o "$fp" || true
|
||||
fi
|
||||
if [[ $(file "$fp") == *"arm64)"* ]]; then
|
||||
sudo lipo -remove arm64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
opwd=$(pwd)
|
||||
cd $1
|
||||
f=$(find . -perm +111 -type f)
|
||||
for fp in $f
|
||||
do
|
||||
if [[ $(file "$fp") == *"universal binary"* ]]; then
|
||||
if [ "`arch`" == "arm64" ]; then
|
||||
if [[ $(file "$fp") == *"x86_64"* ]]; then
|
||||
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
else
|
||||
if [[ $(file "$fp") == *"arm64e)"* ]]; then
|
||||
sudo lipo -remove arm64e "$fp" -o "$fp" || true
|
||||
fi
|
||||
if [[ $(file "$fp") == *"arm64)"* ]]; then
|
||||
sudo lipo -remove arm64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
fi
|
||||
done
|
||||
fi
|
||||
done
|
||||
|
||||
cd $opwd
|
||||
fi
|
||||
cd $opwd
|
||||
}
|
||||
|
||||
tmpify /Library/Developer/CoreSimulator
|
||||
@@ -62,9 +58,10 @@ runs:
|
||||
|
||||
sudo rm -rf /Applications/Safari.app
|
||||
sudo rm -rf /Applications/Xcode_16.1.app
|
||||
sudo rm -rf /Applications/Xcode_16.2.app
|
||||
sudo rm -rf /Applications/Xcode_16.3.app
|
||||
sudo rm -rf /Applications/Xcode_16.2.app
|
||||
sudo rm -rf /Applications/Google Chrome.app
|
||||
sudo rm -rf /Applications/Xcode_16.4.app
|
||||
sudo rm -rf /Applications/Google Chrome for Testing.app
|
||||
sudo rm -rf /Applications/Firefox.app
|
||||
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
|
||||
@@ -76,5 +73,4 @@ runs:
|
||||
|
||||
# lipo off some huge binaries arm64 versions to save space
|
||||
strip_universal_deep $(xcode-select -p)/../SharedFrameworks
|
||||
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
|
||||
sudo mdutil -a -i off
|
||||
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
|
||||
@@ -15,7 +15,7 @@ runs:
|
||||
git config --global core.preloadindex true
|
||||
git config --global core.longpaths true
|
||||
fi
|
||||
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
|
||||
export BUILD_TOOLS_SHA=8559e5d325d61f195a255f41077ffc9e5b70b0e5
|
||||
npm i -g @electron/build-tools
|
||||
# Update depot_tools to ensure python
|
||||
e d update_depot_tools
|
||||
|
||||
6
.github/workflows/archaeologist-dig.yml
vendored
6
.github/workflows/archaeologist-dig.yml
vendored
@@ -9,11 +9,11 @@ jobs:
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
|
||||
with:
|
||||
fetch-depth: 0
|
||||
- name: Setup Node.js/npm
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
- name: Setting Up Dig Site
|
||||
@@ -41,7 +41,7 @@ jobs:
|
||||
sha-file: .dig-old
|
||||
filename: electron.old.d.ts
|
||||
- name: Upload artifacts
|
||||
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
|
||||
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
|
||||
with:
|
||||
name: artifacts
|
||||
path: electron/artifacts
|
||||
|
||||
15
.github/workflows/audit-branch-ci.yml
vendored
15
.github/workflows/audit-branch-ci.yml
vendored
@@ -15,12 +15,8 @@ jobs:
|
||||
permissions:
|
||||
contents: read
|
||||
steps:
|
||||
- name: Setup Node.js
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
|
||||
with:
|
||||
node-version: 22.17.x
|
||||
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
|
||||
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
|
||||
- run: npm install @actions/cache @electron/fiddle-core
|
||||
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
|
||||
id: audit-errors
|
||||
with:
|
||||
github-token: ${{ secrets.GITHUB_TOKEN }}
|
||||
@@ -33,7 +29,7 @@ jobs:
|
||||
// Only want the most recent workflow run that wasn't skipped or cancelled
|
||||
const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
|
||||
|
||||
const versions = await ElectronVersions.create({ ignoreCache: true });
|
||||
const versions = await ElectronVersions.create(undefined, { ignoreCache: true });
|
||||
const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
|
||||
|
||||
for (const branch of ["main", ...branches]) {
|
||||
@@ -73,7 +69,6 @@ jobs:
|
||||
annotation_level === "failure" &&
|
||||
!message.startsWith("Process completed with exit code") &&
|
||||
!message.startsWith("Response status code does not indicate success") &&
|
||||
!message.startsWith("The hosted runner lost communication with the server") &&
|
||||
!/Unable to make request/.test(message) &&
|
||||
!/The requested URL returned error/.test(message),
|
||||
)
|
||||
@@ -106,6 +101,7 @@ jobs:
|
||||
}
|
||||
|
||||
if (runsWithErrors.length > 0) {
|
||||
core.setOutput('errorsFound', true);
|
||||
core.summary.addHeading('⚠️ Runs with Errors');
|
||||
core.summary.addTable([
|
||||
[
|
||||
@@ -132,7 +128,6 @@ jobs:
|
||||
|
||||
// Set this as failed so it's easy to scan runs to find failures
|
||||
if (runsWithErrors.find((run) => !run.isStale)) {
|
||||
core.setOutput('errorsFound', true);
|
||||
process.exitCode = 1;
|
||||
}
|
||||
} else {
|
||||
@@ -142,7 +137,7 @@ jobs:
|
||||
await core.summary.write();
|
||||
- name: Send Slack message if errors
|
||||
if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
|
||||
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
|
||||
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
|
||||
with:
|
||||
payload: |
|
||||
link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"
|
||||
|
||||
2
.github/workflows/branch-created.yml
vendored
2
.github/workflows/branch-created.yml
vendored
@@ -75,7 +75,7 @@ jobs:
|
||||
org: electron
|
||||
- name: Generate Release Project Board Metadata
|
||||
if: ${{ steps.check-major-version.outputs.MAJOR }}
|
||||
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
|
||||
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
|
||||
id: generate-project-metadata
|
||||
with:
|
||||
script: |
|
||||
|
||||
6
.github/workflows/build-git-cache.yml
vendored
6
.github/workflows/build-git-cache.yml
vendored
@@ -19,7 +19,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -41,7 +41,7 @@ jobs:
|
||||
TARGET_OS: 'win'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -64,7 +64,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
18
.github/workflows/build.yml
vendored
18
.github/workflows/build.yml
vendored
@@ -54,7 +54,7 @@ jobs:
|
||||
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
|
||||
docs-only: ${{ steps.set-output.outputs.docs-only }}
|
||||
steps:
|
||||
- uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
|
||||
with:
|
||||
ref: ${{ github.event.pull_request.head.sha }}
|
||||
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
|
||||
@@ -111,7 +111,7 @@ jobs:
|
||||
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -141,7 +141,7 @@ jobs:
|
||||
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -171,7 +171,7 @@ jobs:
|
||||
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -189,7 +189,7 @@ jobs:
|
||||
with:
|
||||
target-platform: macos
|
||||
target-archs: x64 arm64
|
||||
check-runs-on: macos-15
|
||||
check-runs-on: macos-14
|
||||
gn-build-type: testing
|
||||
secrets: inherit
|
||||
|
||||
@@ -225,8 +225,8 @@ jobs:
|
||||
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
|
||||
needs: checkout-macos
|
||||
with:
|
||||
build-runs-on: macos-15-xlarge
|
||||
test-runs-on: macos-15-large
|
||||
build-runs-on: macos-14-xlarge
|
||||
test-runs-on: macos-13
|
||||
target-platform: macos
|
||||
target-arch: x64
|
||||
is-release: false
|
||||
@@ -244,8 +244,8 @@ jobs:
|
||||
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
|
||||
needs: checkout-macos
|
||||
with:
|
||||
build-runs-on: macos-15-xlarge
|
||||
test-runs-on: macos-15
|
||||
build-runs-on: macos-14-xlarge
|
||||
test-runs-on: macos-14
|
||||
target-platform: macos
|
||||
target-arch: arm64
|
||||
is-release: false
|
||||
|
||||
11
.github/workflows/issue-commented.yml
vendored
11
.github/workflows/issue-commented.yml
vendored
@@ -10,24 +10,15 @@ permissions: {}
|
||||
jobs:
|
||||
issue-commented:
|
||||
name: Remove blocked/{need-info,need-repro} on comment
|
||||
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
|
||||
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Get author association
|
||||
id: get-author-association
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
run: |
|
||||
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
|
||||
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
|
||||
id: generate-token
|
||||
with:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- name: Remove label
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
|
||||
ISSUE_URL: ${{ github.event.issue.html_url }}
|
||||
|
||||
2
.github/workflows/issue-labeled.yml
vendored
2
.github/workflows/issue-labeled.yml
vendored
@@ -72,7 +72,7 @@ jobs:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- name: Create comment
|
||||
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
|
||||
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
|
||||
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
|
||||
with:
|
||||
actions: 'create-comment'
|
||||
token: ${{ steps.generate-token.outputs.token }}
|
||||
|
||||
4
.github/workflows/issue-opened.yml
vendored
4
.github/workflows/issue-opened.yml
vendored
@@ -37,7 +37,7 @@ jobs:
|
||||
org: electron
|
||||
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
|
||||
- name: Add labels
|
||||
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
|
||||
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
|
||||
id: add-labels
|
||||
env:
|
||||
ISSUE_BODY: ${{ github.event.issue.body }}
|
||||
@@ -134,7 +134,7 @@ jobs:
|
||||
}
|
||||
- name: Create unsupported major comment
|
||||
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
|
||||
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
|
||||
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
|
||||
with:
|
||||
actions: 'create-comment'
|
||||
token: ${{ steps.generate-token.outputs.token }}
|
||||
|
||||
2
.github/workflows/linux-publish.yml
vendored
2
.github/workflows/linux-publish.yml
vendored
@@ -31,7 +31,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
10
.github/workflows/macos-publish.yml
vendored
10
.github/workflows/macos-publish.yml
vendored
@@ -32,7 +32,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -47,7 +47,7 @@ jobs:
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: x64
|
||||
target-variant: darwin
|
||||
@@ -62,7 +62,7 @@ jobs:
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: x64
|
||||
target-variant: mas
|
||||
@@ -77,7 +77,7 @@ jobs:
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: arm64
|
||||
target-variant: darwin
|
||||
@@ -92,7 +92,7 @@ jobs:
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: arm64
|
||||
target-variant: mas
|
||||
|
||||
@@ -1,40 +1,30 @@
|
||||
name: Check for Disallowed Non-Maintainer Change
|
||||
name: Check for Non-Maintainer Dependency Change
|
||||
|
||||
on:
|
||||
pull_request_target:
|
||||
paths:
|
||||
- 'yarn.lock'
|
||||
- 'spec/yarn.lock'
|
||||
- '.github/workflows/**'
|
||||
- '.github/actions/**'
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
check-for-non-maintainer-dependency-change:
|
||||
name: Check for disallowed non-maintainer change
|
||||
if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
|
||||
name: Check for non-maintainer dependency change
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.pull_request.author_association) && github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
|
||||
permissions:
|
||||
contents: read
|
||||
pull-requests: write
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Get author association
|
||||
id: get-author-association
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
run: |
|
||||
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
|
||||
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
|
||||
- name: Check for existing review
|
||||
id: check-for-review
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
PR_URL: ${{ github.event.pull_request.html_url }}
|
||||
run: |
|
||||
set -eo pipefail
|
||||
REVIEW_COUNT=$(gh pr view $PR_URL --json reviews | jq '[ .reviews[] | select(.author.login == "github-actions") | select(.body | startswith("<!-- disallowed-non-maintainer-change -->")) ] | length')
|
||||
REVIEW_COUNT=$(gh pr view $PR_URL --json reviews | jq '[ .reviews[] | select(.author.login == "github-actions") | select(.body | startswith("<!-- no-dependency-change -->")) ] | length')
|
||||
if [[ $REVIEW_COUNT -eq 0 ]]; then
|
||||
echo "SHOULD_REVIEW=1" >> "$GITHUB_OUTPUT"
|
||||
fi
|
||||
@@ -44,4 +34,4 @@ jobs:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
PR_URL: ${{ github.event.pull_request.html_url }}
|
||||
run: |
|
||||
printf "<!-- disallowed-non-maintainer-change -->\n\nHello @${{ github.event.pull_request.user.login }}! It looks like this pull request touches one of our dependency or CI files, and per [our contribution policy](https://github.com/electron/electron/blob/main/CONTRIBUTING.md#dependencies-upgrades-policy) we do not accept these types of changes in PRs." | gh pr review $PR_URL -r --body-file=-
|
||||
printf "<!-- no-dependency-change -->\n\nHello @${{ github.event.pull_request.user.login }}! It looks like this pull request touches one of our dependency files, and per [our contribution policy](https://github.com/electron/electron/blob/main/CONTRIBUTING.md#dependencies-upgrades-policy) we do not accept these types of changes in PRs." | gh pr review $PR_URL -r --body-file=-
|
||||
|
||||
@@ -23,7 +23,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -39,7 +39,7 @@ jobs:
|
||||
with:
|
||||
target-platform: linux
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
2
.github/workflows/pipeline-electron-lint.yml
vendored
2
.github/workflows/pipeline-electron-lint.yml
vendored
@@ -23,7 +23,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
@@ -66,7 +66,6 @@ concurrency:
|
||||
env:
|
||||
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
|
||||
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
|
||||
DD_API_KEY: ${{ secrets.DD_API_KEY }}
|
||||
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
|
||||
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
|
||||
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
|
||||
@@ -85,13 +84,12 @@ jobs:
|
||||
environment: ${{ inputs.environment }}
|
||||
env:
|
||||
TARGET_ARCH: ${{ inputs.target-arch }}
|
||||
TARGET_PLATFORM: ${{ inputs.target-platform }}
|
||||
steps:
|
||||
- name: Create src dir
|
||||
run: |
|
||||
mkdir src
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -115,7 +113,7 @@ jobs:
|
||||
run: df -h
|
||||
- name: Setup Node.js/npm
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
cache: yarn
|
||||
@@ -159,7 +157,7 @@ jobs:
|
||||
if: ${{ inputs.target-platform == 'linux' }}
|
||||
uses: ./src/electron/.github/actions/restore-cache-aks
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
@@ -44,7 +44,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.check-container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -111,7 +111,7 @@ jobs:
|
||||
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
|
||||
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
@@ -68,16 +68,14 @@ jobs:
|
||||
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
|
||||
run: |
|
||||
cp $(which node) /mnt/runner-externals/node20/bin/
|
||||
cp $(which node) /mnt/runner-externals/node24/bin/
|
||||
- name: Setup Node.js/npm
|
||||
if: ${{ inputs.target-platform == 'win' }}
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
- name: Add TCC permissions on macOS
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: |
|
||||
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
|
||||
configure_user_tccdb () {
|
||||
local values=$1
|
||||
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
|
||||
@@ -96,14 +94,11 @@ jobs:
|
||||
"'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
|
||||
)
|
||||
for values in "${userValuesArray[@]}"; do
|
||||
# Sonoma and higher have a few extra values
|
||||
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
|
||||
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
|
||||
if [ "$OSTYPE" = "darwin23" ]; then
|
||||
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
|
||||
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
|
||||
else
|
||||
@@ -114,21 +109,12 @@ jobs:
|
||||
- name: Turn off the unexpectedly quit dialog on macOS
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: defaults write com.apple.CrashReporter DialogType server
|
||||
- name: Set xcode to 16.4
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
ref: ${{ github.event.pull_request.head.sha }}
|
||||
- name: Turn off screenshot nag on macOS
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: |
|
||||
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
|
||||
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
|
||||
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
|
||||
- name: Setup SSH Debugging
|
||||
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
|
||||
uses: ./src/electron/.github/actions/ssh-debug
|
||||
@@ -167,35 +153,39 @@ jobs:
|
||||
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
|
||||
echo "IS_ASAN=true" >> $GITHUB_ENV
|
||||
- name: Download Generated Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
|
||||
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
|
||||
- name: Download Src Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: src_artifacts_${{ env.ARTIFACT_KEY }}
|
||||
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
|
||||
- name: Restore Generated Artifacts
|
||||
run: ./src/electron/script/actions/restore-artifacts.sh
|
||||
- name: Unzip Dist (win)
|
||||
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
|
||||
if: ${{ inputs.target-platform == 'win' }}
|
||||
shell: powershell
|
||||
run: |
|
||||
Set-ExecutionPolicy Bypass -Scope Process -Force
|
||||
cd src/out/Default
|
||||
Expand-Archive -Force dist.zip -DestinationPath ./
|
||||
- name: Unzip Dist (unix)
|
||||
Expand-Archive -Force chromedriver.zip -DestinationPath ./
|
||||
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
|
||||
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
|
||||
if: ${{ inputs.target-platform != 'win' }}
|
||||
run: |
|
||||
cd src/out/Default
|
||||
unzip -:o dist.zip
|
||||
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
|
||||
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
|
||||
# run: |
|
||||
# sudo security authorizationdb write com.apple.trust-settings.admin allow
|
||||
# cd src/electron
|
||||
# ./script/codesign/generate-identity.sh
|
||||
unzip -:o chromedriver.zip
|
||||
unzip -:o mksnapshot.zip
|
||||
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
|
||||
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
|
||||
run: |
|
||||
sudo security authorizationdb write com.apple.trust-settings.admin allow
|
||||
cd src/electron
|
||||
./script/codesign/generate-identity.sh
|
||||
- name: Install Datadog CLI
|
||||
run: |
|
||||
cd src/electron
|
||||
@@ -225,7 +215,7 @@ jobs:
|
||||
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
|
||||
fi
|
||||
fi
|
||||
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
|
||||
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
|
||||
else
|
||||
chown :builduser .. && chmod g+w ..
|
||||
chown -R :builduser . && chmod -R g+w .
|
||||
@@ -262,7 +252,7 @@ jobs:
|
||||
if: always() && !cancelled()
|
||||
- name: Upload Test Artifacts
|
||||
if: always() && !cancelled()
|
||||
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
|
||||
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
|
||||
with:
|
||||
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
|
||||
path: src/electron/spec/artifacts
|
||||
|
||||
@@ -46,7 +46,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.test-container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -61,12 +61,12 @@ jobs:
|
||||
- name: Install Dependencies
|
||||
uses: ./src/electron/.github/actions/install-dependencies
|
||||
- name: Download Generated Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
- name: Download Src Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
@@ -100,7 +100,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.test-container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -115,12 +115,12 @@ jobs:
|
||||
- name: Install Dependencies
|
||||
uses: ./src/electron/.github/actions/install-dependencies
|
||||
- name: Download Generated Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
- name: Download Src Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
|
||||
7
.github/workflows/pull-request-labeled.yml
vendored
7
.github/workflows/pull-request-labeled.yml
vendored
@@ -13,16 +13,13 @@ jobs:
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Trigger Slack workflow
|
||||
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
|
||||
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
|
||||
with:
|
||||
webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
|
||||
webhook-type: webhook-trigger
|
||||
payload: |
|
||||
{
|
||||
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
|
||||
"title": ${{ toJSON(github.event.pull_request.title) }},
|
||||
"url": ${{ toJSON(github.event.pull_request.html_url) }},
|
||||
"user": ${{ toJSON(github.event.pull_request.user.login) }}
|
||||
"url": "${{ github.event.pull_request.html_url }}"
|
||||
}
|
||||
pull-request-labeled-deprecation-review-complete:
|
||||
name: deprecation-review/complete label added
|
||||
|
||||
8
.github/workflows/scorecards.yml
vendored
8
.github/workflows/scorecards.yml
vendored
@@ -22,13 +22,13 @@ jobs:
|
||||
|
||||
steps:
|
||||
- name: "Checkout code"
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
|
||||
with:
|
||||
persist-credentials: false
|
||||
|
||||
# This is a pre-submit / pre-release.
|
||||
- name: "Run analysis"
|
||||
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
|
||||
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
|
||||
with:
|
||||
results_file: results.sarif
|
||||
results_format: sarif
|
||||
@@ -42,7 +42,7 @@ jobs:
|
||||
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
|
||||
# format to the repository Actions tab.
|
||||
- name: "Upload artifact"
|
||||
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
|
||||
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
|
||||
with:
|
||||
name: SARIF file
|
||||
path: results.sarif
|
||||
@@ -50,6 +50,6 @@ jobs:
|
||||
|
||||
# Upload the results to GitHub's code scanning dashboard.
|
||||
- name: "Upload to code-scanning"
|
||||
uses: github/codeql-action/upload-sarif@4e94bd11f71e507f7f87df81788dff88d1dacbfb # v3.29.5
|
||||
uses: github/codeql-action/upload-sarif@ce28f5bb42b7a9f2c824e633a3f6ee835bab6858 # v3.29.0
|
||||
with:
|
||||
sarif_file: results.sarif
|
||||
|
||||
2
.github/workflows/semantic.yml
vendored
2
.github/workflows/semantic.yml
vendored
@@ -19,7 +19,7 @@ jobs:
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: semantic-pull-request
|
||||
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
|
||||
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
with:
|
||||
|
||||
6
.github/workflows/stale.yml
vendored
6
.github/workflows/stale.yml
vendored
@@ -16,7 +16,7 @@ jobs:
|
||||
id: generate-token
|
||||
with:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
|
||||
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
|
||||
with:
|
||||
repo-token: ${{ steps.generate-token.outputs.token }}
|
||||
days-before-stale: 90
|
||||
@@ -27,7 +27,7 @@ jobs:
|
||||
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
|
||||
close-issue-message: >
|
||||
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
|
||||
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
|
||||
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
|
||||
only-pr-labels: not-a-real-label
|
||||
pending-repro:
|
||||
runs-on: ubuntu-latest
|
||||
@@ -39,7 +39,7 @@ jobs:
|
||||
id: generate-token
|
||||
with:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
|
||||
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
|
||||
with:
|
||||
repo-token: ${{ steps.generate-token.outputs.token }}
|
||||
days-before-stale: -1
|
||||
|
||||
2
.github/workflows/windows-publish.yml
vendored
2
.github/workflows/windows-publish.yml
vendored
@@ -36,7 +36,7 @@ jobs:
|
||||
build-image-sha: ${{ inputs.build-image-sha }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
37
BUILD.gn
37
BUILD.gn
@@ -586,13 +586,7 @@ source_set("electron_lib") {
|
||||
}
|
||||
|
||||
if (is_mac) {
|
||||
# Disable C++ modules to resolve linking error when including MacOS SDK
|
||||
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
|
||||
# TODO(samuelmaddock): consider revisiting this in the future
|
||||
use_libcxx_modules = false
|
||||
|
||||
deps += [
|
||||
"//components/os_crypt/common:keychain_password_mac",
|
||||
"//components/remote_cocoa/app_shim",
|
||||
"//components/remote_cocoa/browser",
|
||||
"//content/browser:mac_helpers",
|
||||
@@ -661,7 +655,6 @@ source_set("electron_lib") {
|
||||
"//ui/events/devices/x11",
|
||||
"//ui/events/platform/x11",
|
||||
"//ui/gtk:gtk_config",
|
||||
"//ui/linux:display_server_utils",
|
||||
"//ui/linux:linux_ui",
|
||||
"//ui/linux:linux_ui_factory",
|
||||
"//ui/wm",
|
||||
@@ -695,6 +688,7 @@ source_set("electron_lib") {
|
||||
"//components/app_launch_prefetch",
|
||||
"//components/crash/core/app:crash_export_thunks",
|
||||
"//third_party/libxml:xml_writer",
|
||||
"//ui/native_theme:native_theme_browser",
|
||||
"//ui/wm",
|
||||
"//ui/wm/public",
|
||||
]
|
||||
@@ -786,13 +780,9 @@ source_set("electron_lib") {
|
||||
|
||||
action("mksnapshot_checksum_gen") {
|
||||
script = "build/checksum_header.py"
|
||||
|
||||
outputs = [ "$target_gen_dir/snapshot_checksum.h" ]
|
||||
inputs = [ "$root_out_dir/$v8_context_snapshot_filename" ]
|
||||
args = rebase_path(inputs)
|
||||
|
||||
args += rebase_path(outputs)
|
||||
|
||||
args = rebase_path(inputs) + rebase_path(outputs)
|
||||
deps = [ "//tools/v8_context_snapshot" ]
|
||||
}
|
||||
|
||||
@@ -1625,29 +1615,6 @@ group("node_headers") {
|
||||
public_deps = [ ":tar_node_headers" ]
|
||||
}
|
||||
|
||||
group("testing_build") {
|
||||
public_deps = [
|
||||
":electron_dist_zip",
|
||||
":electron_mksnapshot_zip",
|
||||
":node_headers",
|
||||
]
|
||||
}
|
||||
|
||||
group("release_build") {
|
||||
public_deps = [ ":testing_build" ]
|
||||
if (is_official_build) {
|
||||
public_deps += [ ":electron_symbols" ]
|
||||
}
|
||||
if (is_linux) {
|
||||
public_deps += [
|
||||
":hunspell_dictionaries_zip",
|
||||
":libcxx_headers_zip",
|
||||
":libcxx_objects_zip",
|
||||
":libcxxabi_headers_zip",
|
||||
]
|
||||
}
|
||||
}
|
||||
|
||||
if (is_linux && is_official_build) {
|
||||
strip_binary("strip_electron_binary") {
|
||||
binary_input = "$root_out_dir/$electron_project_name"
|
||||
|
||||
6
DEPS
6
DEPS
@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
|
||||
|
||||
vars = {
|
||||
'chromium_version':
|
||||
'144.0.7500.0',
|
||||
'140.0.7339.80',
|
||||
'node_version':
|
||||
'v24.11.0',
|
||||
'v22.19.0',
|
||||
'nan_version':
|
||||
'675cefebca42410733da8a454c8d9391fcebfbc2',
|
||||
'e14bdcd1f72d62bca1d541b66da43130384ec213',
|
||||
'squirrel.mac_version':
|
||||
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
|
||||
'reactiveobjc_version':
|
||||
|
||||
@@ -39,7 +39,7 @@ Each Electron release provides binaries for macOS, Windows, and Linux.
|
||||
|
||||
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
|
||||
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
|
||||
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
|
||||
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
|
||||
* Ubuntu 18.04 and newer
|
||||
* Fedora 32 and newer
|
||||
* Debian 10 and newer
|
||||
|
||||
@@ -8,12 +8,6 @@ The Electron team will send a response indicating the next steps in handling you
|
||||
|
||||
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
|
||||
|
||||
## Escalation
|
||||
|
||||
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
|
||||
|
||||
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
|
||||
|
||||
## The Electron Security Notification Process
|
||||
|
||||
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.
|
||||
|
||||
@@ -2,7 +2,7 @@ is_electron_build = true
|
||||
root_extra_deps = [ "//electron" ]
|
||||
|
||||
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
|
||||
node_module_version = 143
|
||||
node_module_version = 139
|
||||
|
||||
v8_promise_internal_field_count = 1
|
||||
v8_embedder_string = "-electron.0"
|
||||
@@ -19,15 +19,15 @@ proprietary_codecs = true
|
||||
|
||||
enable_printing = true
|
||||
|
||||
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
|
||||
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
|
||||
use_clang_modules = false
|
||||
|
||||
# Removes DLLs from the build, which are only meant to be used for Chromium development.
|
||||
# See https://github.com/electron/electron/pull/17985
|
||||
angle_enable_vulkan_validation_layers = false
|
||||
dawn_enable_vulkan_validation_layers = false
|
||||
|
||||
# Removes dxc dll's that are only used experimentally.
|
||||
# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
|
||||
dawn_use_built_dxc = false
|
||||
|
||||
# These are disabled because they cause the zip manifest to differ between
|
||||
# testing and release builds.
|
||||
# See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.
|
||||
@@ -72,9 +72,3 @@ enterprise_cloud_content_analysis = false
|
||||
|
||||
# We don't use anything from here, and it causes target collisions
|
||||
enable_linux_installer = false
|
||||
|
||||
# Disable "Save to Drive" feature in PDF viewer
|
||||
enable_pdf_save_to_drive = false
|
||||
|
||||
# Explictly disable use_reclient until reclient is completely removed
|
||||
use_reclient = false
|
||||
|
||||
@@ -12,7 +12,7 @@ TEMPLATE_H = """
|
||||
|
||||
namespace electron::snapshot_checksum {
|
||||
|
||||
inline constexpr std::string_view kChecksum = "{checksum}";
|
||||
const std::string kChecksum = "{checksum}";
|
||||
|
||||
} // namespace electron::snapshot_checksum
|
||||
|
||||
|
||||
@@ -67,6 +67,10 @@ template("mac_xib_bundle_data") {
|
||||
ibtool_flags = [
|
||||
"--minimum-deployment-target",
|
||||
mac_deployment_target,
|
||||
|
||||
# TODO(rsesek): Enable this once all the bots are on Xcode 7+.
|
||||
# "--target-device",
|
||||
# "mac",
|
||||
]
|
||||
}
|
||||
|
||||
|
||||
@@ -23,8 +23,6 @@ static_library("chrome") {
|
||||
"//chrome/browser/browser_process.h",
|
||||
"//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
|
||||
"//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
|
||||
"//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
|
||||
"//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
|
||||
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
|
||||
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
|
||||
"//chrome/browser/devtools/devtools_eye_dropper.cc",
|
||||
@@ -144,6 +142,8 @@ static_library("chrome") {
|
||||
"//chrome/browser/ui/views/overlay/toggle_camera_button.h",
|
||||
"//chrome/browser/ui/views/overlay/toggle_microphone_button.cc",
|
||||
"//chrome/browser/ui/views/overlay/toggle_microphone_button.h",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_views.cc",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_views.h",
|
||||
"//chrome/browser/ui/views/picture_in_picture/picture_in_picture_bounds_change_animation.cc",
|
||||
@@ -280,8 +280,6 @@ static_library("chrome") {
|
||||
"//chrome/browser/process_singleton_mac.mm",
|
||||
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.h",
|
||||
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.mm",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
|
||||
]
|
||||
deps += [ ":system_media_capture_permissions_mac_conflict" ]
|
||||
}
|
||||
@@ -504,17 +502,15 @@ source_set("chrome_spellchecker") {
|
||||
]
|
||||
}
|
||||
|
||||
if (is_mac) {
|
||||
# These sources create an object file conflict with one in |:chrome|, so they
|
||||
# must live in a separate target.
|
||||
# Conflicting sources:
|
||||
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
|
||||
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
|
||||
source_set("system_media_capture_permissions_mac_conflict") {
|
||||
sources = [
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
|
||||
]
|
||||
deps = [ "//chrome/common" ]
|
||||
}
|
||||
# These sources create an object file conflict with one in |:chrome|, so they
|
||||
# must live in a separate target.
|
||||
# Conflicting sources:
|
||||
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
|
||||
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
|
||||
source_set("system_media_capture_permissions_mac_conflict") {
|
||||
sources = [
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
|
||||
]
|
||||
deps = [ "//chrome/common" ]
|
||||
}
|
||||
|
||||
@@ -421,7 +421,6 @@ Returns:
|
||||
* `oom` - Process ran out of memory
|
||||
* `launch-failed` - Process never successfully launched
|
||||
* `integrity-failure` - Windows code integrity checks failed
|
||||
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
|
||||
* `exitCode` number - The exit code for the process
|
||||
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
|
||||
* `serviceName` string (optional) - The non-localized name of the process.
|
||||
@@ -1215,13 +1214,6 @@ Disables hardware acceleration for current app.
|
||||
|
||||
This method can only be called before app is ready.
|
||||
|
||||
### `app.isHardwareAccelerationEnabled()`
|
||||
|
||||
Returns `boolean` - whether hardware acceleration is currently disabled.
|
||||
|
||||
> [!NOTE]
|
||||
> This information is only usable after the `gpu-info-update` event is emitted.
|
||||
|
||||
### `app.disableDomainBlockingFor3DAPIs()`
|
||||
|
||||
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
|
||||
@@ -1405,75 +1397,7 @@ details. Disabled by default.
|
||||
This API must be called after the `ready` event is emitted.
|
||||
|
||||
> [!NOTE]
|
||||
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
|
||||
|
||||
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
|
||||
|
||||
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
|
||||
|
||||
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
|
||||
* `webContents` - Web contents accessibility tree exposure enabled.
|
||||
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
|
||||
* `extendedProperties` - Extended accessibility properties enabled.
|
||||
* `screenReader` - Screen reader specific mode enabled.
|
||||
* `html` - HTML accessibility tree construction enabled.
|
||||
* `labelImages` - Accessibility support for automatic image annotations.
|
||||
* `pdfPrinting` - Accessibility support for PDF printing enabled.
|
||||
|
||||
Notes:
|
||||
|
||||
* The array may be empty if no accessibility modes are active.
|
||||
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
|
||||
prefer this method for granular diagnostics or telemetry.
|
||||
|
||||
Example:
|
||||
|
||||
```js
|
||||
const { app } = require('electron')
|
||||
|
||||
app.whenReady().then(() => {
|
||||
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
|
||||
// Change some app UI to better work with Screen Readers.
|
||||
}
|
||||
})
|
||||
```
|
||||
|
||||
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
|
||||
|
||||
* `features` string[] - An array of the accessibility features to enable.
|
||||
|
||||
Possible values are:
|
||||
|
||||
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
|
||||
* `webContents` - Web contents accessibility tree exposure enabled.
|
||||
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
|
||||
* `extendedProperties` - Extended accessibility properties enabled.
|
||||
* `screenReader` - Screen reader specific mode enabled.
|
||||
* `html` - HTML accessibility tree construction enabled.
|
||||
* `labelImages` - Accessibility support for automatic image annotations.
|
||||
* `pdfPrinting` - Accessibility support for PDF printing enabled.
|
||||
|
||||
To disable all supported features, pass an empty array `[]`.
|
||||
|
||||
Example:
|
||||
|
||||
```js
|
||||
const { app } = require('electron')
|
||||
|
||||
app.whenReady().then(() => {
|
||||
// Enable a subset of features:
|
||||
app.setAccessibilitySupportFeatures([
|
||||
'screenReader',
|
||||
'pdfPrinting',
|
||||
'webContents'
|
||||
])
|
||||
|
||||
// Other logic
|
||||
|
||||
// Some time later, disable all features:
|
||||
app.setAccessibilitySupportFeatures([])
|
||||
})
|
||||
```
|
||||
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
|
||||
|
||||
### `app.showAboutPanel()`
|
||||
|
||||
|
||||
@@ -1262,16 +1262,15 @@ Sets the properties for the window's taskbar button.
|
||||
|
||||
#### `win.setAccentColor(accentColor)` _Windows_
|
||||
|
||||
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
|
||||
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
|
||||
|
||||
Sets the system accent color and highlighting of active window border.
|
||||
|
||||
The `accentColor` parameter accepts the following values:
|
||||
|
||||
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
|
||||
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
|
||||
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
|
||||
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
|
||||
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
|
||||
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
|
||||
* **`false`** - Explicitly disables accent color highlighting for the window.
|
||||
|
||||
Examples:
|
||||
|
||||
@@ -1284,14 +1283,11 @@ win.setAccentColor('#ff0000')
|
||||
// RGB format (alpha ignored if present).
|
||||
win.setAccentColor('rgba(255,0,0,0.5)')
|
||||
|
||||
// Enable accent color, using the color specified in System Settings.
|
||||
// Use system accent color.
|
||||
win.setAccentColor(true)
|
||||
|
||||
// Disable accent color.
|
||||
win.setAccentColor(false)
|
||||
|
||||
// Reset window accent color behavior to follow behavior set in System Settings.
|
||||
win.setAccentColor(null)
|
||||
```
|
||||
|
||||
#### `win.getAccentColor()` _Windows_
|
||||
|
||||
@@ -1442,16 +1442,15 @@ Sets the properties for the window's taskbar button.
|
||||
|
||||
#### `win.setAccentColor(accentColor)` _Windows_
|
||||
|
||||
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
|
||||
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
|
||||
|
||||
Sets the system accent color and highlighting of active window border.
|
||||
|
||||
The `accentColor` parameter accepts the following values:
|
||||
|
||||
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
|
||||
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
|
||||
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
|
||||
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
|
||||
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
|
||||
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
|
||||
* **`false`** - Explicitly disables accent color highlighting for the window.
|
||||
|
||||
Examples:
|
||||
|
||||
@@ -1464,14 +1463,11 @@ win.setAccentColor('#ff0000')
|
||||
// RGB format (alpha ignored if present).
|
||||
win.setAccentColor('rgba(255,0,0,0.5)')
|
||||
|
||||
// Enable accent color, using the color specified in System Settings.
|
||||
// Use system accent color.
|
||||
win.setAccentColor(true)
|
||||
|
||||
// Disable accent color.
|
||||
win.setAccentColor(false)
|
||||
|
||||
// Reset window accent color behavior to follow behavior set in System Settings.
|
||||
win.setAccentColor(null)
|
||||
```
|
||||
|
||||
#### `win.getAccentColor()` _Windows_
|
||||
@@ -1574,18 +1570,11 @@ events.
|
||||
|
||||
Prevents the window contents from being captured by other apps.
|
||||
|
||||
On Windows, it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
|
||||
On macOS it sets the NSWindow's [`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc) to [`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
|
||||
On Windows it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
|
||||
For Windows 10 version 2004 and up the window will be removed from capture entirely,
|
||||
older Windows versions behave as if `WDA_MONITOR` is applied capturing a black window.
|
||||
|
||||
On macOS, it sets the `NSWindow`'s
|
||||
[`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc)
|
||||
to
|
||||
[`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
|
||||
Unfortunately, due to an intentional change in macOS, newer Mac applications that use
|
||||
`ScreenCaptureKit` will capture your window despite `win.setContentProtection(true)`.
|
||||
See [here](https://github.com/electron/electron/issues/48258#issuecomment-3269893618).
|
||||
|
||||
#### `win.isContentProtected()` _macOS_ _Windows_
|
||||
|
||||
Returns `boolean` - whether or not content protection is currently enabled.
|
||||
|
||||
@@ -4,12 +4,6 @@
|
||||
|
||||
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
|
||||
|
||||
> [!IMPORTANT]
|
||||
> If you want to call this API from a renderer process with context isolation enabled,
|
||||
> place the API call in your preload script and
|
||||
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
|
||||
> [`contextBridge`](context-bridge.md) API.
|
||||
|
||||
On Linux, there is also a `selection` clipboard. To manipulate it
|
||||
you need to pass `selection` to each method:
|
||||
|
||||
|
||||
@@ -86,7 +86,7 @@ Field trials to be forcefully enabled or disabled.
|
||||
|
||||
For example: `WebRTC-Audio-Red-For-Opus/Enabled/`
|
||||
|
||||
### --host-rules=`rules` _Deprecated_
|
||||
### --host-rules=`rules`
|
||||
|
||||
A comma-separated list of `rules` that control how hostnames are mapped.
|
||||
|
||||
@@ -104,23 +104,9 @@ These mappings apply to the endpoint host in a net request (the TCP connect
|
||||
and host resolver in a direct connection, and the `CONNECT` in an HTTP proxy
|
||||
connection, and the endpoint host in a `SOCKS` proxy connection).
|
||||
|
||||
**Deprecated:** Use the `--host-resolver-rules` switch instead.
|
||||
|
||||
### --host-resolver-rules=`rules`
|
||||
|
||||
A comma-separated list of `rules` that control how hostnames are mapped.
|
||||
|
||||
For example:
|
||||
|
||||
* `MAP * 127.0.0.1` Forces all hostnames to be mapped to 127.0.0.1
|
||||
* `MAP *.google.com proxy` Forces all google.com subdomains to be resolved to
|
||||
"proxy".
|
||||
* `MAP test.com [::1]:77` Forces "test.com" to resolve to IPv6 loopback. Will
|
||||
also force the port of the resulting socket address to be 77.
|
||||
* `MAP * baz, EXCLUDE www.google.com` Remaps everything to "baz", except for
|
||||
"www.google.com".
|
||||
|
||||
These `rules` only apply to the host resolver.
|
||||
Like `--host-rules` but these `rules` only apply to the host resolver.
|
||||
|
||||
### --ignore-certificate-errors
|
||||
|
||||
@@ -193,11 +179,6 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
|
||||
Forces renderer process and Chromium helper processes to run un-sandboxed.
|
||||
Should only be used for testing.
|
||||
|
||||
### --no-stdio-init
|
||||
|
||||
Disable stdio initialization during node initialization.
|
||||
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
|
||||
|
||||
### --proxy-bypass-list=`hosts`
|
||||
|
||||
Instructs Electron to bypass the proxy server for the given semi-colon-separated
|
||||
@@ -350,22 +331,6 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
|
||||
|
||||
Disable exposition of [Navigator API][] on the global scope from Node.js.
|
||||
|
||||
## Chromium Flags
|
||||
|
||||
There isn't a documented list of all Chromium switches, but there are a few ways to find them.
|
||||
|
||||
The easiest way is through Chromium's flags page, which you can access at `about://flags`. These flags don't directly match switch names, but they show up in the process's command-line arguments.
|
||||
|
||||
To see these arguments, enable a flag in `about://flags`, then go to `about://version` in Chromium. You'll find a list of command-line arguments, including `--flag-switches-begin --your --list --flag-switches-end`, which contains the list of your flag enabled switches.
|
||||
|
||||
Most flags are included as part of `--enable-features=`, but some are standalone switches, like `--enable-experimental-web-platform-features`.
|
||||
|
||||
A complete list of flags exists in [Chromium's flag metadata page](https://source.chromium.org/chromium/chromium/src/+/main:chrome/browser/flag-metadata.json), but this list includes platform, environment and GPU specific, expired and potentially non-functional flags, so many of them might not always work in every situation.
|
||||
|
||||
Keep in mind that standalone switches can sometimes be split into individual features, so there's no fully complete list of switches.
|
||||
|
||||
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
|
||||
|
||||
[app]: app.md
|
||||
[append-switch]: command-line.md#commandlineappendswitchswitch-value
|
||||
[debugging-main-process]: ../tutorial/debugging-main-process.md
|
||||
|
||||
@@ -157,7 +157,6 @@ has been included below for completeness:
|
||||
| [Cloneable Types](https://developer.mozilla.org/en-US/docs/Web/API/Web_Workers_API/Structured_clone_algorithm) | Simple | ✅ | ✅ | See the linked document on cloneable types |
|
||||
| `Element` | Complex | ✅ | ✅ | Prototype modifications are dropped. Sending custom elements will not work. |
|
||||
| `Blob` | Complex | ✅ | ✅ | N/A |
|
||||
| `VideoFrame` | Complex | ✅ | ✅ | N/A |
|
||||
| `Symbol` | N/A | ❌ | ❌ | Symbols cannot be copied across contexts so they are dropped |
|
||||
|
||||
If the type you care about is not in the above table, it is probably not supported.
|
||||
|
||||
@@ -4,12 +4,6 @@
|
||||
|
||||
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
|
||||
|
||||
> [!IMPORTANT]
|
||||
> If you want to call this API from a renderer process with context isolation enabled,
|
||||
> place the API call in your preload script and
|
||||
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
|
||||
> [`contextBridge`](context-bridge.md) API.
|
||||
|
||||
The following is an example of setting up Electron to automatically submit
|
||||
crash reports to a remote server:
|
||||
|
||||
|
||||
@@ -102,10 +102,6 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
|
||||
|
||||
## Caveats
|
||||
|
||||
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
|
||||
|
||||
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
|
||||
|
||||
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
|
||||
|
||||
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.
|
||||
|
||||
@@ -186,3 +186,14 @@ the one downloaded by `npm install`. Usage:
|
||||
```sh
|
||||
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
|
||||
```
|
||||
|
||||
## Set By Electron
|
||||
|
||||
Electron sets some variables in your environment at runtime.
|
||||
|
||||
### `ORIGINAL_XDG_CURRENT_DESKTOP`
|
||||
|
||||
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
|
||||
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
|
||||
to affect other logic within Chromium so if you want access to the _original_ value
|
||||
you should look up this environment variable instead.
|
||||
|
||||
@@ -20,12 +20,6 @@ changes:
|
||||
|
||||
Process: [Renderer](../glossary.md#renderer-process)
|
||||
|
||||
> [!IMPORTANT]
|
||||
> If you want to call this API from a renderer process with context isolation enabled,
|
||||
> place the API call in your preload script and
|
||||
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
|
||||
> [`contextBridge`](context-bridge.md) API.
|
||||
|
||||
The `ipcRenderer` module is an [EventEmitter][event-emitter]. It provides a few
|
||||
methods so you can send synchronous and asynchronous messages from the render
|
||||
process (web page) to the main process. You can also receive replies from the
|
||||
|
||||
@@ -4,12 +4,6 @@
|
||||
|
||||
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
|
||||
|
||||
> [!IMPORTANT]
|
||||
> If you want to call this API from a renderer process with context isolation enabled,
|
||||
> place the API call in your preload script and
|
||||
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
|
||||
> [`contextBridge`](context-bridge.md) API.
|
||||
|
||||
The `nativeImage` module provides a unified interface for manipulating
|
||||
system images. These can be handy if you want to provide multiple scaled
|
||||
versions of the same icon or take advantage of macOS [template images][template-image].
|
||||
|
||||
@@ -66,7 +66,7 @@ The `session` module has the following properties:
|
||||
|
||||
### `session.defaultSession`
|
||||
|
||||
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
|
||||
A `Session` object, the default session object of the app.
|
||||
|
||||
## Class: Session
|
||||
|
||||
@@ -939,18 +939,14 @@ session.fromPartition('some-partition').setPermissionRequestHandler((webContents
|
||||
* `top-level-storage-access` - Allow top-level sites to request third-party cookie access on behalf of embedded content originating from another site in the same related website set using the [Storage Access API](https://developer.mozilla.org/en-US/docs/Web/API/Storage_Access_API).
|
||||
* `usb` - Expose non-standard Universal Serial Bus (USB) compatible devices services to the web with the [WebUSB API](https://developer.mozilla.org/en-US/docs/Web/API/WebUSB_API).
|
||||
* `deprecated-sync-clipboard-read` _Deprecated_ - Request access to run `document.execCommand("paste")`
|
||||
* `fileSystem` - Access to read, write, and file management capabilities using the [File System API](https://developer.mozilla.org/en-US/docs/Web/API/File_System_API).
|
||||
* `requestingOrigin` string - The origin URL of the permission check
|
||||
* `details` Object - Some properties are only available on certain permission types.
|
||||
* `embeddingOrigin` string (optional) - The origin of the frame embedding the frame that made the permission check. Only set for cross-origin sub frames making permission checks.
|
||||
* `securityOrigin` string (optional) - The security origin of the `media` check.
|
||||
* `mediaType` string (optional) - The type of media access being requested, can be `video`,
|
||||
`audio` or `unknown`.
|
||||
`audio` or `unknown`
|
||||
* `requestingUrl` string (optional) - The last URL the requesting frame loaded. This is not provided for cross-origin sub frames making permission checks.
|
||||
* `isMainFrame` boolean - Whether the frame making the request is the main frame.
|
||||
* `filePath` string (optional) - The path of a `fileSystem` request.
|
||||
* `isDirectory` boolean (optional) - Whether a `fileSystem` request is a directory.
|
||||
* `fileAccessType` string (optional) - The access type of a `fileSystem` request. Can be `writable` or `readable`.
|
||||
* `isMainFrame` boolean - Whether the frame making the request is the main frame
|
||||
|
||||
Sets the handler which can be used to respond to permission checks for the `session`.
|
||||
Returning `true` will allow the permission and `false` will reject it. Please note that
|
||||
@@ -972,9 +968,6 @@ session.fromPartition('some-partition').setPermissionCheckHandler((webContents,
|
||||
})
|
||||
```
|
||||
|
||||
> [!NOTE]
|
||||
> `isMainFrame` will always be `false` for a `fileSystem` request as a result of Chromium limitations.
|
||||
|
||||
#### `ses.setDisplayMediaRequestHandler(handler[, opts])`
|
||||
|
||||
* `handler` Function | null
|
||||
|
||||
@@ -102,10 +102,9 @@
|
||||
should have rounded corners. Default is `true`. Setting this property
|
||||
to `false` will prevent the window from being fullscreenable on macOS.
|
||||
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
|
||||
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
|
||||
frameless windows on Windows, which adds the standard window frame. Setting it
|
||||
to `false` will remove window shadow and window animations, and disable window
|
||||
resizing via dragging the window edges. Default is `true`.
|
||||
* `thickFrame` boolean (optional) - Use `WS_THICKFRAME` style for frameless windows on
|
||||
Windows, which adds standard window frame. Setting it to `false` will remove
|
||||
window shadow and window animations. Default is `true`.
|
||||
* `vibrancy` string (optional) _macOS_ - Add a type of vibrancy effect to
|
||||
the window, only on macOS. Can be `appearance-based`, `titlebar`, `selection`,
|
||||
`menu`, `popover`, `sidebar`, `header`, `sheet`, `window`, `hud`, `fullscreen-ui`,
|
||||
|
||||
@@ -1,195 +0,0 @@
|
||||
# ColorSpace Object
|
||||
|
||||
* `primaries` string - The color primaries of the color space. Can be one of the following values:
|
||||
* `bt709` - BT709 primaries (also used for sRGB)
|
||||
* `bt470m` - BT470M primaries
|
||||
* `bt470bg` - BT470BG primaries
|
||||
* `smpte170m` - SMPTE170M primaries
|
||||
* `smpte240m` - SMPTE240M primaries
|
||||
* `film` - Film primaries
|
||||
* `bt2020` - BT2020 primaries
|
||||
* `smptest428-1` - SMPTEST428-1 primaries
|
||||
* `smptest431-2` - SMPTEST431-2 primaries
|
||||
* `p3` - P3 primaries
|
||||
* `xyz-d50` - XYZ D50 primaries
|
||||
* `adobe-rgb` - Adobe RGB primaries
|
||||
* `apple-generic-rgb` - Apple Generic RGB primaries
|
||||
* `wide-gamut-color-spin` - Wide Gamut Color Spin primaries
|
||||
* `ebu-3213-e` - EBU 3213-E primaries
|
||||
* `custom` - Custom primaries
|
||||
* `invalid` - Invalid primaries
|
||||
|
||||
* `transfer` string - The transfer function of the color space. Can be one of the following values:
|
||||
* `bt709` - BT709 transfer function
|
||||
* `bt709-apple` - BT709 Apple transfer function
|
||||
* `gamma18` - Gamma 1.8 transfer function
|
||||
* `gamma22` - Gamma 2.2 transfer function
|
||||
* `gamma24` - Gamma 2.4 transfer function
|
||||
* `gamma28` - Gamma 2.8 transfer function
|
||||
* `smpte170m` - SMPTE170M transfer function
|
||||
* `smpte240m` - SMPTE240M transfer function
|
||||
* `linear` - Linear transfer function
|
||||
* `log` - Log transfer function
|
||||
* `log-sqrt` - Log Square Root transfer function
|
||||
* `iec61966-2-4` - IEC61966-2-4 transfer function
|
||||
* `bt1361-ecg` - BT1361 ECG transfer function
|
||||
* `srgb` - sRGB transfer function
|
||||
* `bt2020-10` - BT2020-10 transfer function
|
||||
* `bt2020-12` - BT2020-12 transfer function
|
||||
* `pq` - PQ (Perceptual Quantizer) transfer function
|
||||
* `smptest428-1` - SMPTEST428-1 transfer function
|
||||
* `hlg` - HLG (Hybrid Log-Gamma) transfer function
|
||||
* `srgb-hdr` - sRGB HDR transfer function
|
||||
* `linear-hdr` - Linear HDR transfer function
|
||||
* `custom` - Custom transfer function
|
||||
* `custom-hdr` - Custom HDR transfer function
|
||||
* `scrgb-linear-80-nits` - scRGB Linear 80 nits transfer function
|
||||
* `invalid` - Invalid transfer function
|
||||
|
||||
* `matrix` string - The color matrix of the color space. Can be one of the following values:
|
||||
* `rgb` - RGB matrix
|
||||
* `bt709` - BT709 matrix
|
||||
* `fcc` - FCC matrix
|
||||
* `bt470bg` - BT470BG matrix
|
||||
* `smpte170m` - SMPTE170M matrix
|
||||
* `smpte240m` - SMPTE240M matrix
|
||||
* `ycocg` - YCoCg matrix
|
||||
* `bt2020-ncl` - BT2020 NCL matrix
|
||||
* `ydzdx` - YDzDx matrix
|
||||
* `gbr` - GBR matrix
|
||||
* `invalid` - Invalid matrix
|
||||
|
||||
* `range` string - The color range of the color space. Can be one of the following values:
|
||||
* `limited` - Limited color range (RGB values ranging from 16 to 235)
|
||||
* `full` - Full color range (RGB values from 0 to 255)
|
||||
* `derived` - Range defined by the transfer function and matrix
|
||||
* `invalid` - Invalid range
|
||||
|
||||
## Common `ColorSpace` definitions
|
||||
|
||||
### Standard Color Spaces
|
||||
|
||||
**sRGB**:
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'srgb',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**Display P3**:
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'p3',
|
||||
transfer: 'srgb',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**XYZ D50**:
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'xyz-d50',
|
||||
transfer: 'linear',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
### HDR Color Spaces
|
||||
|
||||
**Extended sRGB** (extends sRGB to all real values):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'srgb-hdr',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**scRGB Linear** (linear transfer function for all real values):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'linear-hdr',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**scRGB Linear 80 Nits** (with an SDR white level of 80 nits):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'scrgb-linear-80-nits',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**HDR10** (BT.2020 primaries with PQ transfer function):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt2020',
|
||||
transfer: 'pq',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**HLG** (BT.2020 primaries with HLG transfer function):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt2020',
|
||||
transfer: 'hlg',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
### Video Color Spaces
|
||||
|
||||
**Rec. 601** (SDTV):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'smpte170m',
|
||||
transfer: 'smpte170m',
|
||||
matrix: 'smpte170m',
|
||||
range: 'limited'
|
||||
}
|
||||
```
|
||||
|
||||
**Rec. 709** (HDTV):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'bt709',
|
||||
matrix: 'bt709',
|
||||
range: 'limited'
|
||||
}
|
||||
```
|
||||
|
||||
**JPEG** (typical color space for JPEG images):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'srgb',
|
||||
matrix: 'smpte170m',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
@@ -2,13 +2,9 @@
|
||||
|
||||
* `textureInfo` Object - The shared texture info.
|
||||
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
|
||||
* `pixelFormat` string - The pixel format of the texture.
|
||||
* `rgba` - The texture format is 8-bit unorm RGBA.
|
||||
* `bgra` - The texture format is 8-bit unorm BGRA.
|
||||
* `rgbaf16` - The texture format is 16-bit float RGBA.
|
||||
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
|
||||
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
|
||||
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
|
||||
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.
|
||||
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In OSR case, it is expected to have the full section area.
|
||||
* `contentRect` [Rectangle](rectangle.md) - The region of the video frame that capturer would like to populate. In OSR case, it is the same with `dirtyRect` that needs to be painted.
|
||||
* `timestamp` number - The time in microseconds since the capture start.
|
||||
* `metadata` Object - Extra metadata. See comments in src\media\base\video_frame_metadata.h for accurate details.
|
||||
@@ -16,6 +12,13 @@
|
||||
* `regionCaptureRect` [Rectangle](rectangle.md) (optional) - May reflect the frame's contents origin if region capture is used internally.
|
||||
* `sourceSize` [Rectangle](rectangle.md) (optional) - Full size of the source frame.
|
||||
* `frameCount` number (optional) - The increasing count of captured frame. May contain gaps if frames are dropped between two consecutively received frames.
|
||||
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle data.
|
||||
* `sharedTextureHandle` Buffer _Windows_ _macOS_ - The handle to the shared texture.
|
||||
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
|
||||
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
|
||||
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
|
||||
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
|
||||
* `release` Function - Release the resources. The `texture` cannot be directly passed to another process, users need to maintain texture lifecycles in
|
||||
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important that you call `texture.release()` as soon as you're done with the texture.
|
||||
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important
|
||||
that you call `texture.release()` as soon as you're done with the texture.
|
||||
|
||||
@@ -8,7 +8,6 @@
|
||||
* `oom` - Process ran out of memory
|
||||
* `launch-failed` - Process never successfully launched
|
||||
* `integrity-failure` - Windows code integrity checks failed
|
||||
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
|
||||
* `exitCode` Integer - The exit code of the process, unless `reason` is
|
||||
`launch-failed`, in which case `exitCode` will be a platform-specific
|
||||
launch failure error code.
|
||||
|
||||
@@ -1,12 +0,0 @@
|
||||
# SharedTextureHandle Object
|
||||
|
||||
* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process.
|
||||
* `ioSurface` Buffer (optional) _macOS_ - IOSurfaceRef holds the shared texture. Note that this IOSurface is local to current process (not global).
|
||||
* `nativePixmap` Object (optional) _Linux_ - Structure contains planes of shared texture.
|
||||
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
|
||||
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
|
||||
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
|
||||
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
|
||||
* `supportsZeroCopyWebGpuImport` boolean _Linux_ - Indicates whether supports zero copy import to WebGPU.
|
||||
@@ -1,35 +1,17 @@
|
||||
# USBDevice Object
|
||||
|
||||
* `configuration` Object (optional) - A [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) object containing information about the currently selected configuration of a USB device.
|
||||
* `configurationValue` Integer - the configuration value of this configuration.
|
||||
* `configurationName` string - the name provided by the device to describe this configuration.
|
||||
* `interfaces` Object[] - An array of [USBInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBInterface) objects containing information about an interface provided by the USB device.
|
||||
* `interfaceNumber` Integer - the interface number of this interface.
|
||||
* `alternate` Object - the currently selected alternative configuration of this interface.
|
||||
* `alternateSetting` Integer - the alternate setting number of this interface.
|
||||
* `interfaceClass` Integer - the class of this interface. See [USB.org](https://www.usb.org/defined-class-codes) for class code descriptions.
|
||||
* `interfaceSubclass` Integer - the subclass of this interface.
|
||||
* `interfaceProtocol` Integer - the protocol supported by this interface.
|
||||
* `interfaceName` string (optional) - the name of the interface, if one is provided by the device.
|
||||
* `endpoints` Object[] - an array containing instances of the [USBEndpoint interface](https://developer.mozilla.org/en-US/docs/Web/API/USBEndpoint) describing each of the endpoints that are part of this interface.
|
||||
* `endpointNumber` Integer - this endpoint's "endpoint number" which is a value from 1 to 15.
|
||||
* `direction` string - the direction in which this endpoint transfers data - can be either 'in' or 'out'.
|
||||
* `type` string - the type of this endpoint - can be either 'bulk', 'interrupt', or 'isochronous'.
|
||||
* `packetSize` Integer - the size of the packets that data sent through this endpoint will be divided into.
|
||||
* `alternates` Object[] - an array containing instances of the [USBAlternateInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBAlternateInterface) interface describing each of the alternative configurations possible for this interface.
|
||||
* `configurations` Object[] - An array of [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) interfaces for controlling a paired USB device.
|
||||
* `deviceClass` Integer - The device class for the communication interface supported by the device.
|
||||
* `deviceId` string - Unique identifier for the device.
|
||||
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device.
|
||||
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device.
|
||||
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
|
||||
* `manufacturerName` string (optional) - The manufacturer name of the device.
|
||||
* `vendorId` Integer - The USB vendor ID.
|
||||
* `productId` Integer - The USB product ID.
|
||||
* `productName` string (optional) - Name of the device.
|
||||
* `serialNumber` string (optional) - The USB device serial number.
|
||||
* `usbVersionMajor` Integer - The USB protocol major version supported by the device.
|
||||
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device.
|
||||
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device.
|
||||
* `vendorId` Integer - The USB vendor ID.
|
||||
* `manufacturerName` string (optional) - The manufacturer name of the device.
|
||||
* `usbVersionMajor` Integer - The USB protocol major version supported by the device
|
||||
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device
|
||||
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device
|
||||
* `deviceClass` Integer - The device class for the communication interface supported by the device
|
||||
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device
|
||||
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device
|
||||
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
|
||||
|
||||
@@ -21,9 +21,7 @@
|
||||
associated with the window, making it compatible with the Chromium
|
||||
OS-level sandbox and disabling the Node.js engine. This is not the same as
|
||||
the `nodeIntegration` option and the APIs available to the preload script
|
||||
are more limited. Default is `true` since Electron 20. The sandbox will
|
||||
automatically be disabled when `nodeIntegration` is set to `true`.
|
||||
Read more about the option [here](../../tutorial/sandbox.md).
|
||||
are more limited. Read more about the option [here](../../tutorial/sandbox.md).
|
||||
* `session` [Session](../session.md#class-session) (optional) - Sets the session used by the
|
||||
page. Instead of passing the Session object directly, you can also choose to
|
||||
use the `partition` option instead, which accepts a partition string. When
|
||||
@@ -89,11 +87,6 @@
|
||||
paint event. Defaults to `false`. See the
|
||||
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
|
||||
more details.
|
||||
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
|
||||
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
|
||||
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
|
||||
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
|
||||
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
|
||||
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
|
||||
the specified `preload` script in a separate JavaScript context. Defaults
|
||||
to `true`. The context that the `preload` script runs in will only have
|
||||
|
||||
@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
|
||||
|
||||
The `systemPreferences` object emits the following events:
|
||||
|
||||
### Event: 'accent-color-changed' _Windows_ _Linux_
|
||||
### Event: 'accent-color-changed' _Windows_
|
||||
|
||||
Returns:
|
||||
|
||||
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
|
||||
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
|
||||
or global value of a `key` previously set with `setUserDefault`.
|
||||
|
||||
### `systemPreferences.getAccentColor()`
|
||||
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
|
||||
|
||||
Returns `string` - The users current system wide accent color preference in RGBA
|
||||
hexadecimal form.
|
||||
|
||||
@@ -4,12 +4,6 @@
|
||||
|
||||
Process: [Renderer](../glossary.md#renderer-process)
|
||||
|
||||
> [!IMPORTANT]
|
||||
> If you want to call this API from a renderer process with context isolation enabled,
|
||||
> place the API call in your preload script and
|
||||
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
|
||||
> [`contextBridge`](context-bridge.md) API.
|
||||
|
||||
`webFrame` export of the Electron module is an instance of the `WebFrame`
|
||||
class representing the current frame. Sub-frames can be retrieved by
|
||||
certain properties and methods (e.g. `webFrame.firstChild`).
|
||||
@@ -145,7 +139,7 @@ by its key, which is returned from `webFrame.insertCSS(css)`.
|
||||
|
||||
Inserts `text` to the focused element.
|
||||
|
||||
### `webFrame.executeJavaScript(code[, userGesture][, callback])`
|
||||
### `webFrame.executeJavaScript(code[, userGesture, callback])`
|
||||
|
||||
* `code` string
|
||||
* `userGesture` boolean (optional) - Default is `false`.
|
||||
@@ -166,7 +160,7 @@ In the browser window some HTML APIs like `requestFullScreen` can only be
|
||||
invoked by a gesture from the user. Setting `userGesture` to `true` will remove
|
||||
this limitation.
|
||||
|
||||
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture][, callback])`
|
||||
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture, callback])`
|
||||
|
||||
* `worldId` Integer - The ID of the world to run the javascript
|
||||
in, `0` is the default main world (where content runs), `999` is the
|
||||
|
||||
@@ -4,12 +4,6 @@
|
||||
|
||||
Process: [Renderer](../glossary.md#renderer-process)
|
||||
|
||||
> [!IMPORTANT]
|
||||
> If you want to call this API from a renderer process with context isolation enabled,
|
||||
> place the API call in your preload script and
|
||||
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
|
||||
> [`contextBridge`](context-bridge.md) API.
|
||||
|
||||
## Methods
|
||||
|
||||
The `webUtils` module has the following methods:
|
||||
@@ -23,27 +17,11 @@ Returns `string` - The file system path that this `File` object points to. In th
|
||||
This method superseded the previous augmentation to the `File` object with the `path` property. An example is included below.
|
||||
|
||||
```js @ts-nocheck
|
||||
// Before (renderer)
|
||||
const oldPath = document.querySelector('input[type=file]').files[0].path
|
||||
```
|
||||
// Before
|
||||
const oldPath = document.querySelector('input').files[0].path
|
||||
|
||||
```js @ts-nocheck
|
||||
// After
|
||||
const { webUtils } = require('electron')
|
||||
|
||||
// Renderer:
|
||||
|
||||
const file = document.querySelector('input[type=file]').files[0]
|
||||
electronApi.doSomethingWithFile(file)
|
||||
|
||||
// Preload script:
|
||||
|
||||
const { contextBridge, webUtils } = require('electron')
|
||||
|
||||
contextBridge.exposeInMainWorld('electronApi', {
|
||||
doSomethingWithFile (file) {
|
||||
const path = webUtils.getPathForFile(file)
|
||||
// Do something with the path, e.g., send it over IPC to the main process.
|
||||
// It's best not to expose the full file path to the web content if possible.
|
||||
}
|
||||
})
|
||||
const newPath = webUtils.getPathForFile(document.querySelector('input').files[0])
|
||||
```
|
||||
|
||||
@@ -39,8 +39,8 @@ consider using `webContents.setWindowOpenHandler` to customize the
|
||||
BrowserWindow creation.
|
||||
|
||||
A subset of [`WebPreferences`](structures/web-preferences.md) can be set directly,
|
||||
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `javascript`,
|
||||
`contextIsolation`, and `webviewTag`.
|
||||
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `preload`,
|
||||
`javascript`, `contextIsolation`, and `webviewTag`.
|
||||
|
||||
For example:
|
||||
|
||||
|
||||
@@ -12,50 +12,13 @@ This document uses the following convention to categorize breaking changes:
|
||||
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
|
||||
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
|
||||
|
||||
## Planned Breaking API Changes (39.0)
|
||||
|
||||
### Deprecated: `--host-rules` command line switch
|
||||
|
||||
Chromium is deprecating the `--host-rules` switch.
|
||||
|
||||
You should use `--host-resolver-rules` instead.
|
||||
|
||||
### Behavior Changed: window.open popups are always resizable
|
||||
|
||||
Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
|
||||
|
||||
To restore previous behavior:
|
||||
|
||||
```js
|
||||
webContents.setWindowOpenHandler((details) => {
|
||||
return {
|
||||
action: 'allow',
|
||||
overrideBrowserWindowOptions: {
|
||||
resizable: details.features.includes('resizable=yes')
|
||||
}
|
||||
}
|
||||
})
|
||||
```
|
||||
|
||||
### Behavior Changed: shared texture OSR `paint` event data structure
|
||||
|
||||
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
|
||||
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
|
||||
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
|
||||
|
||||
## Planned Breaking API Changes (38.0)
|
||||
|
||||
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
|
||||
|
||||
The default value of the `--ozone-platform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
|
||||
The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
|
||||
|
||||
Electron now defaults to running as a native Wayland app when launched in a Wayland session (when `XDG_SESSION_TYPE=wayland`).
|
||||
Users can force XWayland by passing `--ozone-platform=x11`.
|
||||
|
||||
### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
|
||||
|
||||
Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
|
||||
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overriden and now reflects the actual desktop environment.
|
||||
You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
|
||||
|
||||
### Removed: macOS 11 support
|
||||
|
||||
|
||||
25
docs/faq.md
25
docs/faq.md
@@ -12,28 +12,19 @@ network problems. The best resolution is to try switching networks, or
|
||||
wait a bit and try installing again.
|
||||
|
||||
You can also attempt to download Electron directly from
|
||||
[GitHub Releases](https://github.com/electron/electron/releases)
|
||||
[electron/electron/releases](https://github.com/electron/electron/releases)
|
||||
if installing via `npm` is failing.
|
||||
|
||||
If you need to install Electron through a custom mirror or proxy, see
|
||||
the [Advanced Installation](./tutorial/installation.md) documentation for more details.
|
||||
## When will Electron upgrade to latest Chrome?
|
||||
|
||||
## How are Electron binaries downloaded?
|
||||
The Chrome version of Electron is usually bumped within one or two weeks after
|
||||
a new stable Chrome version gets released. This estimate is not guaranteed and
|
||||
depends on the amount of work involved with upgrading.
|
||||
|
||||
When you run `npm install electron`, the Electron binary for the corresponding version is downloaded
|
||||
into your project's `node_modules` folder via npm's `postinstall` lifecycle script.
|
||||
Only the stable channel of Chrome is used. If an important fix is in beta or dev
|
||||
channel, we will back-port it.
|
||||
|
||||
This logic is handled by the [`@electron/get`](https://github.com/electron/get) utility package
|
||||
under the hood.
|
||||
|
||||
## When will Electron upgrade to latest Chromium?
|
||||
|
||||
Every new major version of Electron releases with a Chromium major version upgrade. By releasing every
|
||||
8 weeks, Electron is able to pull in every other major Chromium release on the very same day that it
|
||||
releases upstream. Security fixes will be backported to stable release channels ahead of time.
|
||||
|
||||
See the [Electron Releases](./tutorial/electron-timelines.md) documentation for more details or
|
||||
[releases.electronjs.org](https://releases.electronjs.org) to see our Release Status dashboard.
|
||||
For more information, please see the [security introduction](tutorial/security.md).
|
||||
|
||||
## When will Electron upgrade to latest Node.js?
|
||||
|
||||
|
||||
@@ -12,15 +12,6 @@ The ASAR format was created primarily to improve performance on Windows when
|
||||
reading large quantities of small files (e.g. when loading your app's JavaScript
|
||||
dependency tree from `node_modules`).
|
||||
|
||||
### ASAR integrity
|
||||
|
||||
ASAR integrity is an security feature that validates the contents of your app's
|
||||
ASAR archives at runtime. When enabled, your Electron app will verify the
|
||||
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
|
||||
hashes, the app will forcefully terminate.
|
||||
|
||||
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
|
||||
|
||||
### code signing
|
||||
|
||||
Code signing is a process where an app developer digitally signs their code to
|
||||
|
||||
@@ -5,7 +5,7 @@ slug: asar-integrity
|
||||
hide_title: false
|
||||
---
|
||||
|
||||
ASAR integrity is a security feature that validates the contents of your app's
|
||||
ASAR integrity is an experimental feature that validates the contents of your app's
|
||||
[ASAR archives](./asar-archives.md) at runtime.
|
||||
|
||||
## Version support
|
||||
@@ -64,10 +64,13 @@ flipFuses(
|
||||
)
|
||||
```
|
||||
|
||||
> [!TIP]
|
||||
> With Electron Forge, you can configure your app's fuses with
|
||||
> [@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
|
||||
> in your Forge configuration file.
|
||||
:::tip Fuses in Electron Forge
|
||||
|
||||
With Electron Forge, you can configure your app's fuses with
|
||||
[@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
|
||||
in your Forge configuration file.
|
||||
|
||||
:::
|
||||
|
||||
## Providing the header hash
|
||||
|
||||
@@ -77,7 +80,7 @@ on package time. The process of providing this packaged hash is different for ma
|
||||
### Using Electron tooling
|
||||
|
||||
Electron Forge and Electron Packager do this setup automatically for you with no additional
|
||||
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
|
||||
configuration. The minimum required versions for ASAR integrity are:
|
||||
|
||||
* `@electron/packager@18.3.1`
|
||||
* `@electron/forge@7.4.0`
|
||||
@@ -106,7 +109,7 @@ Valid `algorithm` values are currently `SHA256` only. The `hash` is a hash of th
|
||||
The `@electron/asar` package exposes a `getRawHeader` method whose result can then be hashed to generate this value
|
||||
(e.g. using the [`node:crypto`](https://nodejs.org/api/crypto.html) module).
|
||||
|
||||
#### Windows
|
||||
### Windows
|
||||
|
||||
When packaging for Windows, you must populate a valid [resource](https://learn.microsoft.com/en-us/windows/win32/menurc/resources)
|
||||
entry of type `Integrity` and name `ElectronAsar`. The value of this resource should be a JSON encoded dictionary
|
||||
@@ -122,6 +125,9 @@ in the form included below:
|
||||
]
|
||||
```
|
||||
|
||||
> [!NOTE]
|
||||
> For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
|
||||
> in the Electron Packager code.
|
||||
:::info
|
||||
|
||||
For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
|
||||
in the Electron Packager code.
|
||||
|
||||
:::
|
||||
|
||||
@@ -74,22 +74,46 @@ describe('keyboard input', () => {
|
||||
Furthermore, WebdriverIO allows you to access Electron APIs to get static information about your application:
|
||||
|
||||
```js @ts-nocheck
|
||||
import { browser } from '@wdio/globals'
|
||||
import { browser, $, expect } from '@wdio/globals'
|
||||
|
||||
describe('trigger message modal', async () => {
|
||||
it('message modal can be triggered from a test', async () => {
|
||||
await browser.electron.execute(
|
||||
(electron, param1, param2, param3) => {
|
||||
const appWindow = electron.BrowserWindow.getFocusedWindow()
|
||||
electron.dialog.showMessageBox(appWindow, {
|
||||
message: 'Hello World!',
|
||||
detail: `${param1} + ${param2} + ${param3} = ${param1 + param2 + param3}`
|
||||
})
|
||||
},
|
||||
1,
|
||||
2,
|
||||
3
|
||||
)
|
||||
describe('when the make smaller button is clicked', () => {
|
||||
it('should decrease the window height and width by 10 pixels', async () => {
|
||||
const boundsBefore = await browser.electron.browserWindow('getBounds')
|
||||
expect(boundsBefore.width).toEqual(210)
|
||||
expect(boundsBefore.height).toEqual(310)
|
||||
|
||||
await $('.make-smaller').click()
|
||||
const boundsAfter = await browser.electron.browserWindow('getBounds')
|
||||
expect(boundsAfter.width).toEqual(200)
|
||||
expect(boundsAfter.height).toEqual(300)
|
||||
})
|
||||
})
|
||||
```
|
||||
|
||||
or to retrieve other Electron process information:
|
||||
|
||||
```js @ts-nocheck
|
||||
import fs from 'node:fs'
|
||||
import path from 'node:path'
|
||||
|
||||
import { browser, expect } from '@wdio/globals'
|
||||
|
||||
const packageJson = JSON.parse(fs.readFileSync(path.join(__dirname, '..', 'package.json'), { encoding: 'utf-8' }))
|
||||
const { name, version } = packageJson
|
||||
|
||||
describe('electron APIs', () => {
|
||||
it('should retrieve app metadata through the electron API', async () => {
|
||||
const appName = await browser.electron.app('getName')
|
||||
expect(appName).toEqual(name)
|
||||
const appVersion = await browser.electron.app('getVersion')
|
||||
expect(appVersion).toEqual(version)
|
||||
})
|
||||
|
||||
it('should pass args through to the launched application', async () => {
|
||||
// custom args are set in the wdio.conf.js file as they need to be set before WDIO starts
|
||||
const argv = await browser.electron.mainProcess('argv')
|
||||
expect(argv).toContain('--foo')
|
||||
expect(argv).toContain('--bar=baz')
|
||||
})
|
||||
})
|
||||
```
|
||||
@@ -182,7 +206,7 @@ npm install --save-dev @playwright/test
|
||||
```
|
||||
|
||||
:::caution Dependencies
|
||||
This tutorial was written with `@playwright/test@1.52.0`. Check out
|
||||
This tutorial was written with `@playwright/test@1.41.1`. Check out
|
||||
[Playwright's releases][playwright-releases] page to learn about
|
||||
changes that might affect the code below.
|
||||
:::
|
||||
@@ -194,10 +218,10 @@ To point this API to your Electron app, you can pass the path to your main proce
|
||||
entry point (here, it is `main.js`).
|
||||
|
||||
```js {5} @ts-nocheck
|
||||
import { test, _electron as electron } from '@playwright/test'
|
||||
const { test, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('launch app', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
const electronApp = await electron.launch({ args: ['main.js'] })
|
||||
// close app
|
||||
await electronApp.close()
|
||||
})
|
||||
@@ -207,10 +231,10 @@ After that, you will access to an instance of Playwright's `ElectronApp` class.
|
||||
is a powerful class that has access to main process modules for example:
|
||||
|
||||
```js {5-10} @ts-nocheck
|
||||
import { test, _electron as electron } from '@playwright/test'
|
||||
const { test, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('get isPackaged', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
const electronApp = await electron.launch({ args: ['main.js'] })
|
||||
const isPackaged = await electronApp.evaluate(async ({ app }) => {
|
||||
// This runs in Electron's main process, parameter here is always
|
||||
// the result of the require('electron') in the main app script.
|
||||
@@ -226,10 +250,10 @@ It can also create individual [Page][playwright-page] objects from Electron Brow
|
||||
For example, to grab the first BrowserWindow and save a screenshot:
|
||||
|
||||
```js {6-7} @ts-nocheck
|
||||
import { test, _electron as electron } from '@playwright/test'
|
||||
const { test, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('save screenshot', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
const electronApp = await electron.launch({ args: ['main.js'] })
|
||||
const window = await electronApp.firstWindow()
|
||||
await window.screenshot({ path: 'intro.png' })
|
||||
// close app
|
||||
@@ -241,7 +265,7 @@ Putting all this together using the Playwright test-runner, let's create a `exam
|
||||
test file with a single test and assertion:
|
||||
|
||||
```js title='example.spec.js' @ts-nocheck
|
||||
import { test, expect, _electron as electron } from '@playwright/test'
|
||||
const { test, expect, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('example test', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
|
||||
@@ -233,10 +233,10 @@ can find [its documentation here](https://www.electron.build/code-signing).
|
||||
[Azure Trusted Signing][] is Microsoft's modern cloud-based alternative to EV certificates.
|
||||
It is the cheapest option for code signing on Windows, and it gets rid of SmartScreen warnings.
|
||||
|
||||
As of October 2025, Azure Trusted Signing is available to US and Canada-based organizations
|
||||
with 3+ years of verifiable business history and to individual developers in the US and Canada.
|
||||
Microsoft is looking to make the program more widely available. If you're reading this at a
|
||||
later point, it could make sense to check if the eligibility criteria have changed.
|
||||
As of May 2025, Azure Trusted Signing is [available][trusted-signing-availability] to US and
|
||||
Canada-based organizations with 3+ years of verifiable business history. Microsoft is looking
|
||||
to make the program more widely available. If you're reading this at a later point, it could
|
||||
make sense to check if the eligibility criteria have changed.
|
||||
|
||||
#### Using Electron Forge
|
||||
|
||||
@@ -267,5 +267,6 @@ See the [Windows Store Guide][].
|
||||
[maker-squirrel]: https://www.electronforge.io/config/makers/squirrel.windows
|
||||
[maker-msi]: https://www.electronforge.io/config/makers/wix-msi
|
||||
[azure trusted signing]: https://azure.microsoft.com/en-us/products/trusted-signing
|
||||
[trusted-signing-availability]: https://techcommunity.microsoft.com/blog/microsoft-security-blog/trusted-signing-public-preview-update/4399713
|
||||
[forge-trusted-signing]: https://www.electronforge.io/guides/code-signing/code-signing-windows#using-azure-trusted-signing
|
||||
[builder-trusted-signing]: https://www.electron.build/code-signing-win#using-azure-trusted-signing-beta
|
||||
|
||||
@@ -9,11 +9,10 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
|
||||
|
||||
| Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
|
||||
| ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
|
||||
| 40.0.0 | 2025-Oct-30 | 2025-Dec-03 | 2025-Oct-28 | 2026-Jun-30 | M144 | TBD | ✅ |
|
||||
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
|
||||
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | TBD | ✅ |
|
||||
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
|
||||
| 37.0.0 | 2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
|
||||
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
|
||||
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | ✅ |
|
||||
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
|
||||
| 34.0.0 | 2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
|
||||
| 33.0.0 | 2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
|
||||
@@ -122,3 +121,22 @@ and that number is reduced to two in major version 10, the three-argument versio
|
||||
continue to work until, at minimum, major version 12. Past the minimum two-version
|
||||
threshold, we will attempt to support backwards compatibility beyond two versions
|
||||
until the maintainers feel the maintenance burden is too high to continue doing so.
|
||||
|
||||
### End-of-life
|
||||
|
||||
When a release branch reaches the end of its support cycle, the series
|
||||
will be deprecated in NPM and a final end-of-support release will be
|
||||
made. This release will add a warning to inform that an unsupported
|
||||
version of Electron is in use.
|
||||
|
||||
These steps are to help app developers learn when a branch they're
|
||||
using becomes unsupported, but without being excessively intrusive
|
||||
to end users.
|
||||
|
||||
If an application has exceptional circumstances and needs to stay
|
||||
on an unsupported series of Electron, developers can silence the
|
||||
end-of-support warning by omitting the final release from the app's
|
||||
`package.json` `devDependencies`. For example, since the 1-6-x series
|
||||
ended with an end-of-support 1.6.18 release, developers could choose
|
||||
to stay in the 1-6-x series without warnings with `devDependency` of
|
||||
`"electron": 1.6.0 - 1.6.17`.
|
||||
|
||||
@@ -32,7 +32,7 @@ This table gives a general overview of where ESM is supported and which ESM load
|
||||
| Main | Node.js | N/A | <ul><li> [You must use `await` generously before the app's `ready` event](#you-must-use-await-generously-before-the-apps-ready-event) </li></ul> |
|
||||
| Renderer (Sandboxed) | Chromium | Unsupported | <ul><li> [Sandboxed preload scripts can't use ESM imports](#sandboxed-preload-scripts-cant-use-esm-imports) </li></ul> |
|
||||
| Renderer (Unsandboxed & Context Isolated) | Chromium | Node.js | <ul><li> [Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content) </li> <li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
|
||||
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
|
||||
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li><li>[ESM preload scripts must be context isolated to use dynamic Node.js ESM imports](#esm-preload-scripts-must-be-context-isolated-to-use-dynamic-nodejs-esm-imports)</li></ul> |
|
||||
|
||||
## Main process
|
||||
|
||||
|
||||
@@ -4,24 +4,11 @@
|
||||
|
||||
## What are fuses?
|
||||
|
||||
From a security perspective, it makes sense to disable certain unused Electron features
|
||||
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
|
||||
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
|
||||
subset of "living off the land" attacks.
|
||||
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
|
||||
|
||||
We also don't want Electron consumers forking to achieve this goal, as building from source and
|
||||
maintaining a fork is a massive technical challenge and costs a lot of time and money.
|
||||
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
|
||||
|
||||
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
|
||||
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
|
||||
|
||||
Because they are flipped at package time before you code sign your app, the OS becomes responsible
|
||||
for ensuring those bits aren't flipped back via OS-level code signing validation
|
||||
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
|
||||
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
|
||||
on Windows).
|
||||
|
||||
## Current fuses
|
||||
## Current Fuses
|
||||
|
||||
### `runAsNode`
|
||||
|
||||
@@ -29,11 +16,7 @@ on Windows).
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.RunAsNode`
|
||||
|
||||
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
|
||||
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
|
||||
as expected, as it depends on this environment variable to function. Instead, we recommend that you
|
||||
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
|
||||
standalone Node.js process (e.g. a SQLite server process).
|
||||
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
|
||||
|
||||
### `cookieEncryption`
|
||||
|
||||
@@ -41,12 +24,7 @@ standalone Node.js process (e.g. a SQLite server process).
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
|
||||
|
||||
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
|
||||
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
|
||||
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
|
||||
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
|
||||
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
|
||||
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
|
||||
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
|
||||
|
||||
### `nodeOptions`
|
||||
|
||||
@@ -54,11 +32,7 @@ later will make your cookie store corrupt and useless. Most apps can safely enab
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
|
||||
|
||||
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
|
||||
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
|
||||
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
|
||||
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
|
||||
Most apps can safely disable this fuse.
|
||||
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
|
||||
|
||||
### `nodeCliInspect`
|
||||
|
||||
@@ -66,9 +40,7 @@ Most apps can safely disable this fuse.
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
|
||||
|
||||
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
|
||||
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
|
||||
inspector. Most apps can safely disable this fuse.
|
||||
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
|
||||
|
||||
### `embeddedAsarIntegrityValidation`
|
||||
|
||||
@@ -76,12 +48,9 @@ inspector. Most apps can safely disable this fuse.
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
|
||||
|
||||
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
|
||||
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
|
||||
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
|
||||
Most apps can safely enable this fuse.
|
||||
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
|
||||
|
||||
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
|
||||
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
|
||||
|
||||
### `onlyLoadAppFromAsar`
|
||||
|
||||
@@ -89,15 +58,7 @@ For more information on how to use ASAR integrity validation, please read the [A
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
|
||||
|
||||
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
|
||||
By default, Electron will search for this code in the following order:
|
||||
|
||||
1. `app.asar`
|
||||
1. `app`
|
||||
1. `default_app.asar`
|
||||
|
||||
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
|
||||
it is impossible to load non-validated code.
|
||||
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
|
||||
|
||||
### `loadBrowserProcessSpecificV8Snapshot`
|
||||
|
||||
@@ -105,17 +66,11 @@ it is impossible to load non-validated code.
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
|
||||
|
||||
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
|
||||
initialized heaps and then load them back in to avoid the cost of initializing the heap.
|
||||
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
|
||||
|
||||
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
|
||||
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
|
||||
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
|
||||
Other processes will use the V8 snapshot file that they normally do.
|
||||
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
|
||||
|
||||
Using separate snapshots for renderer processes and the main process can improve security, especially
|
||||
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
|
||||
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
|
||||
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
|
||||
|
||||
### `grantFileProtocolExtraPrivileges`
|
||||
|
||||
@@ -123,25 +78,19 @@ See [electron/electron#35170](https://github.com/electron/electron/issues/35170)
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
|
||||
|
||||
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
|
||||
are given privileges beyond what they would receive in a traditional web browser. This behavior was
|
||||
core to Electron apps in original versions of Electron, but is no longer required as apps should be
|
||||
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
|
||||
|
||||
If you aren't serving pages from `file://`, you should disable this fuse.
|
||||
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
|
||||
|
||||
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
|
||||
|
||||
* `file://` protocol pages can use `fetch` to load other assets over `file://`
|
||||
* `file://` protocol pages can use service workers
|
||||
* `file://` protocol pages have universal access granted to child frames also running on `file://`
|
||||
protocols regardless of sandbox settings
|
||||
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
|
||||
|
||||
## How do I flip fuses?
|
||||
## How do I flip the fuses?
|
||||
|
||||
### The easy way
|
||||
|
||||
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
|
||||
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
|
||||
|
||||
```js @ts-nocheck
|
||||
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
|
||||
@@ -157,37 +106,29 @@ flipFuses(
|
||||
)
|
||||
```
|
||||
|
||||
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
|
||||
app using the `@electron/fuses` CLI.
|
||||
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
|
||||
|
||||
```bash
|
||||
npx @electron/fuses read --app /Applications/Foo.app
|
||||
```
|
||||
|
||||
>[!NOTE]
|
||||
> If you are using Electron Forge to distribute your application, you can flip fuses using
|
||||
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
|
||||
> which comes pre-installed with all templates.
|
||||
|
||||
### The hard way
|
||||
|
||||
> [!IMPORTANT]
|
||||
> Glossary:
|
||||
>
|
||||
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
|
||||
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
|
||||
> * **Fuse Schema**: The format/allowed values for the fuse wire
|
||||
#### Quick Glossary
|
||||
|
||||
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
|
||||
sequence of bytes that represent the state of the fuses you want.
|
||||
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
|
||||
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
|
||||
* **Fuse Schema**: The format / allowed values for the fuse wire
|
||||
|
||||
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
|
||||
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
|
||||
|
||||
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
|
||||
|
||||
```text
|
||||
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
|
||||
```
|
||||
|
||||
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
|
||||
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
|
||||
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
|
||||
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
|
||||
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
|
||||
@@ -195,6 +136,6 @@ Somewhere in the Electron binary, there will be a sequence of bytes that look li
|
||||
* "1" (0x31) indicates the fuse is enabled
|
||||
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
|
||||
|
||||
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
|
||||
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
|
||||
|
||||
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).
|
||||
|
||||
@@ -26,12 +26,12 @@ any dependencies in your app will not be installed.
|
||||
|
||||
## Customization
|
||||
|
||||
If you want to change the architecture that is downloaded (e.g., `x64` on an
|
||||
`arm64` machine), you can use the `--arch` flag with npm install or set the
|
||||
If you want to change the architecture that is downloaded (e.g., `ia32` on an
|
||||
`x64` machine), you can use the `--arch` flag with npm install or set the
|
||||
`npm_config_arch` environment variable:
|
||||
|
||||
```shell
|
||||
npm install --arch=x64 electron
|
||||
npm install --arch=ia32 electron
|
||||
```
|
||||
|
||||
In addition to changing the architecture, you can also specify the platform
|
||||
@@ -60,7 +60,7 @@ where `$VERSION` is the exact version of Electron).
|
||||
If you are unable to access GitHub or you need to provide a custom build, you
|
||||
can do so by either providing a mirror or an existing cache directory.
|
||||
|
||||
### Mirror
|
||||
#### Mirror
|
||||
|
||||
You can use environment variables to override the base URL, the path at which to
|
||||
look for Electron binaries, and the binary filename. The URL used by `@electron/get`
|
||||
@@ -95,7 +95,7 @@ Electron release you may have to set `electron_use_remote_checksums=1` directly,
|
||||
or configure it in a `.npmrc` file, to force Electron to use the remote `SHASUMS256.txt`
|
||||
file to verify the checksum instead of the embedded checksums.
|
||||
|
||||
### Cache
|
||||
#### Cache
|
||||
|
||||
Alternatively, you can override the local cache. `@electron/get` will cache
|
||||
downloaded binaries in a local directory to not stress your network. You can use
|
||||
@@ -120,7 +120,7 @@ The cache contains the version's official zip file as well as a checksum, and is
|
||||
│ └── electron-v15.3.1-darwin-x64.zip
|
||||
```
|
||||
|
||||
## Postinstall script
|
||||
## Skip binary download
|
||||
|
||||
Under the hood, Electron's JavaScript API binds to a binary that contains its
|
||||
implementations. Because this binary is crucial to the function of any Electron app,
|
||||
|
||||
@@ -2,15 +2,15 @@
|
||||
|
||||
## Overview
|
||||
|
||||
Online and offline event detection can be implemented in both the main and renderer processes:
|
||||
|
||||
- **Renderer process**: Use the [`navigator.onLine`](http://html5index.org/Offline%20-%20NavigatorOnLine.html) attribute and [online/offline events](https://developer.mozilla.org/en-US/docs/Online_and_offline_events), part of standard HTML5 API.
|
||||
- **Main process**: Use the [`net.isOnline()`](../api/net.md#netisonline) method or the [`net.online`](../api/net.md#netonline-readonly) property.
|
||||
[Online and offline event](https://developer.mozilla.org/en-US/docs/Online_and_offline_events)
|
||||
detection can be implemented in the Renderer process using the
|
||||
[`navigator.onLine`](http://html5index.org/Offline%20-%20NavigatorOnLine.html)
|
||||
attribute, part of standard HTML5 API.
|
||||
|
||||
The `navigator.onLine` attribute returns:
|
||||
|
||||
- `false` if all network requests are guaranteed to fail (e.g. when disconnected from the network).
|
||||
- `true` in all other cases.
|
||||
* `false` if all network requests are guaranteed to fail (e.g. when disconnected from the network).
|
||||
* `true` in all other cases.
|
||||
|
||||
Since many cases return `true`, you should treat with care situations of
|
||||
getting false positives, as we cannot always assume that `true` value means
|
||||
@@ -19,27 +19,7 @@ is running a virtualization software that has virtual Ethernet adapters in "alwa
|
||||
connected" state. Therefore, if you want to determine the Internet access
|
||||
status of Electron, you should develop additional means for this check.
|
||||
|
||||
## Main Process Detection
|
||||
|
||||
In the main process, you can use the `net` module to detect online/offline status:
|
||||
|
||||
```js
|
||||
const { net } = require('electron')
|
||||
|
||||
// Method 1: Using net.isOnline()
|
||||
const isOnline = net.isOnline()
|
||||
console.log('Online status:', isOnline)
|
||||
|
||||
// Method 2: Using net.online property
|
||||
console.log('Online status:', net.online)
|
||||
```
|
||||
|
||||
Both `net.isOnline()` and `net.online` return the same boolean value with the same reliability characteristics as `navigator.onLine` - they provide a strong indicator when offline (`false`), but a `true` value doesn't guarantee successful internet connectivity.
|
||||
|
||||
> [!NOTE]
|
||||
> The `net` module is only available after the app emits the `ready` event.
|
||||
|
||||
## Renderer Process Example
|
||||
## Example
|
||||
|
||||
Starting with an HTML file `index.html`, this example will demonstrate how the `navigator.onLine` API can be used to build a connection status indicator.
|
||||
|
||||
@@ -104,4 +84,4 @@ After launching the Electron application, you should see the notification:
|
||||

|
||||
|
||||
> [!NOTE]
|
||||
> If you need to check the connection status in the main process, you can use [`net.isOnline()`](../api/net.md#netisonline) directly instead of communicating from the renderer process via [IPC](../api/ipc-renderer.md).
|
||||
> If you need to communicate the connection status to the main process, use the [IPC renderer](../api/ipc-renderer.md) API.
|
||||
|
||||
@@ -13,13 +13,7 @@ the GPU service and the network service.
|
||||
See Chromium's [Sandbox design document][sandbox] for more information.
|
||||
|
||||
Starting from Electron 20, the sandbox is enabled for renderer processes without any
|
||||
further configuration.
|
||||
|
||||
Sandboxing is tied to Node.js integration. _Enabling Node.js integration_ for a
|
||||
renderer process by setting `nodeIntegration: true` _disables the sandbox_ for the
|
||||
process.
|
||||
|
||||
If you want to disable the sandbox for a process, see the
|
||||
further configuration. If you want to disable the sandbox for a process, see the
|
||||
[Disabling the sandbox for a single process](#disabling-the-sandbox-for-a-single-process)
|
||||
section.
|
||||
|
||||
@@ -104,8 +98,7 @@ app.whenReady().then(() => {
|
||||
```
|
||||
|
||||
Sandboxing is also disabled whenever Node.js integration is enabled in the renderer.
|
||||
This can be done through the BrowserWindow constructor with the `nodeIntegration: true` flag
|
||||
or by providing the respective HTML boolean attribute for a `webview`.
|
||||
This can be done through the BrowserWindow constructor with the `nodeIntegration: true` flag.
|
||||
|
||||
```js title='main.js'
|
||||
app.whenReady().then(() => {
|
||||
@@ -118,10 +111,6 @@ app.whenReady().then(() => {
|
||||
})
|
||||
```
|
||||
|
||||
```html title='index.html (Renderer Process)'
|
||||
<webview nodeIntegration src="page.html"></webview>
|
||||
```
|
||||
|
||||
### Enabling the sandbox globally
|
||||
|
||||
If you want to force sandboxing for all renderers, you can also use the
|
||||
|
||||
@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
|
||||
You should at least follow these steps to improve the security of your application:
|
||||
|
||||
1. [Only load secure content](#1-only-load-secure-content)
|
||||
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
|
||||
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
|
||||
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
|
||||
4. [Enable process sandboxing](#4-enable-process-sandboxing)
|
||||
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
|
||||
@@ -244,10 +244,6 @@ to enable this behavior.
|
||||
Even when `nodeIntegration: false` is used, to truly enforce strong isolation
|
||||
and prevent the use of Node primitives `contextIsolation` **must** also be used.
|
||||
|
||||
Beware that _disabling context isolation_ for a renderer process by setting
|
||||
`nodeIntegration: true` _also disables process sandboxing_ for that process.
|
||||
See section below.
|
||||
|
||||
:::info
|
||||
For more information on what `contextIsolation` is and how to enable it please
|
||||
see our dedicated [Context Isolation](context-isolation.md) document.
|
||||
@@ -255,16 +251,6 @@ see our dedicated [Context Isolation](context-isolation.md) document.
|
||||
|
||||
### 4. Enable process sandboxing
|
||||
|
||||
:::info
|
||||
This recommendation is the default behavior in Electron since 20.0.0.
|
||||
|
||||
Additionally, process sandboxing can be enforced for all renderer processes
|
||||
application wide: [Enabling the sandbox globally](sandbox.md#enabling-the-sandbox-globally)
|
||||
|
||||
_Disabling context isolation_ (see above) _also disables process sandboxing_,
|
||||
regardless of the default, `sandbox: false` or globally enabled sandboxing!
|
||||
:::
|
||||
|
||||
[Sandboxing](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/design/sandbox.md)
|
||||
is a Chromium feature that uses the operating system to
|
||||
significantly limit what renderer processes have access to. You should enable
|
||||
@@ -299,7 +285,7 @@ const { session } = require('electron')
|
||||
const { URL } = require('node:url')
|
||||
|
||||
session
|
||||
.defaultSession
|
||||
.fromPartition('some-partition')
|
||||
.setPermissionRequestHandler((webContents, permission, callback) => {
|
||||
const parsedUrl = new URL(webContents.getURL())
|
||||
|
||||
@@ -316,8 +302,6 @@ session
|
||||
})
|
||||
```
|
||||
|
||||
Note: `session.defaultSession` is only available after `app.whenReady` is called.
|
||||
|
||||
### 6. Do not disable `webSecurity`
|
||||
|
||||
:::info
|
||||
@@ -408,8 +392,6 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
|
||||
})
|
||||
```
|
||||
|
||||
Note: `session.defaultSession` is only available after `app.whenReady` is called.
|
||||
|
||||
#### CSP meta tag
|
||||
|
||||
CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
|
||||
@@ -822,10 +804,10 @@ that your application might have the rights for.
|
||||
|
||||
#### How?
|
||||
|
||||
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
|
||||
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
|
||||
flipping these fuses easy. Check out the README of that module for more details on usage and
|
||||
potential error cases, and refer to
|
||||
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
|
||||
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
|
||||
|
||||
### 20. Do not expose Electron APIs to untrusted web content
|
||||
|
||||
|
||||
@@ -55,27 +55,14 @@ There are a few rules to follow for the purposes of this tutorial:
|
||||
- _author_, _license_, and _description_ can be any value, but will be necessary for
|
||||
[packaging][packaging] later on.
|
||||
|
||||
:::caution Install dependencies with a regular `node_modules` folder
|
||||
|
||||
Electron's packaging toolchain requires the `node_modules` folder to be physically on disk in the
|
||||
way that npm installs Node dependencies. By default, [Yarn Berry](https://yarnpkg.com/) and
|
||||
[pnpm](http://pnpm.io/) both use alternative installation strategies.
|
||||
|
||||
Therefore, you must set [`nodeLinker: node-modules`](https://yarnpkg.com/configuration/yarnrc#nodeLinker)
|
||||
in Yarn or [`nodeLinker: hoisted`](https://pnpm.io/settings#nodelinker) in pnpm if you are using
|
||||
those package managers.
|
||||
|
||||
:::
|
||||
|
||||
Then, install Electron into your app's **devDependencies**, which is the list of external
|
||||
development-only package dependencies not required in production.
|
||||
|
||||
:::info Why is Electron a dev dependency?
|
||||
:::info Why is Electron a devDependency?
|
||||
|
||||
This may seem counter-intuitive since your production code is running Electron APIs. Under the hood,
|
||||
Electron's JavaScript API binds to a binary that contains its implementations. The packaging step for
|
||||
Electron handles the bundling of this binary, eliminating the need to specify it as a production
|
||||
dependency.
|
||||
This may seem counter-intuitive since your production code is running Electron APIs.
|
||||
However, packaged apps will come bundled with the Electron binary, eliminating the need to specify
|
||||
it as a production dependency.
|
||||
|
||||
:::
|
||||
|
||||
@@ -83,17 +70,6 @@ dependency.
|
||||
npm install electron --save-dev
|
||||
```
|
||||
|
||||
:::warning
|
||||
|
||||
In order to correctly install Electron, you need to ensure that its `postinstall` lifecycle
|
||||
script is able to run. This means avoiding the `--ignore-scripts` flag on npm and allowlisting
|
||||
`electron` to run build scripts on other package managers.
|
||||
|
||||
This is likely to change in a future version of Electron. See
|
||||
[electron/rfcs#22](https://github.com/electron/rfcs/pull/22) for more details.
|
||||
|
||||
:::
|
||||
|
||||
Your package.json file should look something like this after initializing your package
|
||||
and installing Electron. You should also now have a `node_modules` folder containing
|
||||
the Electron executable, as well as a `package-lock.json` lockfile that specifies
|
||||
|
||||
@@ -82,7 +82,6 @@ auto_filenames = {
|
||||
"docs/api/structures/browser-window-options.md",
|
||||
"docs/api/structures/certificate-principal.md",
|
||||
"docs/api/structures/certificate.md",
|
||||
"docs/api/structures/color-space.md",
|
||||
"docs/api/structures/cookie.md",
|
||||
"docs/api/structures/cpu-usage.md",
|
||||
"docs/api/structures/crash-report.md",
|
||||
@@ -144,7 +143,6 @@ auto_filenames = {
|
||||
"docs/api/structures/service-worker-info.md",
|
||||
"docs/api/structures/shared-dictionary-info.md",
|
||||
"docs/api/structures/shared-dictionary-usage-info.md",
|
||||
"docs/api/structures/shared-texture-handle.md",
|
||||
"docs/api/structures/shared-worker-info.md",
|
||||
"docs/api/structures/sharing-item.md",
|
||||
"docs/api/structures/shortcut-details.md",
|
||||
|
||||
@@ -629,6 +629,8 @@ filenames = {
|
||||
"shell/common/gin_converters/usb_device_info_converter.h",
|
||||
"shell/common/gin_converters/value_converter.cc",
|
||||
"shell/common/gin_converters/value_converter.h",
|
||||
"shell/common/gin_helper/arguments.cc",
|
||||
"shell/common/gin_helper/arguments.h",
|
||||
"shell/common/gin_helper/callback.cc",
|
||||
"shell/common/gin_helper/callback.h",
|
||||
"shell/common/gin_helper/cleaned_up_at_exit.cc",
|
||||
|
||||
@@ -217,7 +217,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
|
||||
"//third_party/libc++/src/include/__atomic/contention_t.h",
|
||||
"//third_party/libc++/src/include/__atomic/fence.h",
|
||||
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
|
||||
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
|
||||
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
|
||||
"//third_party/libc++/src/include/__atomic/memory_order.h",
|
||||
@@ -841,6 +840,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/cmath",
|
||||
"//third_party/libc++/src/include/__cxx03/codecvt",
|
||||
"//third_party/libc++/src/include/__cxx03/complex",
|
||||
"//third_party/libc++/src/include/__cxx03/complex.h",
|
||||
"//third_party/libc++/src/include/__cxx03/condition_variable",
|
||||
"//third_party/libc++/src/include/__cxx03/csetjmp",
|
||||
"//third_party/libc++/src/include/__cxx03/csignal",
|
||||
@@ -853,20 +853,25 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/cstring",
|
||||
"//third_party/libc++/src/include/__cxx03/ctgmath",
|
||||
"//third_party/libc++/src/include/__cxx03/ctime",
|
||||
"//third_party/libc++/src/include/__cxx03/ctype.h",
|
||||
"//third_party/libc++/src/include/__cxx03/cuchar",
|
||||
"//third_party/libc++/src/include/__cxx03/cwchar",
|
||||
"//third_party/libc++/src/include/__cxx03/cwctype",
|
||||
"//third_party/libc++/src/include/__cxx03/deque",
|
||||
"//third_party/libc++/src/include/__cxx03/errno.h",
|
||||
"//third_party/libc++/src/include/__cxx03/exception",
|
||||
"//third_party/libc++/src/include/__cxx03/experimental/__config",
|
||||
"//third_party/libc++/src/include/__cxx03/experimental/utility",
|
||||
"//third_party/libc++/src/include/__cxx03/ext/__hash",
|
||||
"//third_party/libc++/src/include/__cxx03/ext/hash_map",
|
||||
"//third_party/libc++/src/include/__cxx03/ext/hash_set",
|
||||
"//third_party/libc++/src/include/__cxx03/fenv.h",
|
||||
"//third_party/libc++/src/include/__cxx03/float.h",
|
||||
"//third_party/libc++/src/include/__cxx03/forward_list",
|
||||
"//third_party/libc++/src/include/__cxx03/fstream",
|
||||
"//third_party/libc++/src/include/__cxx03/functional",
|
||||
"//third_party/libc++/src/include/__cxx03/future",
|
||||
"//third_party/libc++/src/include/__cxx03/inttypes.h",
|
||||
"//third_party/libc++/src/include/__cxx03/iomanip",
|
||||
"//third_party/libc++/src/include/__cxx03/ios",
|
||||
"//third_party/libc++/src/include/__cxx03/iosfwd",
|
||||
@@ -893,8 +898,11 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/sstream",
|
||||
"//third_party/libc++/src/include/__cxx03/stack",
|
||||
"//third_party/libc++/src/include/__cxx03/stdatomic.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdbool.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stddef.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdexcept",
|
||||
"//third_party/libc++/src/include/__cxx03/stdint.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdio.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdlib.h",
|
||||
"//third_party/libc++/src/include/__cxx03/streambuf",
|
||||
"//third_party/libc++/src/include/__cxx03/string",
|
||||
@@ -902,6 +910,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/string_view",
|
||||
"//third_party/libc++/src/include/__cxx03/strstream",
|
||||
"//third_party/libc++/src/include/__cxx03/system_error",
|
||||
"//third_party/libc++/src/include/__cxx03/tgmath.h",
|
||||
"//third_party/libc++/src/include/__cxx03/thread",
|
||||
"//third_party/libc++/src/include/__cxx03/type_traits",
|
||||
"//third_party/libc++/src/include/__cxx03/typeindex",
|
||||
@@ -914,6 +923,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/vector",
|
||||
"//third_party/libc++/src/include/__cxx03/version",
|
||||
"//third_party/libc++/src/include/__cxx03/wchar.h",
|
||||
"//third_party/libc++/src/include/__cxx03/wctype.h",
|
||||
"//third_party/libc++/src/include/__debug_utils/randomize_range.h",
|
||||
"//third_party/libc++/src/include/__debug_utils/sanitizers.h",
|
||||
"//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
|
||||
@@ -1024,12 +1034,14 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__fwd/get.h",
|
||||
"//third_party/libc++/src/include/__fwd/ios.h",
|
||||
"//third_party/libc++/src/include/__fwd/istream.h",
|
||||
"//third_party/libc++/src/include/__fwd/map.h",
|
||||
"//third_party/libc++/src/include/__fwd/mdspan.h",
|
||||
"//third_party/libc++/src/include/__fwd/memory.h",
|
||||
"//third_party/libc++/src/include/__fwd/memory_resource.h",
|
||||
"//third_party/libc++/src/include/__fwd/ostream.h",
|
||||
"//third_party/libc++/src/include/__fwd/pair.h",
|
||||
"//third_party/libc++/src/include/__fwd/queue.h",
|
||||
"//third_party/libc++/src/include/__fwd/set.h",
|
||||
"//third_party/libc++/src/include/__fwd/span.h",
|
||||
"//third_party/libc++/src/include/__fwd/sstream.h",
|
||||
"//third_party/libc++/src/include/__fwd/stack.h",
|
||||
@@ -1355,9 +1367,11 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__tree",
|
||||
"//third_party/libc++/src/include/__tuple/find_index.h",
|
||||
"//third_party/libc++/src/include/__tuple/ignore.h",
|
||||
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
|
||||
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_element.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_like.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_size.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_types.h",
|
||||
@@ -1367,6 +1381,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/aligned_storage.h",
|
||||
"//third_party/libc++/src/include/__type_traits/aligned_union.h",
|
||||
"//third_party/libc++/src/include/__type_traits/alignment_of.h",
|
||||
"//third_party/libc++/src/include/__type_traits/can_extract_key.h",
|
||||
"//third_party/libc++/src/include/__type_traits/common_reference.h",
|
||||
"//third_party/libc++/src/include/__type_traits/common_type.h",
|
||||
"//third_party/libc++/src/include/__type_traits/conditional.h",
|
||||
@@ -1414,7 +1429,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_function.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_integral.h",
|
||||
@@ -1448,7 +1462,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/is_trivially_relocatable.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_unbounded_array.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_union.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_unqualified.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_unsigned.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_void.h",
|
||||
@@ -1457,7 +1470,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_signed.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
|
||||
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
|
||||
"//third_party/libc++/src/include/__type_traits/nat.h",
|
||||
@@ -1489,7 +1501,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__utility/cmp.h",
|
||||
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
|
||||
"//third_party/libc++/src/include/__utility/declval.h",
|
||||
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
|
||||
"//third_party/libc++/src/include/__utility/element_count.h",
|
||||
"//third_party/libc++/src/include/__utility/empty.h",
|
||||
"//third_party/libc++/src/include/__utility/exception_guard.h",
|
||||
@@ -1500,7 +1511,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__utility/integer_sequence.h",
|
||||
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
|
||||
"//third_party/libc++/src/include/__utility/is_valid_range.h",
|
||||
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
|
||||
"//third_party/libc++/src/include/__utility/move.h",
|
||||
"//third_party/libc++/src/include/__utility/no_destroy.h",
|
||||
"//third_party/libc++/src/include/__utility/pair.h",
|
||||
@@ -1512,7 +1522,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__utility/small_buffer.h",
|
||||
"//third_party/libc++/src/include/__utility/swap.h",
|
||||
"//third_party/libc++/src/include/__utility/to_underlying.h",
|
||||
"//third_party/libc++/src/include/__utility/try_key_extraction.h",
|
||||
"//third_party/libc++/src/include/__utility/unreachable.h",
|
||||
"//third_party/libc++/src/include/__variant/monostate.h",
|
||||
"//third_party/libc++/src/include/__vector/comparison.h",
|
||||
|
||||
@@ -1,14 +1,11 @@
|
||||
import { Menu } from 'electron/main';
|
||||
|
||||
import { EventEmitter } from 'events';
|
||||
import * as fs from 'fs';
|
||||
|
||||
const bindings = process._linkedBinding('electron_browser_app');
|
||||
const commandLine = process._linkedBinding('electron_common_command_line');
|
||||
const { app } = bindings;
|
||||
|
||||
Object.setPrototypeOf(app, EventEmitter.prototype);
|
||||
|
||||
// Only one app object permitted.
|
||||
export default app;
|
||||
|
||||
|
||||
@@ -25,32 +25,13 @@ Menu.prototype._isCommandIdChecked = function (id) {
|
||||
};
|
||||
|
||||
Menu.prototype._isCommandIdEnabled = function (id) {
|
||||
const item = this.commandsMap[id];
|
||||
if (!item) return false;
|
||||
|
||||
const focusedWindow = BaseWindow.getFocusedWindow();
|
||||
|
||||
if (item.role === 'minimize' && focusedWindow) {
|
||||
return focusedWindow.isMinimizable();
|
||||
}
|
||||
|
||||
if (item.role === 'togglefullscreen' && focusedWindow) {
|
||||
return focusedWindow.isFullScreenable();
|
||||
}
|
||||
|
||||
if (item.role === 'close' && focusedWindow) {
|
||||
return focusedWindow.isClosable();
|
||||
}
|
||||
|
||||
return item.enabled;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].enabled : false;
|
||||
};
|
||||
|
||||
Menu.prototype._shouldCommandIdWorkWhenHidden = function (id) {
|
||||
return this.commandsMap[id]?.acceleratorWorksWhenHidden ?? false;
|
||||
return this.commandsMap[id] ? !!this.commandsMap[id].acceleratorWorksWhenHidden : false;
|
||||
};
|
||||
|
||||
Menu.prototype._isCommandIdVisible = function (id) {
|
||||
return this.commandsMap[id]?.visible ?? false;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].visible : false;
|
||||
};
|
||||
|
||||
Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator) {
|
||||
@@ -61,12 +42,12 @@ Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator
|
||||
};
|
||||
|
||||
Menu.prototype._shouldRegisterAcceleratorForCommandId = function (id) {
|
||||
return this.commandsMap[id]?.registerAccelerator ?? false;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].registerAccelerator : false;
|
||||
};
|
||||
|
||||
if (process.platform === 'darwin') {
|
||||
Menu.prototype._getSharingItemForCommandId = function (id) {
|
||||
return this.commandsMap[id]?.sharingItem ?? null;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].sharingItem : null;
|
||||
};
|
||||
}
|
||||
|
||||
|
||||
@@ -119,10 +119,7 @@ export function fetchWithSession (input: RequestInfo, init: (RequestInit & {bypa
|
||||
p.reject(err);
|
||||
});
|
||||
|
||||
// pipeTo expects a WritableStream<Uint8Array>. Node.js' Writable.toWeb returns WritableStream<any>,
|
||||
// which causes a TS structural mismatch.
|
||||
const writable = Writable.toWeb(r as unknown as Writable) as unknown as WritableStream<Uint8Array>;
|
||||
if (!req.body?.pipeTo(writable).then(() => r.end())) { r.end(); }
|
||||
if (!req.body?.pipeTo(Writable.toWeb(r as unknown as Writable)).then(() => r.end())) { r.end(); }
|
||||
|
||||
return p.promise;
|
||||
}
|
||||
|
||||
@@ -4,8 +4,6 @@ import { createReadStream } from 'fs';
|
||||
import { Readable } from 'stream';
|
||||
import { ReadableStream } from 'stream/web';
|
||||
|
||||
import type { ReadableStreamDefaultReader } from 'stream/web';
|
||||
|
||||
// Global protocol APIs.
|
||||
const { registerSchemesAsPrivileged, getStandardSchemes, Protocol } = process._linkedBinding('electron_browser_protocol');
|
||||
|
||||
@@ -14,7 +12,7 @@ const ERR_UNEXPECTED = -9;
|
||||
|
||||
const isBuiltInScheme = (scheme: string) => ['http', 'https', 'file'].includes(scheme);
|
||||
|
||||
function makeStreamFromPipe (pipe: any): ReadableStream<Uint8Array> {
|
||||
function makeStreamFromPipe (pipe: any): ReadableStream {
|
||||
const buf = new Uint8Array(1024 * 1024 /* 1 MB */);
|
||||
return new ReadableStream({
|
||||
async pull (controller) {
|
||||
@@ -40,26 +38,21 @@ function makeStreamFromFileInfo ({
|
||||
filePath: string;
|
||||
offset?: number;
|
||||
length?: number;
|
||||
}): ReadableStream<Uint8Array> {
|
||||
// Node's Readable.toWeb produces a WHATWG ReadableStream whose chunks are Uint8Array.
|
||||
}): ReadableStream {
|
||||
return Readable.toWeb(createReadStream(filePath, {
|
||||
start: offset,
|
||||
end: length >= 0 ? offset + length : undefined
|
||||
})) as ReadableStream<Uint8Array>;
|
||||
}));
|
||||
}
|
||||
|
||||
function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): RequestInit['body'] {
|
||||
if (!uploadData) return null;
|
||||
// Optimization: skip creating a stream if the request is just a single buffer.
|
||||
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') {
|
||||
return uploadData[0].bytes as any;
|
||||
}
|
||||
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') return uploadData[0].bytes;
|
||||
|
||||
const chunks = [...uploadData] as any[]; // TODO: refine ProtocolRequest types
|
||||
// Use Node's web stream types explicitly to avoid DOM lib vs Node lib structural mismatches.
|
||||
// Generic <Uint8Array> ensures reader.read() returns value?: Uint8Array consistent with enqueue.
|
||||
let current: ReadableStreamDefaultReader<Uint8Array> | null = null;
|
||||
return new ReadableStream<Uint8Array>({
|
||||
const chunks = [...uploadData] as any[]; // TODO: types are wrong
|
||||
let current: ReadableStreamDefaultReader | null = null;
|
||||
return new ReadableStream({
|
||||
async pull (controller) {
|
||||
if (current) {
|
||||
const { done, value } = await current.read();
|
||||
@@ -74,7 +67,7 @@ function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): Reque
|
||||
if (!chunks.length) { return controller.close(); }
|
||||
const chunk = chunks.shift()!;
|
||||
if (chunk.type === 'rawData') {
|
||||
controller.enqueue(chunk.bytes as Uint8Array);
|
||||
controller.enqueue(chunk.bytes);
|
||||
} else if (chunk.type === 'file') {
|
||||
current = makeStreamFromFileInfo(chunk).getReader();
|
||||
return this.pull!(controller);
|
||||
|
||||
@@ -882,7 +882,7 @@ export function create (options = {}): Electron.WebContents {
|
||||
return new (WebContents as any)(options);
|
||||
}
|
||||
|
||||
export function fromId (id: number) {
|
||||
export function fromId (id: string) {
|
||||
return binding.fromId(id);
|
||||
}
|
||||
|
||||
|
||||
@@ -40,7 +40,7 @@ process.on('uncaughtException', function (error) {
|
||||
// Emit 'exit' event on quit.
|
||||
const { app } = require('electron');
|
||||
|
||||
app.on('quit', (_event: any, exitCode: number) => {
|
||||
app.on('quit', (_event, exitCode) => {
|
||||
process.emit('exit', exitCode);
|
||||
});
|
||||
|
||||
@@ -162,6 +162,27 @@ require('@electron/internal/browser/api/web-contents-view');
|
||||
// Set main startup script of the app.
|
||||
const mainStartupScript = packageJson.main || 'index.js';
|
||||
|
||||
const KNOWN_XDG_DESKTOP_VALUES = new Set(['Pantheon', 'Unity:Unity7', 'pop:GNOME']);
|
||||
|
||||
function currentPlatformSupportsAppIndicator () {
|
||||
if (process.platform !== 'linux') return false;
|
||||
const currentDesktop = process.env.XDG_CURRENT_DESKTOP;
|
||||
|
||||
if (!currentDesktop) return false;
|
||||
if (KNOWN_XDG_DESKTOP_VALUES.has(currentDesktop)) return true;
|
||||
// ubuntu based or derived session (default ubuntu one, communitheme…) supports
|
||||
// indicator too.
|
||||
if (/ubuntu/ig.test(currentDesktop)) return true;
|
||||
|
||||
return false;
|
||||
}
|
||||
|
||||
// Workaround for electron/electron#5050 and electron/electron#9046
|
||||
process.env.ORIGINAL_XDG_CURRENT_DESKTOP = process.env.XDG_CURRENT_DESKTOP;
|
||||
if (currentPlatformSupportsAppIndicator()) {
|
||||
process.env.XDG_CURRENT_DESKTOP = 'Unity';
|
||||
}
|
||||
|
||||
// Quit when all windows are closed and no other one is listening to this.
|
||||
app.on('window-all-closed', () => {
|
||||
if (app.listenerCount('window-all-closed') === 1) {
|
||||
|
||||
@@ -91,12 +91,6 @@ export function parseFeatures (features: string) {
|
||||
delete parsed[key];
|
||||
}
|
||||
|
||||
// Per spec - https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev
|
||||
// windows are always resizable.
|
||||
if (parsed.resizable !== undefined) {
|
||||
delete parsed.resizable;
|
||||
}
|
||||
|
||||
if (parsed.left !== undefined) parsed.x = parsed.left;
|
||||
if (parsed.top !== undefined) parsed.y = parsed.top;
|
||||
|
||||
|
||||
@@ -746,7 +746,7 @@ export const wrapFsWithAsar = (fs: Record<string, any>) => {
|
||||
|
||||
context.readdirResults.push(dirent);
|
||||
if (dirent!.isDirectory() || stat === 1) {
|
||||
context.pathsQueue.push(path.join(dirent!.parentPath, dirent!.name));
|
||||
context.pathsQueue.push(path.join(dirent!.path, dirent!.name));
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -5,9 +5,7 @@ const proc = require('child_process');
|
||||
const electron = require('./');
|
||||
|
||||
const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
|
||||
let childClosed = false;
|
||||
child.on('close', function (code, signal) {
|
||||
childClosed = true;
|
||||
if (code === null) {
|
||||
console.error(electron, 'exited with signal', signal);
|
||||
process.exit(1);
|
||||
@@ -17,7 +15,7 @@ child.on('close', function (code, signal) {
|
||||
|
||||
const handleTerminationSignal = function (signal) {
|
||||
process.on(signal, function signalHandler () {
|
||||
if (!childClosed) {
|
||||
if (!child.killed) {
|
||||
child.kill(signal);
|
||||
}
|
||||
});
|
||||
@@ -25,4 +23,3 @@ const handleTerminationSignal = function (signal) {
|
||||
|
||||
handleTerminationSignal('SIGINT');
|
||||
handleTerminationSignal('SIGTERM');
|
||||
handleTerminationSignal('SIGUSR2');
|
||||
|
||||
@@ -44,7 +44,7 @@ downloadArtifact({
|
||||
artifactName: 'electron',
|
||||
force: process.env.force_no_cache === 'true',
|
||||
cacheRoot: process.env.electron_config_cache,
|
||||
checksums: (process.env.electron_use_remote_checksums || process.env.npm_config_electron_use_remote_checksums) ? undefined : require('./checksums.json'),
|
||||
checksums: process.env.electron_use_remote_checksums ?? process.env.npm_config_electron_use_remote_checksums ? undefined : require('./checksums.json'),
|
||||
platform,
|
||||
arch
|
||||
}).then(extractFile).catch(err => {
|
||||
|
||||
@@ -9,7 +9,7 @@
|
||||
},
|
||||
"dependencies": {
|
||||
"@electron/get": "^2.0.0",
|
||||
"@types/node": "^24.9.0",
|
||||
"@types/node": "^22.7.7",
|
||||
"extract-zip": "^2.0.1"
|
||||
},
|
||||
"engines": {
|
||||
|
||||
23
package.json
23
package.json
@@ -4,23 +4,22 @@
|
||||
"repository": "https://github.com/electron/electron",
|
||||
"description": "Build cross platform desktop apps with JavaScript, HTML, and CSS",
|
||||
"devDependencies": {
|
||||
"@azure/storage-blob": "^12.28.0",
|
||||
"@azure/storage-blob": "^12.25.0",
|
||||
"@electron/asar": "^3.2.13",
|
||||
"@electron/docs-parser": "^2.0.0",
|
||||
"@electron/fiddle-core": "^1.3.4",
|
||||
"@electron/github-app-auth": "^2.2.1",
|
||||
"@electron/lint-roller": "^3.1.2",
|
||||
"@electron/typescript-definitions": "^9.1.5",
|
||||
"@octokit/rest": "^20.1.2",
|
||||
"@electron/lint-roller": "^3.1.1",
|
||||
"@electron/typescript-definitions": "^9.1.2",
|
||||
"@octokit/rest": "^20.0.2",
|
||||
"@primer/octicons": "^10.0.0",
|
||||
"@types/minimist": "^1.2.5",
|
||||
"@types/node": "^24.9.0",
|
||||
"@types/node": "^22.7.7",
|
||||
"@types/semver": "^7.5.8",
|
||||
"@types/stream-json": "^1.7.8",
|
||||
"@types/stream-json": "^1.7.7",
|
||||
"@types/temp": "^0.9.4",
|
||||
"@typescript-eslint/eslint-plugin": "^8.32.1",
|
||||
"@typescript-eslint/parser": "^8.7.0",
|
||||
"@xmldom/xmldom": "^0.8.11",
|
||||
"buffer": "^6.0.3",
|
||||
"chalk": "^4.1.0",
|
||||
"check-for-leaks": "^1.2.1",
|
||||
@@ -34,7 +33,7 @@
|
||||
"eslint-plugin-node": "^11.1.0",
|
||||
"eslint-plugin-promise": "^6.6.0",
|
||||
"events": "^3.2.0",
|
||||
"folder-hash": "^4.1.1",
|
||||
"folder-hash": "^2.1.1",
|
||||
"got": "^11.8.5",
|
||||
"husky": "^9.1.7",
|
||||
"lint-staged": "^16.1.0",
|
||||
@@ -44,18 +43,18 @@
|
||||
"pre-flight": "^2.0.0",
|
||||
"process": "^0.11.10",
|
||||
"remark-cli": "^12.0.1",
|
||||
"remark-preset-lint-markdown-style-guide": "^6.0.1",
|
||||
"remark-preset-lint-markdown-style-guide": "^4.0.0",
|
||||
"semver": "^7.6.3",
|
||||
"stream-json": "^1.9.1",
|
||||
"stream-json": "^1.8.0",
|
||||
"tap-xunit": "^2.4.1",
|
||||
"temp": "^0.9.4",
|
||||
"timers-browserify": "1.4.2",
|
||||
"ts-loader": "^8.0.2",
|
||||
"ts-node": "6.2.0",
|
||||
"typescript": "^5.8.3",
|
||||
"typescript": "^5.6.2",
|
||||
"url": "^0.11.4",
|
||||
"webpack": "^5.95.0",
|
||||
"webpack-cli": "^6.0.1",
|
||||
"webpack-cli": "^5.1.4",
|
||||
"wrapper-webpack-plugin": "^2.2.0"
|
||||
},
|
||||
"private": true,
|
||||
|
||||
@@ -10,10 +10,10 @@ this patch is required to provide ripemd160 support in the nodejs crypto
|
||||
module.
|
||||
|
||||
diff --git a/crypto/digest/digest_extra.cc b/crypto/digest/digest_extra.cc
|
||||
index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47b9e3034f 100644
|
||||
index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d27388be99 100644
|
||||
--- a/crypto/digest/digest_extra.cc
|
||||
+++ b/crypto/digest/digest_extra.cc
|
||||
@@ -47,6 +47,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
|
||||
@@ -46,6 +46,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
|
||||
{NID_sha512, EVP_sha512, SN_sha512, LN_sha512},
|
||||
{NID_sha512_256, EVP_sha512_256, SN_sha512_256, LN_sha512_256},
|
||||
{NID_md5_sha1, EVP_md5_sha1, SN_md5_sha1, LN_md5_sha1},
|
||||
@@ -22,7 +22,7 @@ index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47
|
||||
// hash function when given a signature OID. To avoid unintended lax parsing
|
||||
// of hash OIDs, this is no longer supported for lookup by OID or NID.
|
||||
diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
|
||||
index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
|
||||
index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
|
||||
--- a/crypto/fipsmodule/digest/digests.cc.inc
|
||||
+++ b/crypto/fipsmodule/digest/digests.cc.inc
|
||||
@@ -18,6 +18,7 @@
|
||||
@@ -62,27 +62,27 @@ index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649
|
||||
+
|
||||
#undef CHECK
|
||||
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
|
||||
index feaf17c72cecb8099bc11ac10747fbad719ddca9..891a73f229e3f0838cb2fa99b8fb24fdeac1962b 100644
|
||||
index e04b80cd6a1a215fc87f8fd8d750c3d258c3974f..8fdf1c624794f568bfc77b7b6b0c510b23905a4d 100644
|
||||
--- a/decrepit/evp/evp_do_all.cc
|
||||
+++ b/decrepit/evp/evp_do_all.cc
|
||||
@@ -79,6 +79,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
|
||||
callback(EVP_sha384(), "SHA384", nullptr, arg);
|
||||
callback(EVP_sha512(), "SHA512", nullptr, arg);
|
||||
callback(EVP_sha512_256(), "SHA512-256", nullptr, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
|
||||
callback(EVP_sha384(), "SHA384", NULL, arg);
|
||||
callback(EVP_sha512(), "SHA512", NULL, arg);
|
||||
callback(EVP_sha512_256(), "SHA512-256", NULL, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
|
||||
|
||||
callback(EVP_md4(), "md4", nullptr, arg);
|
||||
callback(EVP_md5(), "md5", nullptr, arg);
|
||||
callback(EVP_md4(), "md4", NULL, arg);
|
||||
callback(EVP_md5(), "md5", NULL, arg);
|
||||
@@ -88,6 +89,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
|
||||
callback(EVP_sha384(), "sha384", nullptr, arg);
|
||||
callback(EVP_sha512(), "sha512", nullptr, arg);
|
||||
callback(EVP_sha512_256(), "sha512-256", nullptr, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
|
||||
callback(EVP_sha384(), "sha384", NULL, arg);
|
||||
callback(EVP_sha512(), "sha512", NULL, arg);
|
||||
callback(EVP_sha512_256(), "sha512-256", NULL, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
|
||||
}
|
||||
|
||||
void EVP_MD_do_all(void (*callback)(const EVP_MD *cipher, const char *name,
|
||||
diff --git a/include/openssl/digest.h b/include/openssl/digest.h
|
||||
index a86c18926e7798a3b0aae70c53870e03b5acd0ab..f4f27f9e803533d8db50d89e7a0125384a025a46 100644
|
||||
index 710c6e6d110378d1db10d8c2ae57b2d844c603b9..dbb1e0cd5e9480d1ac7a86cbca6fae29d6a8dca4 100644
|
||||
--- a/include/openssl/digest.h
|
||||
+++ b/include/openssl/digest.h
|
||||
@@ -48,6 +48,9 @@ OPENSSL_EXPORT const EVP_MD *EVP_blake2b256(void);
|
||||
|
||||
@@ -28,7 +28,7 @@ RC2 Ciphers: rc2-40-cbc
|
||||
It's unclear whether this would be accepted upstream. We should try regardless.
|
||||
|
||||
diff --git a/crypto/cipher/get_cipher.cc b/crypto/cipher/get_cipher.cc
|
||||
index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da0229687f 100644
|
||||
index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f825851b634 100644
|
||||
--- a/crypto/cipher/get_cipher.cc
|
||||
+++ b/crypto/cipher/get_cipher.cc
|
||||
@@ -31,6 +31,7 @@ static const struct {
|
||||
@@ -64,64 +64,64 @@ index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da
|
||||
|
||||
const EVP_CIPHER *EVP_get_cipherbynid(int nid) {
|
||||
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
|
||||
index 891a73f229e3f0838cb2fa99b8fb24fdeac1962b..f7d0c5dc66f016eb9338c15e7f5ef59e6de2969d 100644
|
||||
index 8fdf1c624794f568bfc77b7b6b0c510b23905a4d..2e40c031e8c681fe921331b26dbf63f4df2fcf71 100644
|
||||
--- a/decrepit/evp/evp_do_all.cc
|
||||
+++ b/decrepit/evp/evp_do_all.cc
|
||||
@@ -20,8 +20,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
const char *unused, void *arg),
|
||||
void *arg) {
|
||||
callback(EVP_aes_128_cbc(), "AES-128-CBC", nullptr, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", nullptr, arg);
|
||||
callback(EVP_aes_192_cbc(), "AES-192-CBC", nullptr, arg);
|
||||
callback(EVP_aes_256_cbc(), "AES-256-CBC", nullptr, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", nullptr, arg);
|
||||
callback(EVP_aes_128_ctr(), "AES-128-CTR", nullptr, arg);
|
||||
callback(EVP_aes_192_ctr(), "AES-192-CTR", nullptr, arg);
|
||||
callback(EVP_aes_256_ctr(), "AES-256-CTR", nullptr, arg);
|
||||
callback(EVP_aes_128_cbc(), "AES-128-CBC", NULL, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", NULL, arg);
|
||||
callback(EVP_aes_192_cbc(), "AES-192-CBC", NULL, arg);
|
||||
callback(EVP_aes_256_cbc(), "AES-256-CBC", NULL, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", NULL, arg);
|
||||
callback(EVP_aes_128_ctr(), "AES-128-CTR", NULL, arg);
|
||||
callback(EVP_aes_192_ctr(), "AES-192-CTR", NULL, arg);
|
||||
callback(EVP_aes_256_ctr(), "AES-256-CTR", NULL, arg);
|
||||
@@ -34,9 +36,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
callback(EVP_aes_128_gcm(), "AES-128-GCM", nullptr, arg);
|
||||
callback(EVP_aes_192_gcm(), "AES-192-GCM", nullptr, arg);
|
||||
callback(EVP_aes_256_gcm(), "AES-256-GCM", nullptr, arg);
|
||||
+ callback(EVP_bf_cbc(), "BF-CBC", nullptr, arg);
|
||||
+ callback(EVP_bf_cfb(), "BF-CFB", nullptr, arg);
|
||||
+ callback(EVP_bf_ecb(), "BF-ECB", nullptr, arg);
|
||||
callback(EVP_des_cbc(), "DES-CBC", nullptr, arg);
|
||||
callback(EVP_des_ecb(), "DES-ECB", nullptr, arg);
|
||||
callback(EVP_des_ede(), "DES-EDE", nullptr, arg);
|
||||
+ callback(EVP_des_ede3(), "DES-EDE3", nullptr, arg);
|
||||
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", nullptr, arg);
|
||||
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", nullptr, arg);
|
||||
callback(EVP_rc2_cbc(), "RC2-CBC", nullptr, arg);
|
||||
callback(EVP_aes_128_gcm(), "AES-128-GCM", NULL, arg);
|
||||
callback(EVP_aes_192_gcm(), "AES-192-GCM", NULL, arg);
|
||||
callback(EVP_aes_256_gcm(), "AES-256-GCM", NULL, arg);
|
||||
+ callback(EVP_bf_cbc(), "BF-CBC", NULL, arg);
|
||||
+ callback(EVP_bf_cfb(), "BF-CFB", NULL, arg);
|
||||
+ callback(EVP_bf_ecb(), "BF-ECB", NULL, arg);
|
||||
callback(EVP_des_cbc(), "DES-CBC", NULL, arg);
|
||||
callback(EVP_des_ecb(), "DES-ECB", NULL, arg);
|
||||
callback(EVP_des_ede(), "DES-EDE", NULL, arg);
|
||||
+ callback(EVP_des_ede3(), "DES-EDE3", NULL, arg);
|
||||
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", NULL, arg);
|
||||
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", NULL, arg);
|
||||
callback(EVP_rc2_cbc(), "RC2-CBC", NULL, arg);
|
||||
@@ -44,8 +50,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
|
||||
// OpenSSL returns everything twice, the second time in lower case.
|
||||
callback(EVP_aes_128_cbc(), "aes-128-cbc", nullptr, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", nullptr, arg);
|
||||
callback(EVP_aes_192_cbc(), "aes-192-cbc", nullptr, arg);
|
||||
callback(EVP_aes_256_cbc(), "aes-256-cbc", nullptr, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", nullptr, arg);
|
||||
callback(EVP_aes_128_ctr(), "aes-128-ctr", nullptr, arg);
|
||||
callback(EVP_aes_192_ctr(), "aes-192-ctr", nullptr, arg);
|
||||
callback(EVP_aes_256_ctr(), "aes-256-ctr", nullptr, arg);
|
||||
callback(EVP_aes_128_cbc(), "aes-128-cbc", NULL, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", NULL, arg);
|
||||
callback(EVP_aes_192_cbc(), "aes-192-cbc", NULL, arg);
|
||||
callback(EVP_aes_256_cbc(), "aes-256-cbc", NULL, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", NULL, arg);
|
||||
callback(EVP_aes_128_ctr(), "aes-128-ctr", NULL, arg);
|
||||
callback(EVP_aes_192_ctr(), "aes-192-ctr", NULL, arg);
|
||||
callback(EVP_aes_256_ctr(), "aes-256-ctr", NULL, arg);
|
||||
@@ -58,9 +66,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
callback(EVP_aes_128_gcm(), "aes-128-gcm", nullptr, arg);
|
||||
callback(EVP_aes_192_gcm(), "aes-192-gcm", nullptr, arg);
|
||||
callback(EVP_aes_256_gcm(), "aes-256-gcm", nullptr, arg);
|
||||
+ callback(EVP_bf_cbc(), "bf-cbc", nullptr, arg);
|
||||
+ callback(EVP_bf_cfb(), "bf-cfb", nullptr, arg);
|
||||
+ callback(EVP_bf_ecb(), "bf-ecb", nullptr, arg);
|
||||
callback(EVP_des_cbc(), "des-cbc", nullptr, arg);
|
||||
callback(EVP_des_ecb(), "des-ecb", nullptr, arg);
|
||||
callback(EVP_des_ede(), "des-ede", nullptr, arg);
|
||||
+ callback(EVP_des_ede3(), "des-ede3", nullptr, arg);
|
||||
callback(EVP_des_ede_cbc(), "des-ede-cbc", nullptr, arg);
|
||||
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", nullptr, arg);
|
||||
callback(EVP_rc2_cbc(), "rc2-cbc", nullptr, arg);
|
||||
callback(EVP_aes_128_gcm(), "aes-128-gcm", NULL, arg);
|
||||
callback(EVP_aes_192_gcm(), "aes-192-gcm", NULL, arg);
|
||||
callback(EVP_aes_256_gcm(), "aes-256-gcm", NULL, arg);
|
||||
+ callback(EVP_bf_cbc(), "bf-cbc", NULL, arg);
|
||||
+ callback(EVP_bf_cfb(), "bf-cfb", NULL, arg);
|
||||
+ callback(EVP_bf_ecb(), "bf-ecb", NULL, arg);
|
||||
callback(EVP_des_cbc(), "des-cbc", NULL, arg);
|
||||
callback(EVP_des_ecb(), "des-ecb", NULL, arg);
|
||||
callback(EVP_des_ede(), "des-ede", NULL, arg);
|
||||
+ callback(EVP_des_ede3(), "des-ede3", NULL, arg);
|
||||
callback(EVP_des_ede_cbc(), "des-ede-cbc", NULL, arg);
|
||||
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", NULL, arg);
|
||||
callback(EVP_rc2_cbc(), "rc2-cbc", NULL, arg);
|
||||
diff --git a/include/openssl/cipher.h b/include/openssl/cipher.h
|
||||
index a5533caf45eaacc4baef4a73d97e9bc2b6e3a942..35f24c1b22ea2c6b4766c0d87e75b6fc6b459f79 100644
|
||||
index 13e68ad20ac08a462bb577d7f99e2c6f167579fa..4960d0eeb8f31bec4347ed2a1b63beba530de700 100644
|
||||
--- a/include/openssl/cipher.h
|
||||
+++ b/include/openssl/cipher.h
|
||||
@@ -461,6 +461,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
|
||||
@@ -448,6 +448,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
|
||||
|
||||
// EVP_aes_128_cfb128 is only available in decrepit.
|
||||
OPENSSL_EXPORT const EVP_CIPHER *EVP_aes_128_cfb128(void);
|
||||
|
||||
@@ -8,7 +8,7 @@ This reverts commit ebd8b8965c74ab06bb91f7a00b23822e1f1f26ca.
|
||||
It is causing significant TLS failures in Node.js.
|
||||
|
||||
diff --git a/ssl/ssl_buffer.cc b/ssl/ssl_buffer.cc
|
||||
index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad1655500d33 100644
|
||||
index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a02124b80f9ef 100644
|
||||
--- a/ssl/ssl_buffer.cc
|
||||
+++ b/ssl/ssl_buffer.cc
|
||||
@@ -230,7 +230,6 @@ int ssl_handle_open_record(SSL *ssl, bool *out_retry, ssl_open_record_t ret,
|
||||
@@ -20,10 +20,10 @@ index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad16
|
||||
|
||||
case ssl_open_record_error:
|
||||
diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
|
||||
index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e517ea6ae2 100644
|
||||
index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f8431434e42 100644
|
||||
--- a/ssl/ssl_lib.cc
|
||||
+++ b/ssl/ssl_lib.cc
|
||||
@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
|
||||
@@ -1206,7 +1206,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
|
||||
}
|
||||
|
||||
if (ret_code == 0) {
|
||||
@@ -32,7 +32,7 @@ index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e5
|
||||
return SSL_ERROR_ZERO_RETURN;
|
||||
}
|
||||
// An EOF was observed which violates the protocol, and the underlying
|
||||
@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
|
||||
@@ -2567,13 +2567,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
|
||||
return CRYPTO_get_ex_data(&ctx->ex_data, idx);
|
||||
}
|
||||
|
||||
|
||||
@@ -110,6 +110,7 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
|
||||
fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
|
||||
refactor_expose_file_system_access_blocklist.patch
|
||||
feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
|
||||
fix_font_face_resolution_when_renderer_is_blocked.patch
|
||||
feat_enable_passing_exit_code_on_service_process_crash.patch
|
||||
chore_remove_reference_to_chrome_browser_themes.patch
|
||||
feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
|
||||
@@ -131,16 +132,8 @@ chore_grandfather_in_electron_views_and_delegates.patch
|
||||
refactor_patch_electron_permissiontypes_into_blink.patch
|
||||
revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
|
||||
build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
|
||||
build_set_mac_sdk_minimum_to_10.patch
|
||||
fix_add_macos_memory_query_fallback_to_avoid_crash.patch
|
||||
fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
|
||||
feat_add_support_for_embedder_snapshot_validation.patch
|
||||
chore_restore_some_deprecated_wrapper_utility_in_gin.patch
|
||||
chore_add_electron_objects_to_wrappablepointertag.patch
|
||||
chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
|
||||
revert_partial_remove_unused_prehandlemouseevent.patch
|
||||
allow_electron_to_depend_on_components_os_crypt_sync.patch
|
||||
expose_referrerscriptinfo_hostdefinedoptionsindex.patch
|
||||
chore_disable_protocol_handler_dcheck.patch
|
||||
fix_check_for_file_existence_before_setting_mtime.patch
|
||||
revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch
|
||||
fix_release_mouse_buttons_on_focus_loss_on_wayland.patch
|
||||
band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch
|
||||
|
||||
@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
|
||||
}
|
||||
|
||||
diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
|
||||
index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
|
||||
index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
|
||||
--- a/ui/base/accelerators/accelerator.h
|
||||
+++ b/ui/base/accelerators/accelerator.h
|
||||
@@ -21,6 +21,7 @@
|
||||
@@ -18,6 +18,7 @@
|
||||
#include <vector>
|
||||
|
||||
#include "base/component_export.h"
|
||||
+#include "third_party/abseil-cpp/absl/types/optional.h"
|
||||
#include "base/time/time.h"
|
||||
#include "build/blink_buildflags.h"
|
||||
#include "build/build_config.h"
|
||||
+#include "third_party/abseil-cpp/absl/types/optional.h"
|
||||
#include "ui/events/event_constants.h"
|
||||
#include "ui/events/keycodes/keyboard_codes.h"
|
||||
|
||||
@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
|
||||
<< 18); // masked to 6 bits
|
||||
@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
|
||||
return interrupted_by_mouse_event_;
|
||||
}
|
||||
|
||||
+ absl::optional<char16_t> shifted_char;
|
||||
|
||||
@@ -10,10 +10,10 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
|
||||
This should be upstreamed.
|
||||
|
||||
diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
|
||||
index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
|
||||
index f9e15ddeeb022b77607ae7880a5a7121abc7a111..954a4966c73a74816131217756f17c04483bb1fe 100644
|
||||
--- a/content/gpu/gpu_main.cc
|
||||
+++ b/content/gpu/gpu_main.cc
|
||||
@@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
@@ -271,6 +271,10 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
// to the GpuProcessHost once the GpuServiceImpl has started.
|
||||
viz::GpuLogMessageManager::GetInstance()->InstallPreInitializeLogHandler();
|
||||
|
||||
@@ -24,7 +24,7 @@ index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f
|
||||
// We are experiencing what appear to be memory-stomp issues in the GPU
|
||||
// process. These issues seem to be impacting the task executor and listeners
|
||||
// registered to it. Create the task executor on the heap to guard against
|
||||
@@ -381,7 +385,6 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
@@ -380,7 +384,6 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
#endif
|
||||
const bool dead_on_arrival = !init_success;
|
||||
|
||||
|
||||
@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
|
||||
context, which can cause some preload scripts to trip.
|
||||
|
||||
diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
|
||||
index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
|
||||
index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e90be3d39b 100644
|
||||
--- a/content/public/renderer/render_frame_observer.h
|
||||
+++ b/content/public/renderer/render_frame_observer.h
|
||||
@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
|
||||
@@ -138,6 +138,8 @@ class CONTENT_EXPORT RenderFrameObserver {
|
||||
virtual void DidHandleOnloadEvents() {}
|
||||
virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
int32_t world_id) {}
|
||||
@@ -23,10 +23,10 @@ index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b
|
||||
int32_t world_id) {}
|
||||
virtual void DidClearWindowObject() {}
|
||||
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
|
||||
index 298387873e7ded5f96c788bc53ad7256a8f5b13e..7e64e34a2ebd9738d33bfc9cc7fd827b8757037d 100644
|
||||
index ede4414f875254b77ffb29d0e1bfb254c619b10f..5f766b7d1bd20131b380e862090716de899d086c 100644
|
||||
--- a/content/renderer/render_frame_impl.cc
|
||||
+++ b/content/renderer/render_frame_impl.cc
|
||||
@@ -4659,6 +4659,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
@@ -4676,6 +4676,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
observer.DidCreateScriptContext(context, world_id);
|
||||
}
|
||||
|
||||
@@ -40,7 +40,7 @@ index 298387873e7ded5f96c788bc53ad7256a8f5b13e..7e64e34a2ebd9738d33bfc9cc7fd827b
|
||||
int world_id) {
|
||||
for (auto& observer : observers_)
|
||||
diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
|
||||
index b6acf7101932961b4a81738e1fcda07efc714edc..32dfed04e2fd7cd2e60c7cf145d182f4163feb68 100644
|
||||
index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa56dbfa2dc 100644
|
||||
--- a/content/renderer/render_frame_impl.h
|
||||
+++ b/content/renderer/render_frame_impl.h
|
||||
@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
|
||||
@@ -53,10 +53,10 @@ index b6acf7101932961b4a81738e1fcda07efc714edc..32dfed04e2fd7cd2e60c7cf145d182f4
|
||||
int world_id) override;
|
||||
void DidChangeScrollOffset() override;
|
||||
diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
|
||||
index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
|
||||
index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00bf366e92d 100644
|
||||
--- a/third_party/blink/public/web/web_local_frame_client.h
|
||||
+++ b/third_party/blink/public/web/web_local_frame_client.h
|
||||
@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
|
||||
@@ -662,6 +662,9 @@ class BLINK_EXPORT WebLocalFrameClient {
|
||||
virtual void DidCreateScriptContext(v8::Local<v8::Context>,
|
||||
int32_t world_id) {}
|
||||
|
||||
@@ -67,10 +67,10 @@ index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb3
|
||||
virtual void WillReleaseScriptContext(v8::Local<v8::Context>,
|
||||
int32_t world_id) {}
|
||||
diff --git a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
|
||||
index 3ce1ef340780075951fb8c1b65f2ec90569f34ef..898d7caac98727210ac5780b576526a71ec5a5aa 100644
|
||||
index b963abd8c4bf6ffaea1930a8d1f647a8a8c266bc..2e8653654686f4fc775288f059ff27daa38e02d5 100644
|
||||
--- a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
|
||||
+++ b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
|
||||
@@ -217,6 +217,7 @@ void LocalWindowProxy::Initialize() {
|
||||
@@ -216,6 +216,7 @@ void LocalWindowProxy::Initialize() {
|
||||
}
|
||||
|
||||
InstallConditionalFeatures();
|
||||
@@ -92,11 +92,11 @@ index 36baf908d3be8aed44ff60b8de2cffe2eee15efe..8d73ddb12013ce195026b9f63050cf33
|
||||
int32_t world_id) = 0;
|
||||
virtual bool AllowScriptExtensions() = 0;
|
||||
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
|
||||
index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9ae8d3379f 100644
|
||||
index 22f1a4a3a903cb82a1066642e542bb78bf321d79..77d76bf97976e18a8bd077e005b8a3addf9b029d 100644
|
||||
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
|
||||
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
|
||||
@@ -300,6 +300,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
|
||||
}
|
||||
@@ -295,6 +295,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
|
||||
web_frame_->Client()->DidCreateScriptContext(context, world_id);
|
||||
}
|
||||
|
||||
+void LocalFrameClientImpl::DidInstallConditionalFeatures(
|
||||
@@ -110,7 +110,7 @@ index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9a
|
||||
v8::Local<v8::Context> context,
|
||||
int32_t world_id) {
|
||||
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.h b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
|
||||
index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e5844349c0b5 100644
|
||||
index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf30267fddf7c4 100644
|
||||
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.h
|
||||
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
|
||||
@@ -81,6 +81,8 @@ class CORE_EXPORT LocalFrameClientImpl final : public LocalFrameClient {
|
||||
@@ -123,10 +123,10 @@ index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e584
|
||||
int32_t world_id) override;
|
||||
|
||||
diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
|
||||
index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
|
||||
index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
|
||||
--- a/third_party/blink/renderer/core/loader/empty_clients.h
|
||||
+++ b/third_party/blink/renderer/core/loader/empty_clients.h
|
||||
@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
|
||||
@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
|
||||
|
||||
void DidCreateScriptContext(v8::Local<v8::Context>,
|
||||
int32_t world_id) override {}
|
||||
|
||||
@@ -7,12 +7,12 @@ Ensure that licenses for the dependencies introduced by Electron
|
||||
are included in `LICENSES.chromium.html`
|
||||
|
||||
diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
|
||||
index 514be069768cc1bbd39f2b261cefb1a9f267f89f..0a1ab64914cfaa087e4000fb81bfafd18aa1b98b 100755
|
||||
index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
|
||||
--- a/tools/licenses/licenses.py
|
||||
+++ b/tools/licenses/licenses.py
|
||||
@@ -357,6 +357,31 @@ SPECIAL_CASES = {
|
||||
@@ -337,6 +337,31 @@ SPECIAL_CASES = {
|
||||
"License": "Apache 2.0",
|
||||
"License File": ["//third_party/sample3/the_license"],
|
||||
"License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
|
||||
},
|
||||
+ os.path.join('third_party', 'electron_node'): {
|
||||
+ "Name": "Node.js",
|
||||
|
||||
@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
|
||||
https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
|
||||
|
||||
diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
|
||||
index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
|
||||
index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
|
||||
--- a/ui/base/clipboard/scoped_clipboard_writer.cc
|
||||
+++ b/ui/base/clipboard/scoped_clipboard_writer.cc
|
||||
@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
|
||||
@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
|
||||
}
|
||||
}
|
||||
|
||||
@@ -29,10 +29,10 @@ index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0
|
||||
objects_.clear();
|
||||
raw_objects_.clear();
|
||||
diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
|
||||
index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
|
||||
index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
|
||||
--- a/ui/base/clipboard/scoped_clipboard_writer.h
|
||||
+++ b/ui/base/clipboard/scoped_clipboard_writer.h
|
||||
@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
|
||||
@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
|
||||
// This is only used to write custom format data.
|
||||
void WriteData(std::u16string_view format, mojo_base::BigBuffer data);
|
||||
|
||||
|
||||
@@ -8,7 +8,7 @@ accessing Blink internals. Its inverse, which already exists, is used in
|
||||
Android WebView.
|
||||
|
||||
diff --git a/third_party/blink/public/web/web_message_port_converter.h b/third_party/blink/public/web/web_message_port_converter.h
|
||||
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211a29548aa 100644
|
||||
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e7521cb71b8 100644
|
||||
--- a/third_party/blink/public/web/web_message_port_converter.h
|
||||
+++ b/third_party/blink/public/web/web_message_port_converter.h
|
||||
@@ -13,6 +13,7 @@
|
||||
@@ -19,20 +19,18 @@ index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211
|
||||
} // namespace v8
|
||||
|
||||
namespace blink {
|
||||
@@ -25,6 +26,11 @@ class BLINK_EXPORT WebMessagePortConverter {
|
||||
@@ -25,6 +26,9 @@ class BLINK_EXPORT WebMessagePortConverter {
|
||||
// neutered, it will return nullopt.
|
||||
static std::optional<MessagePortChannel>
|
||||
DisentangleAndExtractMessagePortChannel(v8::Isolate*, v8::Local<v8::Value>);
|
||||
+
|
||||
+ BLINK_EXPORT static v8::Local<v8::Value>
|
||||
+ EntangleAndInjectMessagePortChannel(v8::Isolate*,
|
||||
+ v8::Local<v8::Context>,
|
||||
+ MessagePortChannel);
|
||||
+ EntangleAndInjectMessagePortChannel(v8::Local<v8::Context>, MessagePortChannel);
|
||||
};
|
||||
|
||||
} // namespace blink
|
||||
diff --git a/third_party/blink/renderer/core/exported/web_message_port_converter.cc b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
|
||||
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d84213eba 100644
|
||||
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef732225d6 100644
|
||||
--- a/third_party/blink/renderer/core/exported/web_message_port_converter.cc
|
||||
+++ b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
|
||||
@@ -6,6 +6,7 @@
|
||||
@@ -43,20 +41,19 @@ index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d
|
||||
#include "third_party/blink/renderer/bindings/core/v8/v8_message_port.h"
|
||||
#include "third_party/blink/renderer/core/messaging/message_port.h"
|
||||
|
||||
@@ -21,4 +22,16 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
|
||||
@@ -21,4 +22,15 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
|
||||
return port->Disentangle();
|
||||
}
|
||||
|
||||
+v8::Local<v8::Value>
|
||||
+WebMessagePortConverter::EntangleAndInjectMessagePortChannel(
|
||||
+ v8::Isolate* isolate,
|
||||
+ v8::Local<v8::Context> context,
|
||||
+ MessagePortChannel port_channel) {
|
||||
+ auto* execution_context = ToExecutionContext(context);
|
||||
+ CHECK(execution_context);
|
||||
+ auto* port = MakeGarbageCollected<MessagePort>(*execution_context);
|
||||
+ port->Entangle(std::move(port_channel));
|
||||
+ return port->ToV8(isolate, context->Global());
|
||||
+ return port->ToV8(context->GetIsolate(), context->Global());
|
||||
+}
|
||||
+
|
||||
} // namespace blink
|
||||
|
||||
@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
|
||||
WindowList.
|
||||
|
||||
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
|
||||
index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da2967073016 100644
|
||||
index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aabbba621cb 100644
|
||||
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
|
||||
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
|
||||
@@ -48,6 +48,7 @@
|
||||
@@ -19,9 +19,9 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
#include "content/public/browser/web_ui_data_source.h"
|
||||
+#include "electron/shell/browser/electron_browser_context.h"
|
||||
#include "ui/accessibility/accessibility_features.h"
|
||||
#include "ui/accessibility/ax_mode.h"
|
||||
#include "ui/accessibility/ax_updates_and_events.h"
|
||||
@@ -178,7 +179,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
|
||||
#include "ui/accessibility/platform/ax_platform.h"
|
||||
@@ -173,7 +174,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
|
||||
rvh->GetRoutingID(), accessibility_mode);
|
||||
}
|
||||
|
||||
@@ -30,7 +30,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
base::Value::Dict BuildTargetDescriptor(Browser* browser) {
|
||||
base::Value::Dict target_data;
|
||||
target_data.Set(kSessionIdField, browser->session_id().id());
|
||||
@@ -224,7 +225,7 @@ void HandleAccessibilityRequestCallback(
|
||||
@@ -197,7 +198,7 @@ void HandleAccessibilityRequestCallback(
|
||||
auto& browser_accessibility_state =
|
||||
*content::BrowserAccessibilityState::GetInstance();
|
||||
base::Value::Dict data;
|
||||
@@ -39,7 +39,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
ui::AXMode mode = browser_accessibility_state.GetAccessibilityMode();
|
||||
bool native = mode.has_mode(ui::AXMode::kNativeAPIs);
|
||||
bool web = mode.has_mode(ui::AXMode::kWebContents);
|
||||
@@ -285,7 +286,7 @@ void HandleAccessibilityRequestCallback(
|
||||
@@ -258,7 +259,7 @@ void HandleAccessibilityRequestCallback(
|
||||
data.Set(kIsScreenReaderActive, is_screen_reader_active);
|
||||
|
||||
std::string pref_api_type =
|
||||
@@ -48,7 +48,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
bool pref_api_type_supported = false;
|
||||
|
||||
std::vector<ui::AXApiType::Type> supported_api_types =
|
||||
@@ -353,11 +354,11 @@ void HandleAccessibilityRequestCallback(
|
||||
@@ -326,11 +327,11 @@ void HandleAccessibilityRequestCallback(
|
||||
data.Set(kPagesField, std::move(page_list));
|
||||
|
||||
base::Value::List browser_list;
|
||||
@@ -61,8 +61,8 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
+#endif
|
||||
data.Set(kBrowsersField, std::move(browser_list));
|
||||
|
||||
#if BUILDFLAG(IS_WIN)
|
||||
@@ -844,7 +845,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
|
||||
std::string json_string;
|
||||
@@ -804,7 +805,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
|
||||
const std::string value = CheckJSValue(data.FindString(kValueField));
|
||||
|
||||
if (string_name == kApiTypeField) {
|
||||
@@ -72,7 +72,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
pref->SetString(prefs::kShownAccessibilityApiType, value);
|
||||
}
|
||||
}
|
||||
@@ -898,7 +900,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
|
||||
@@ -858,7 +860,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
|
||||
AXPropertyFilter::ALLOW_EMPTY);
|
||||
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
|
||||
|
||||
@@ -82,7 +82,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
ui::AXApiType::Type api_type =
|
||||
ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
|
||||
std::string accessibility_contents =
|
||||
@@ -925,6 +928,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
@@ -885,6 +888,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
AXPropertyFilter::ALLOW_EMPTY);
|
||||
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
|
||||
|
||||
@@ -90,7 +90,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
for (Browser* browser : *BrowserList::GetInstance()) {
|
||||
if (browser->session_id().id() == session_id) {
|
||||
base::Value::Dict result = BuildTargetDescriptor(browser);
|
||||
@@ -937,6 +941,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
@@ -897,6 +901,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
return;
|
||||
}
|
||||
}
|
||||
@@ -98,7 +98,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
#endif // !BUILDFLAG(IS_ANDROID)
|
||||
// No browser with the specified |session_id| was found.
|
||||
base::Value::Dict result;
|
||||
@@ -980,11 +985,13 @@ void AccessibilityUIMessageHandler::StopRecording(
|
||||
@@ -940,11 +945,13 @@ void AccessibilityUIMessageHandler::StopRecording(
|
||||
}
|
||||
|
||||
ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
|
||||
@@ -115,7 +115,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
// Check to see if it is in the supported types list.
|
||||
if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
|
||||
supported_types.end()) {
|
||||
@@ -1054,10 +1061,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
|
||||
@@ -1014,8 +1021,11 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
|
||||
// static
|
||||
void AccessibilityUIMessageHandler::RegisterProfilePrefs(
|
||||
user_prefs::PrefRegistrySyncable* registry) {
|
||||
@@ -127,13 +127,11 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
|
||||
+ registry->RegisterBooleanPref(prefs::kShowInternalAccessibilityTree, false);
|
||||
+#endif
|
||||
}
|
||||
|
||||
void AccessibilityUIMessageHandler::OnVisibilityChanged(
|
||||
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.h b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
|
||||
index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83c1d1fa0a 100644
|
||||
index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7f1648148 100644
|
||||
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.h
|
||||
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
|
||||
@@ -28,6 +28,8 @@ namespace content {
|
||||
@@ -27,6 +27,8 @@ namespace content {
|
||||
class WebContents;
|
||||
} // namespace content
|
||||
|
||||
@@ -142,7 +140,7 @@ index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83
|
||||
namespace user_prefs {
|
||||
class PrefRegistrySyncable;
|
||||
} // namespace user_prefs
|
||||
@@ -79,6 +81,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler,
|
||||
@@ -77,6 +79,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler {
|
||||
static void RegisterProfilePrefs(user_prefs::PrefRegistrySyncable* registry);
|
||||
|
||||
private:
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user