fix: pdf download functionality

https://chromium-review.googlesource.com/c/chromium/src/+/6682424

.github/actions/build-electron/action.yml

@@ -60,28 +60,14 @@ runs:
           sudo launchctl limit maxfiles 65536 200000
         fi
 
-        if [ "${{ inputs.is-release }}" = "true" ]; then
-          NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
-        else
-          NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
-        fi
+        NINJA_SUMMARIZE_BUILD=1 e build
         cp out/Default/.ninja_log out/electron_ninja_log
         node electron/script/check-symlinks.js
-
-        # Upload build stats to Datadog
-        if ! [ -z $DD_API_KEY ]; then
-          if [ "$TARGET_PLATFORM" = "win" ]; then
-            npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
-          else
-            npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
-          fi
-        else
-          echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
-        fi
-    - name: Verify dist.zip ${{ inputs.step-suffix }}
+    - name: Build Electron dist.zip ${{ inputs.step-suffix }}
       shell: bash
       run: |
-        cd src        
+        cd src
+        e build --target electron:electron_dist_zip
         if [ "${{ inputs.is-asan }}" != "true" ]; then
           target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
           if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -89,10 +75,11 @@ runs:
           fi
           electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
         fi
-    - name: Fixup Mksnapshot ${{ inputs.step-suffix }}
+    - name: Build Mksnapshot ${{ inputs.step-suffix }}
       shell: bash
       run: |
         cd src
+        e build --target electron:electron_mksnapshot
         ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
         # Remove unused args from mksnapshot_args
         SEDOPTION="-i"
@@ -102,6 +89,7 @@ runs:
         sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
         sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
 
+        e build --target electron:electron_mksnapshot_zip
         if [ "${{ inputs.target-platform }}" = "win" ]; then
           cd out/Default
           powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -135,6 +123,7 @@ runs:
       shell: bash
       run: |
         cd src
+        e build --target electron:electron_chromedriver
         e build --target electron:electron_chromedriver_zip
 
         if [ "${{ inputs.is-asan }}" != "true" ]; then
@@ -144,6 +133,11 @@ runs:
           fi
           electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
         fi
+    - name: Build Node.js headers ${{ inputs.step-suffix }}
+      shell: bash
+      run: |
+        cd src
+        e build --target electron:node_headers
     - name: Create installed_software.json ${{ inputs.step-suffix }}
       shell: powershell
       if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -163,11 +157,17 @@ runs:
         # Needed for msdia140.dll on 64-bit windows
         cd src
         export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
-    - name: Zip Symbols ${{ inputs.step-suffix }}
+    - name: Generate & Zip Symbols ${{ inputs.step-suffix }}
       shell: bash
       run: |
+        # Generate breakpad symbols on release builds
+        if [ "${{ inputs.generate-symbols }}" = "true" ]; then
+          e build --target electron:electron_symbols
+        fi
         cd src
         export BUILD_PATH="$(pwd)/out/Default"
+        e build --target electron:licenses
+        e build --target electron:electron_version_file
         if [ "${{ inputs.is-release }}" = "true" ]; then
           DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
         else
@@ -180,6 +180,18 @@ runs:
         cd src
         gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
         e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
+    - name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
+      shell: bash
+      if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
+      run: |
+        e build --target electron:hunspell_dictionaries_zip
+    - name: Generate Libcxx ${{ inputs.step-suffix }}
+      shell: bash
+      if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
+      run: |
+        e build --target electron:libcxx_headers_zip
+        e build --target electron:libcxxabi_headers_zip
+        e build --target electron:libcxx_objects_zip
     - name: Remove Clang problem matcher
       shell: bash
       run: echo "::remove-matcher owner=clang::"

.github/actions/checkout/action.yml

@@ -172,6 +172,7 @@ runs:
     run: |
       rm -rf src/android_webview
       rm -rf src/ios/chrome
+      rm -rf src/third_party/blink/web_tests
       rm -rf src/third_party/blink/perf_tests
       rm -rf src/chrome/test/data/xr/webvr_info
       rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

.github/actions/free-space-macos/action.yml

@@ -17,30 +17,28 @@ runs:
         }
 
         strip_universal_deep() {
-          if [ -d "$1" ]; then
-            opwd=$(pwd)
-            cd $1
-            f=$(find . -perm +111 -type f)
-            for fp in $f
-            do
-              if [[ $(file "$fp") == *"universal binary"* ]]; then
-                if [ "`arch`" == "arm64" ]; then
-                  if [[ $(file "$fp") == *"x86_64"* ]]; then
-                    sudo lipo -remove x86_64 "$fp" -o "$fp" || true
-                  fi
-                else
-                  if [[ $(file "$fp") == *"arm64e)"* ]]; then
-                    sudo lipo -remove arm64e "$fp" -o "$fp" || true
-                  fi
-                  if [[ $(file "$fp") == *"arm64)"* ]]; then
-                    sudo lipo -remove arm64 "$fp" -o "$fp" || true
-                  fi
+          opwd=$(pwd)
+          cd $1
+          f=$(find . -perm +111 -type f)
+          for fp in $f
+          do
+            if [[ $(file "$fp") == *"universal binary"* ]]; then
+              if [ "`arch`" == "arm64" ]; then
+                if [[ $(file "$fp") == *"x86_64"* ]]; then
+                  sudo lipo -remove x86_64 "$fp" -o "$fp" || true
+                fi
+              else
+                if [[ $(file "$fp") == *"arm64e)"* ]]; then
+                  sudo lipo -remove arm64e "$fp" -o "$fp" || true
+                fi
+                if [[ $(file "$fp") == *"arm64)"* ]]; then
+                  sudo lipo -remove arm64 "$fp" -o "$fp" || true
                 fi
               fi
-            done
+            fi
+          done
 
-            cd $opwd
-          fi
+          cd $opwd
         }
 
         tmpify /Library/Developer/CoreSimulator
@@ -62,9 +60,10 @@ runs:
 
         sudo rm -rf /Applications/Safari.app
         sudo rm -rf /Applications/Xcode_16.1.app
-        sudo rm -rf /Applications/Xcode_16.2.app
         sudo rm -rf /Applications/Xcode_16.3.app
+        sudo rm -rf /Applications/Xcode_16.2.app
         sudo rm -rf /Applications/Google Chrome.app
+        sudo rm -rf /Applications/Xcode_16.4.app
         sudo rm -rf /Applications/Google Chrome for Testing.app
         sudo rm -rf	/Applications/Firefox.app
         sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data

.github/actions/install-build-tools/action.yml

@@ -15,7 +15,7 @@ runs:
         git config --global core.preloadindex true
         git config --global core.longpaths true
       fi
-      export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
+      export BUILD_TOOLS_SHA=c13f4bdb50e65da46a4703f8f882079dd21fd99e
       npm i -g @electron/build-tools
       # Update depot_tools to ensure python
       e d update_depot_tools

.github/workflows/archaeologist-dig.yml

@@ -9,11 +9,11 @@ jobs:
     runs-on: ubuntu-latest
     steps:
       - name: Checkout Electron
-        uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+        uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
         with:
           fetch-depth: 0
       - name: Setup Node.js/npm
-        uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
+        uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
         with:
           node-version: 20.19.x
       - name: Setting Up Dig Site

.github/workflows/audit-branch-ci.yml

@@ -16,11 +16,11 @@ jobs:
       contents: read
     steps:
       - name: Setup Node.js
-        uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
+        uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444 # v5.0.0
         with:
           node-version: 22.17.x
       - run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
-      - uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
+      - uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
         id: audit-errors
         with:
           github-token: ${{ secrets.GITHUB_TOKEN }}
@@ -73,7 +73,6 @@ jobs:
                       annotation_level === "failure" &&
                       !message.startsWith("Process completed with exit code") &&
                       !message.startsWith("Response status code does not indicate success") &&
-                      !message.startsWith("The hosted runner lost communication with the server") &&
                       !/Unable to make request/.test(message) &&
                       !/The requested URL returned error/.test(message),
                   )

.github/workflows/branch-created.yml

@@ -75,7 +75,7 @@ jobs:
           org: electron
       - name: Generate Release Project Board Metadata
         if: ${{ steps.check-major-version.outputs.MAJOR }}
-        uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
+        uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
         id: generate-project-metadata
         with:
           script: |

.github/workflows/build-git-cache.yml

@@ -19,7 +19,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -41,7 +41,7 @@ jobs:
       TARGET_OS: 'win'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -64,7 +64,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/build.yml

@@ -54,7 +54,7 @@ jobs:
         build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
         docs-only: ${{ steps.set-output.outputs.docs-only }}
     steps:
-    - uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+    - uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
       with:
         ref: ${{ github.event.pull_request.head.sha }}
     - uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -111,7 +111,7 @@ jobs:
       build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -141,7 +141,7 @@ jobs:
       build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -171,7 +171,7 @@ jobs:
       build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -189,7 +189,7 @@ jobs:
     with:
       target-platform: macos
       target-archs: x64 arm64
-      check-runs-on: macos-15
+      check-runs-on: macos-14
       gn-build-type: testing
     secrets: inherit
 
@@ -225,7 +225,7 @@ jobs:
     uses: ./.github/workflows/pipeline-electron-build-and-test.yml
     needs: checkout-macos
     with:
-      build-runs-on: macos-15-xlarge
+      build-runs-on: macos-14-xlarge
       test-runs-on: macos-15-large
       target-platform: macos
       target-arch: x64
@@ -244,7 +244,7 @@ jobs:
     uses: ./.github/workflows/pipeline-electron-build-and-test.yml
     needs: checkout-macos
     with:
-      build-runs-on: macos-15-xlarge
+      build-runs-on: macos-14-xlarge
       test-runs-on: macos-15
       target-platform: macos
       target-arch: arm64

.github/workflows/issue-opened.yml

@@ -37,7 +37,7 @@ jobs:
           org: electron
       - run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
       - name: Add labels
-        uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
+        uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
         id: add-labels
         env:
           ISSUE_BODY: ${{ github.event.issue.body }}

.github/workflows/linux-publish.yml

@@ -31,7 +31,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/macos-publish.yml

@@ -32,7 +32,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -47,7 +47,7 @@ jobs:
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-15-xlarge
+      build-runs-on: macos-14-xlarge
       target-platform: macos
       target-arch: x64
       target-variant: darwin
@@ -62,7 +62,7 @@ jobs:
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-15-xlarge
+      build-runs-on: macos-14-xlarge
       target-platform: macos
       target-arch: x64
       target-variant: mas
@@ -77,7 +77,7 @@ jobs:
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-15-xlarge
+      build-runs-on: macos-14-xlarge
       target-platform: macos
       target-arch: arm64
       target-variant: darwin
@@ -92,7 +92,7 @@ jobs:
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-15-xlarge
+      build-runs-on: macos-14-xlarge
       target-platform: macos
       target-arch: arm64
       target-variant: mas

.github/workflows/pipeline-electron-docs-only.yml

@@ -23,7 +23,7 @@ jobs:
     container: ${{ fromJSON(inputs.container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -39,7 +39,7 @@ jobs:
       with:
         target-platform: linux
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pipeline-electron-lint.yml

@@ -23,7 +23,7 @@ jobs:
     container: ${{ fromJSON(inputs.container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pipeline-segment-electron-build.yml

@@ -66,7 +66,6 @@ concurrency:
 env:
   CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
   CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
-  DD_API_KEY: ${{ secrets.DD_API_KEY }}
   ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
   ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
   SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
@@ -85,13 +84,12 @@ jobs:
     environment: ${{ inputs.environment }}
     env:
       TARGET_ARCH: ${{ inputs.target-arch }}
-      TARGET_PLATFORM: ${{ inputs.target-platform }}
     steps:
     - name: Create src dir
       run: |
         mkdir src
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -115,7 +113,7 @@ jobs:
       run: df -h
     - name: Setup Node.js/npm
       if: ${{ inputs.target-platform == 'macos' }}
-      uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
+      uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
       with:
         node-version: 20.19.x
         cache: yarn
@@ -159,7 +157,7 @@ jobs:
       if: ${{ inputs.target-platform == 'linux' }}
       uses: ./src/electron/.github/actions/restore-cache-aks
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pipeline-segment-electron-gn-check.yml

@@ -44,7 +44,7 @@ jobs:
     container: ${{ fromJSON(inputs.check-container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -111,7 +111,7 @@ jobs:
     - name: Add CHROMIUM_BUILDTOOLS_PATH to env
       run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pipeline-segment-electron-test.yml

@@ -68,10 +68,9 @@ jobs:
       if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
       run: |
         cp $(which node) /mnt/runner-externals/node20/bin/
-        cp $(which node) /mnt/runner-externals/node24/bin/
     - name: Setup Node.js/npm
       if: ${{ inputs.target-platform == 'win' }}
-      uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
+      uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
       with:
         node-version: 20.19.x
     - name: Add TCC permissions on macOS
@@ -111,6 +110,11 @@ jobs:
             configure_sys_tccdb "$values"
           fi
         done
+
+        # Ref: https://github.com/getsentry/sentry-cocoa/blob/main/scripts/ci-enable-permissions.sh
+        if [ "$OSTYPE" = "darwin24" ]; then
+          defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
+        fi
     - name: Turn off the unexpectedly quit dialog on macOS
       if: ${{ inputs.target-platform == 'macos' }}
       run: defaults write com.apple.CrashReporter DialogType server
@@ -118,17 +122,11 @@ jobs:
       if: ${{ inputs.target-platform == 'macos' }}
       run: sudo xcode-select --switch /Applications/Xcode_16.4.app
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
         ref: ${{ github.event.pull_request.head.sha }}
-    - name: Turn off screenshot nag on macOS
-      if: ${{ inputs.target-platform == 'macos' }}
-      run: |
-        defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
-        src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
-        src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
     - name: Setup SSH Debugging
       if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
       uses: ./src/electron/.github/actions/ssh-debug
@@ -178,18 +176,22 @@ jobs:
         path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
     - name: Restore Generated Artifacts
       run: ./src/electron/script/actions/restore-artifacts.sh
-    - name: Unzip Dist (win)
+    - name: Unzip Dist, Mksnapshot & Chromedriver (win)
       if: ${{ inputs.target-platform == 'win' }}
       shell: powershell
       run: |
         Set-ExecutionPolicy Bypass -Scope Process -Force
         cd src/out/Default
         Expand-Archive -Force dist.zip -DestinationPath ./
-    - name: Unzip Dist (unix)
+        Expand-Archive -Force chromedriver.zip -DestinationPath ./
+        Expand-Archive -Force mksnapshot.zip -DestinationPath ./
+    - name: Unzip Dist, Mksnapshot & Chromedriver (unix)
       if: ${{ inputs.target-platform != 'win' }}
       run: |
         cd src/out/Default
         unzip -:o dist.zip
+        unzip -:o chromedriver.zip
+        unzip -:o mksnapshot.zip
     #- name: Import & Trust Self-Signed Codesigning Cert on MacOS
     #  if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
     #  run: |
@@ -225,7 +227,7 @@ jobs:
               export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
             fi
           fi
-          node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
+          node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
         else
           chown :builduser .. && chmod g+w ..
           chown -R :builduser . && chmod -R g+w .

.github/workflows/pipeline-segment-node-nan-test.yml

@@ -46,7 +46,7 @@ jobs:
     container: ${{ fromJSON(inputs.test-container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0
@@ -100,7 +100,7 @@ jobs:
     container: ${{ fromJSON(inputs.test-container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pull-request-labeled.yml

@@ -19,10 +19,7 @@ jobs:
           webhook-type: webhook-trigger
           payload: |
             {
-              "base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
-              "title": ${{ toJSON(github.event.pull_request.title) }},
-              "url": ${{ toJSON(github.event.pull_request.html_url) }},
-              "user": ${{ toJSON(github.event.pull_request.user.login) }}
+              "url": "${{ github.event.pull_request.html_url }}"
             }
   pull-request-labeled-deprecation-review-complete:
     name: deprecation-review/complete label added

.github/workflows/scorecards.yml

@@ -22,13 +22,13 @@ jobs:
 
     steps:
       - name: "Checkout code"
-        uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
+        uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
         with:
           persist-credentials: false
 
       # This is a pre-submit / pre-release.
       - name: "Run analysis"
-        uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
+        uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
         with:
           results_file: results.sarif
           results_format: sarif
@@ -50,6 +50,6 @@ jobs:
 
       # Upload the results to GitHub's code scanning dashboard.
       - name: "Upload to code-scanning"
-        uses: github/codeql-action/upload-sarif@16140ae1a102900babc80a33c44059580f687047 # v3.29.5
+        uses: github/codeql-action/upload-sarif@f1f6e5f6af878fb37288ce1c627459e94dbf7d01 # v3.29.5
         with:
           sarif_file: results.sarif

.github/workflows/stale.yml

@@ -16,7 +16,7 @@ jobs:
         id: generate-token
         with:
           creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
-      - uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
+      - uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
         with:
           repo-token: ${{ steps.generate-token.outputs.token }}
           days-before-stale: 90
@@ -27,7 +27,7 @@ jobs:
             This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
           close-issue-message: >
             This issue has been closed due to inactivity, and will not be monitored.  If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
-          exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
+          exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
           only-pr-labels: not-a-real-label
   pending-repro:
     runs-on: ubuntu-latest
@@ -39,7 +39,7 @@ jobs:
         id: generate-token
         with:
           creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
-      - uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
+      - uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
         with:
           repo-token: ${{ steps.generate-token.outputs.token }}
           days-before-stale: -1

.github/workflows/windows-publish.yml

@@ -36,7 +36,7 @@ jobs:
       build-image-sha: ${{ inputs.build-image-sha }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
+      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
       with:
         path: src/electron
         fetch-depth: 0

.nvmrc

@@ -1 +1 @@
-22
+20

BUILD.gn

@@ -586,11 +586,6 @@ source_set("electron_lib") {
   }
 
   if (is_mac) {
-    # Disable C++ modules to resolve linking error when including MacOS SDK
-    # headers from third_party/electron_node/deps/uv/include/uv/darwin.h
-    # TODO(samuelmaddock): consider revisiting this in the future
-    use_libcxx_modules = false
-
     deps += [
       "//components/remote_cocoa/app_shim",
       "//components/remote_cocoa/browser",
@@ -1624,29 +1619,6 @@ group("node_headers") {
   public_deps = [ ":tar_node_headers" ]
 }
 
-group("testing_build") {
-  public_deps = [
-    ":electron_dist_zip",
-    ":electron_mksnapshot_zip",
-    ":node_headers",
-  ]
-}
-
-group("release_build") {
-  public_deps = [ ":testing_build" ]
-  if (is_official_build) {
-    public_deps += [ ":electron_symbols" ]
-  }
-  if (is_linux) {
-    public_deps += [
-      ":hunspell_dictionaries_zip",
-      ":libcxx_headers_zip",
-      ":libcxx_objects_zip",
-      ":libcxxabi_headers_zip",
-    ]
-  }
-}
-
 if (is_linux && is_official_build) {
   strip_binary("strip_electron_binary") {
     binary_input = "$root_out_dir/$electron_project_name"

DEPS

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
 
 vars = {
   'chromium_version':
-    '143.0.7485.0',
+    '141.0.7390.7',
   'node_version':
-    'v22.20.0',
+    'v22.19.0',
   'nan_version':
-    '675cefebca42410733da8a454c8d9391fcebfbc2',
+    'e14bdcd1f72d62bca1d541b66da43130384ec213',
   'squirrel.mac_version':
     '0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
   'reactiveobjc_version':

README.md

@@ -39,7 +39,7 @@ Each Electron release provides binaries for macOS, Windows, and Linux.
 
 * macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
 * Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
-* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
+* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
   * Ubuntu 18.04 and newer
   * Fedora 32 and newer
   * Debian 10 and newer

SECURITY.md

@@ -8,12 +8,6 @@ The Electron team will send a response indicating the next steps in handling you
 
 Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
 
-## Escalation
-
-If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
-
-If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
-
 ## The Electron Security Notification Process
 
 For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

build/args/all.gn

@@ -19,15 +19,15 @@ proprietary_codecs = true
 
 enable_printing = true
 
-# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
-# CI is using MacOS 15.5 which doesn't have the required modulemaps.
-use_clang_modules = false
-
 # Removes DLLs from the build, which are only meant to be used for Chromium development.
 # See https://github.com/electron/electron/pull/17985
 angle_enable_vulkan_validation_layers = false
 dawn_enable_vulkan_validation_layers = false
 
+# Removes dxc dll's that are only used experimentally.
+# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
+dawn_use_built_dxc = false
+
 # These are disabled because they cause the zip manifest to differ between
 # testing and release builds.
 # See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.
@@ -72,6 +72,3 @@ enterprise_cloud_content_analysis = false
 
 # We don't use anything from here, and it causes target collisions
 enable_linux_installer = false
-
-# Disable "Save to Drive" feature in PDF viewer
-enable_pdf_save_to_drive = false

docs/api/app.md

@@ -421,7 +421,6 @@ Returns:
     * `oom` - Process ran out of memory
     * `launch-failed` - Process never successfully launched
     * `integrity-failure` - Windows code integrity checks failed
-    * `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
   * `exitCode` number - The exit code for the process
       (e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
   * `serviceName` string (optional) - The non-localized name of the process.
@@ -1398,75 +1397,7 @@ details. Disabled by default.
 This API must be called after the `ready` event is emitted.
 
 > [!NOTE]
-> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
-
-### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
-
-Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
-
-* `nativeAPIs` - Native OS accessibility APIs integration enabled.
-* `webContents` - Web contents accessibility tree exposure enabled.
-* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
-* `extendedProperties` - Extended accessibility properties enabled.
-* `screenReader` - Screen reader specific mode enabled.
-* `html` - HTML accessibility tree construction enabled.
-* `labelImages` - Accessibility support for automatic image annotations.
-* `pdfPrinting` - Accessibility support for PDF printing enabled.
-
-Notes:
-
-* The array may be empty if no accessibility modes are active.
-* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
-  prefer this method for granular diagnostics or telemetry.
-
-Example:
-
-```js
-const { app } = require('electron')
-
-app.whenReady().then(() => {
-  if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
-    // Change some app UI to better work with Screen Readers.
-  }
-})
-```
-
-### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
-
-* `features` string[] - An array of the accessibility features to enable.
-
-Possible values are:
-
-* `nativeAPIs` - Native OS accessibility APIs integration enabled.
-* `webContents` - Web contents accessibility tree exposure enabled.
-* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
-* `extendedProperties` - Extended accessibility properties enabled.
-* `screenReader` - Screen reader specific mode enabled.
-* `html` - HTML accessibility tree construction enabled.
-* `labelImages` - Accessibility support for automatic image annotations.
-* `pdfPrinting` - Accessibility support for PDF printing enabled.
-
-To disable all supported features, pass an empty array `[]`.
-
-Example:
-
-```js
-const { app } = require('electron')
-
-app.whenReady().then(() => {
-  // Enable a subset of features:
-  app.setAccessibilitySupportFeatures([
-    'screenReader',
-    'pdfPrinting',
-    'webContents'
-  ])
-
-  // Other logic
-
-  // Some time later, disable all features:
-  app.setAccessibilitySupportFeatures([])
-})
-```
+> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
 
 ### `app.showAboutPanel()`
 

docs/api/base-window.md

@@ -1262,16 +1262,15 @@ Sets the properties for the window's taskbar button.
 
 #### `win.setAccentColor(accentColor)` _Windows_
 
-* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
+* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
 
 Sets the system accent color and highlighting of active window border.
 
 The `accentColor` parameter accepts the following values:
 
-* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
-* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
-* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
-* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
+* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
+* **`true`** - Uses the system's default accent color from user preferences in System Settings.
+* **`false`** - Explicitly disables accent color highlighting for the window.
 
 Examples:
 
@@ -1284,14 +1283,11 @@ win.setAccentColor('#ff0000')
 // RGB format (alpha ignored if present).
 win.setAccentColor('rgba(255,0,0,0.5)')
 
-// Enable accent color, using the color specified in System Settings.
+// Use system accent color.
 win.setAccentColor(true)
 
 // Disable accent color.
 win.setAccentColor(false)
-
-// Reset window accent color behavior to follow behavior set in System Settings.
-win.setAccentColor(null)
 ```
 
 #### `win.getAccentColor()` _Windows_

docs/api/browser-window.md

@@ -1442,16 +1442,15 @@ Sets the properties for the window's taskbar button.
 
 #### `win.setAccentColor(accentColor)` _Windows_
 
-* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
+* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
 
 Sets the system accent color and highlighting of active window border.
 
 The `accentColor` parameter accepts the following values:
 
-* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
-* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
-* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
-* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
+* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
+* **`true`** - Uses the system's default accent color from user preferences in System Settings.
+* **`false`** - Explicitly disables accent color highlighting for the window.
 
 Examples:
 
@@ -1464,14 +1463,11 @@ win.setAccentColor('#ff0000')
 // RGB format (alpha ignored if present).
 win.setAccentColor('rgba(255,0,0,0.5)')
 
-// Enable accent color, using the color specified in System Settings.
+// Use system accent color.
 win.setAccentColor(true)
 
 // Disable accent color.
 win.setAccentColor(false)
-
-// Reset window accent color behavior to follow behavior set in System Settings.
-win.setAccentColor(null)
 ```
 
 #### `win.getAccentColor()` _Windows_
@@ -1574,18 +1570,11 @@ events.
 
 Prevents the window contents from being captured by other apps.
 
-On Windows, it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
+On macOS it sets the NSWindow's [`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc) to [`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
+On Windows it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
 For Windows 10 version 2004 and up the window will be removed from capture entirely,
 older Windows versions behave as if `WDA_MONITOR` is applied capturing a black window.
 
-On macOS, it sets the `NSWindow`'s
-[`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc)
-to
-[`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
-Unfortunately, due to an intentional change in macOS, newer Mac applications that use
-`ScreenCaptureKit` will capture your window despite `win.setContentProtection(true)`.
-See [here](https://github.com/electron/electron/issues/48258#issuecomment-3269893618).
-
 #### `win.isContentProtected()` _macOS_ _Windows_
 
 Returns `boolean` - whether or not content protection is currently enabled.

docs/api/clipboard.md

@@ -4,12 +4,6 @@
 
 Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
 
-> [!IMPORTANT]
-> If you want to call this API from a renderer process with context isolation enabled,
-> place the API call in your preload script and
-> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
-> [`contextBridge`](context-bridge.md) API.
-
 On Linux, there is also a `selection` clipboard. To manipulate it
 you need to pass `selection` to each method:
 

docs/api/command-line-switches.md

@@ -193,11 +193,6 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
 Forces renderer process and Chromium helper processes to run un-sandboxed.
 Should only be used for testing.
 
-### --no-stdio-init
-
-Disable stdio initialization during node initialization.
-Used to avoid node initialization crash when the nul device is disabled on Windows platform.
-
 ### --proxy-bypass-list=`hosts`
 
 Instructs Electron to bypass the proxy server for the given semi-colon-separated

docs/api/crash-reporter.md

@@ -4,12 +4,6 @@
 
 Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
 
-> [!IMPORTANT]
-> If you want to call this API from a renderer process with context isolation enabled,
-> place the API call in your preload script and
-> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
-> [`contextBridge`](context-bridge.md) API.
-
 The following is an example of setting up Electron to automatically submit
 crash reports to a remote server:
 

docs/api/environment-variables.md

@@ -186,3 +186,14 @@ the one downloaded by `npm install`. Usage:
 ```sh
 export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
 ```
+
+## Set By Electron
+
+Electron sets some variables in your environment at runtime.
+
+### `ORIGINAL_XDG_CURRENT_DESKTOP`
+
+This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
+originally launched with.  Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
+to affect other logic within Chromium so if you want access to the _original_ value
+you should look up this environment variable instead.

docs/api/ipc-renderer.md

@@ -20,12 +20,6 @@ changes:
 
 Process: [Renderer](../glossary.md#renderer-process)
 
-> [!IMPORTANT]
-> If you want to call this API from a renderer process with context isolation enabled,
-> place the API call in your preload script and
-> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
-> [`contextBridge`](context-bridge.md) API.
-
 The `ipcRenderer` module is an  [EventEmitter][event-emitter]. It provides a few
 methods so you can send synchronous and asynchronous messages from the render
 process (web page) to the main process. You can also receive replies from the

docs/api/native-image.md

@@ -4,12 +4,6 @@
 
 Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
 
-> [!IMPORTANT]
-> If you want to call this API from a renderer process with context isolation enabled,
-> place the API call in your preload script and
-> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
-> [`contextBridge`](context-bridge.md) API.
-
 The `nativeImage` module provides a unified interface for manipulating
 system images. These can be handy if you want to provide multiple scaled
 versions of the same icon or take advantage of macOS [template images][template-image].

docs/api/structures/offscreen-shared-texture.md

@@ -2,10 +2,7 @@
 
 * `textureInfo` Object - The shared texture info.
   * `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
-  * `pixelFormat` string - The pixel format of the texture.
-    * `rgba` - The texture format is 8-bit unorm RGBA.
-    * `bgra` - The texture format is 8-bit unorm BGRA.
-    * `rgbaf16` - The texture format is 16-bit float RGBA.
+  * `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
   * `codedSize` [Size](size.md) - The full dimensions of the video frame.
   * `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
   * `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.

docs/api/structures/render-process-gone-details.md

@@ -8,7 +8,6 @@
   * `oom` - Process ran out of memory
   * `launch-failed` - Process never successfully launched
   * `integrity-failure` - Windows code integrity checks failed
-  * `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
 * `exitCode` Integer - The exit code of the process, unless `reason` is
   `launch-failed`, in which case `exitCode` will be a platform-specific
   launch failure error code.

docs/api/structures/web-preferences.md

@@ -87,11 +87,6 @@
      paint event. Defaults to `false`. See the
     [offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
     more details.
-  * `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
-    The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
-    The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
-    * `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
-    * `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
 * `contextIsolation` boolean (optional) - Whether to run Electron APIs and
   the specified `preload` script in a separate JavaScript context. Defaults
   to `true`. The context that the `preload` script runs in will only have

docs/api/system-preferences.md

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
 
 The `systemPreferences` object emits the following events:
 
-### Event: 'accent-color-changed' _Windows_ _Linux_
+### Event: 'accent-color-changed' _Windows_
 
 Returns:
 
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
 Removes the `key` in `NSUserDefaults`. This can be used to restore the default
 or global value of a `key` previously set with `setUserDefault`.
 
-### `systemPreferences.getAccentColor()`
+### `systemPreferences.getAccentColor()` _Windows_ _macOS_
 
 Returns `string` - The users current system wide accent color preference in RGBA
 hexadecimal form.

docs/api/web-frame.md

@@ -4,12 +4,6 @@
 
 Process: [Renderer](../glossary.md#renderer-process)
 
-> [!IMPORTANT]
-> If you want to call this API from a renderer process with context isolation enabled,
-> place the API call in your preload script and
-> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
-> [`contextBridge`](context-bridge.md) API.
-
 `webFrame` export of the Electron module is an instance of the `WebFrame`
 class representing the current frame. Sub-frames can be retrieved by
 certain properties and methods (e.g. `webFrame.firstChild`).
@@ -145,7 +139,7 @@ by its key, which is returned from `webFrame.insertCSS(css)`.
 
 Inserts `text` to the focused element.
 
-### `webFrame.executeJavaScript(code[, userGesture][, callback])`
+### `webFrame.executeJavaScript(code[, userGesture, callback])`
 
 * `code` string
 * `userGesture` boolean (optional) - Default is `false`.
@@ -166,7 +160,7 @@ In the browser window some HTML APIs like `requestFullScreen` can only be
 invoked by a gesture from the user. Setting `userGesture` to `true` will remove
 this limitation.
 
-### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture][, callback])`
+### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture, callback])`
 
 * `worldId` Integer - The ID of the world to run the javascript
             in, `0` is the default main world (where content runs), `999` is the

docs/api/web-utils.md

@@ -4,12 +4,6 @@
 
 Process: [Renderer](../glossary.md#renderer-process)
 
-> [!IMPORTANT]
-> If you want to call this API from a renderer process with context isolation enabled,
-> place the API call in your preload script and
-> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
-> [`contextBridge`](context-bridge.md) API.
-
 ## Methods
 
 The `webUtils` module has the following methods:
@@ -23,27 +17,11 @@ Returns `string` - The file system path that this `File` object points to. In th
 This method superseded the previous augmentation to the `File` object with the `path` property.  An example is included below.
 
 ```js @ts-nocheck
-// Before (renderer)
-const oldPath = document.querySelector('input[type=file]').files[0].path
-```
+// Before
+const oldPath = document.querySelector('input').files[0].path
 
-```js @ts-nocheck
 // After
+const { webUtils } = require('electron')
 
-// Renderer:
-
-const file = document.querySelector('input[type=file]').files[0]
-electronApi.doSomethingWithFile(file)
-
-// Preload script:
-
-const { contextBridge, webUtils } = require('electron')
-
-contextBridge.exposeInMainWorld('electronApi', {
-  doSomethingWithFile (file) {
-    const path = webUtils.getPathForFile(file)
-    // Do something with the path, e.g., send it over IPC to the main process.
-    // It's best not to expose the full file path to the web content if possible.
-  }
-})
+const newPath = webUtils.getPathForFile(document.querySelector('input').files[0])
 ```

docs/api/window-open.md

@@ -39,8 +39,8 @@ consider using `webContents.setWindowOpenHandler` to customize the
 BrowserWindow creation.
 
 A subset of [`WebPreferences`](structures/web-preferences.md) can be set directly,
-unnested, from the features string: `zoomFactor`, `nodeIntegration`, `javascript`,
-`contextIsolation`, and `webviewTag`.
+unnested, from the features string: `zoomFactor`, `nodeIntegration`, `preload`,
+`javascript`, `contextIsolation`, and `webviewTag`.
 
 For example:
 

docs/breaking-changes.md

@@ -47,15 +47,9 @@ See [here](https://www.electronjs.org/docs/latest/api/structures/offscreen-share
 
 ### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
 
-The default value of the `--ozone-platform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
+The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
 
-Electron now defaults to running as a native Wayland app when launched in a Wayland session (when `XDG_SESSION_TYPE=wayland`).
-Users can force XWayland by passing `--ozone-platform=x11`.
-
-### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
-
-Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
-in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overriden and now reflects the actual desktop environment.
+You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
 
 ### Removed: macOS 11 support
 

docs/faq.md

@@ -12,28 +12,19 @@ network problems. The best resolution is to try switching networks, or
 wait a bit and try installing again.
 
 You can also attempt to download Electron directly from
-[GitHub Releases](https://github.com/electron/electron/releases)
+[electron/electron/releases](https://github.com/electron/electron/releases)
 if installing via `npm` is failing.
 
-If you need to install Electron through a custom mirror or proxy, see
-the [Advanced Installation](./tutorial/installation.md) documentation for more details.
+## When will Electron upgrade to latest Chrome?
 
-## How are Electron binaries downloaded?
+The Chrome version of Electron is usually bumped within one or two weeks after
+a new stable Chrome version gets released. This estimate is not guaranteed and
+depends on the amount of work involved with upgrading.
 
-When you run `npm install electron`, the Electron binary for the corresponding version is downloaded
-into your project's `node_modules` folder via npm's `postinstall` lifecycle script.
+Only the stable channel of Chrome is used. If an important fix is in beta or dev
+channel, we will back-port it.
 
-This logic is handled by the [`@electron/get`](https://github.com/electron/get) utility package
-under the hood.
-
-## When will Electron upgrade to latest Chromium?
-
-Every new major version of Electron releases with a Chromium major version upgrade. By releasing every
-8 weeks, Electron is able to pull in every other major Chromium release on the very same day that it
-releases upstream. Security fixes will be backported to stable release channels ahead of time.
-
-See the [Electron Releases](./tutorial/electron-timelines.md) documentation for more details or
-[releases.electronjs.org](https://releases.electronjs.org) to see our Release Status dashboard.
+For more information, please see the [security introduction](tutorial/security.md).
 
 ## When will Electron upgrade to latest Node.js?
 

docs/glossary.md

@@ -12,15 +12,6 @@ The ASAR format was created primarily to improve performance on Windows when
 reading large quantities of small files (e.g. when loading your app's JavaScript
 dependency tree from `node_modules`).
 
-### ASAR integrity
-
-ASAR integrity is an security feature that validates the contents of your app's
-ASAR archives at runtime. When enabled, your Electron app will verify the
-header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
-hashes, the app will forcefully terminate.
-
-See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
-
 ### code signing
 
 Code signing is a process where an app developer digitally signs their code to

docs/tutorial/asar-integrity.md

@@ -5,7 +5,7 @@ slug: asar-integrity
 hide_title: false
 ---
 
-ASAR integrity is a security feature that validates the contents of your app's
+ASAR integrity is an experimental feature that validates the contents of your app's
 [ASAR archives](./asar-archives.md) at runtime.
 
 ## Version support
@@ -64,10 +64,13 @@ flipFuses(
 )
 ```
 
-> [!TIP]
-> With Electron Forge, you can configure your app's fuses with
-> [@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
-> in your Forge configuration file.
+:::tip Fuses in Electron Forge
+
+With Electron Forge, you can configure your app's fuses with
+[@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
+in your Forge configuration file.
+
+:::
 
 ## Providing the header hash
 
@@ -77,7 +80,7 @@ on package time. The process of providing this packaged hash is different for ma
 ### Using Electron tooling
 
 Electron Forge and Electron Packager do this setup automatically for you with no additional
-configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
+configuration. The minimum required versions for ASAR integrity are:
 
 * `@electron/packager@18.3.1`
 * `@electron/forge@7.4.0`
@@ -106,7 +109,7 @@ Valid `algorithm` values are currently `SHA256` only. The `hash` is a hash of th
 The `@electron/asar` package exposes a `getRawHeader` method whose result can then be hashed to generate this value
 (e.g. using the [`node:crypto`](https://nodejs.org/api/crypto.html) module).
 
-#### Windows
+### Windows
 
 When packaging for Windows, you must populate a valid [resource](https://learn.microsoft.com/en-us/windows/win32/menurc/resources)
 entry of type `Integrity` and name `ElectronAsar`. The value of this resource should be a JSON encoded dictionary
@@ -122,6 +125,9 @@ in the form included below:
 ]
 ```
 
-> [!NOTE]
-> For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
-> in the Electron Packager code.
+:::info
+
+For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
+in the Electron Packager code.
+
+:::

docs/tutorial/code-signing.md

@@ -233,10 +233,10 @@ can find [its documentation here](https://www.electron.build/code-signing).
 [Azure Trusted Signing][] is Microsoft's modern cloud-based alternative to EV certificates.
 It is the cheapest option for code signing on Windows, and it gets rid of SmartScreen warnings.
 
-As of October 2025, Azure Trusted Signing is available to US and Canada-based organizations
-with 3+ years of verifiable business history and to individual developers in the US and Canada.
-Microsoft is looking to make the program more widely available. If you're reading this at a
-later point, it could make sense to check if the eligibility criteria have changed.
+As of May 2025, Azure Trusted Signing is [available][trusted-signing-availability] to US and
+Canada-based organizations with 3+ years of verifiable business history. Microsoft is looking
+to make the program more widely available. If you're reading this at a later point, it could
+make sense to check if the eligibility criteria have changed.
 
 #### Using Electron Forge
 
@@ -267,5 +267,6 @@ See the [Windows Store Guide][].
 [maker-squirrel]: https://www.electronforge.io/config/makers/squirrel.windows
 [maker-msi]: https://www.electronforge.io/config/makers/wix-msi
 [azure trusted signing]: https://azure.microsoft.com/en-us/products/trusted-signing
+[trusted-signing-availability]: https://techcommunity.microsoft.com/blog/microsoft-security-blog/trusted-signing-public-preview-update/4399713
 [forge-trusted-signing]: https://www.electronforge.io/guides/code-signing/code-signing-windows#using-azure-trusted-signing
 [builder-trusted-signing]: https://www.electron.build/code-signing-win#using-azure-trusted-signing-beta

docs/tutorial/esm.md

@@ -32,7 +32,7 @@ This table gives a general overview of where ESM is supported and which ESM load
 | Main                 | Node.js    | N/A                   | <ul><li> [You must use `await` generously before the app's `ready` event](#you-must-use-await-generously-before-the-apps-ready-event) </li></ul> |
 | Renderer (Sandboxed) | Chromium   | Unsupported           | <ul><li> [Sandboxed preload scripts can't use ESM imports](#sandboxed-preload-scripts-cant-use-esm-imports) </li></ul> |
 | Renderer (Unsandboxed & Context Isolated) | Chromium | Node.js | <ul><li> [Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content) </li> <li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
-| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
+| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li><li>[ESM preload scripts must be context isolated to use dynamic Node.js ESM imports](#esm-preload-scripts-must-be-context-isolated-to-use-dynamic-nodejs-esm-imports)</li></ul> |
 
 ## Main process
 

docs/tutorial/fuses.md

@@ -4,24 +4,11 @@
 
 ## What are fuses?
 
-From a security perspective, it makes sense to disable certain unused Electron features
-that are powerful but may make your app's security posture weaker. For example, any app that doesn't
-use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
-subset of "living off the land" attacks.
+For a subset of Electron functionality it makes sense to disable certain features for an entire application.  For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature.  We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
 
-We also don't want Electron consumers forking to achieve this goal, as building from source and
-maintaining a fork is a massive technical challenge and costs a lot of time and money.
+Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions.  Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
 
-Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
-that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
-
-Because they are flipped at package time before you code sign your app, the OS becomes responsible
-for ensuring those bits aren't flipped back via OS-level code signing validation
-(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
-[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
-on Windows).
-
-## Current fuses
+## Current Fuses
 
 ### `runAsNode`
 
@@ -29,11 +16,7 @@ on Windows).
 
 **@electron/fuses:** `FuseV1Options.RunAsNode`
 
-The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
-environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
-as expected, as it depends on this environment variable to function. Instead, we recommend that you
-use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
-standalone Node.js process (e.g. a SQLite server process).
+The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not.  Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
 
 ### `cookieEncryption`
 
@@ -41,12 +24,7 @@ standalone Node.js process (e.g. a SQLite server process).
 
 **@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
 
-The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
-cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
-values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
-does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
-fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
-later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
+The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys.  By default the sqlite database that Chromium uses to store cookies stores the values in plaintext.  If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse.  Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless.  Most apps can safely enable this fuse.
 
 ### `nodeOptions`
 
@@ -54,11 +32,7 @@ later will make your cookie store corrupt and useless. Most apps can safely enab
 
 **@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
 
-The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
-and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
-environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
-kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
-Most apps can safely disable this fuse.
+The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)  and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected.  The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production.  Most apps can safely disable this fuse.
 
 ### `nodeCliInspect`
 
@@ -66,9 +40,7 @@ Most apps can safely disable this fuse.
 
 **@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
 
-The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
-or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
-inspector. Most apps can safely disable this fuse.
+The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not.  When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector.  Most apps can safely disable this fuse.
 
 ### `embeddedAsarIntegrityValidation`
 
@@ -76,12 +48,9 @@ inspector. Most apps can safely disable this fuse.
 
 **@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
 
-The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
-content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
-performance impact but may marginally slow down file reads from inside the `app.asar` archive.
-Most apps can safely enable this fuse.
+The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded.  This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
 
-For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
+For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
 
 ### `onlyLoadAppFromAsar`
 
@@ -89,15 +58,7 @@ For more information on how to use ASAR integrity validation, please read the [A
 
 **@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
 
-The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
-By default, Electron will search for this code in the following order:
-
-1. `app.asar`
-1. `app`
-1. `default_app.asar`
-
-When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
-it is impossible to load non-validated code.
+The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code.  By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`.  When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
 
 ### `loadBrowserProcessSpecificV8Snapshot`
 
@@ -105,17 +66,11 @@ it is impossible to load non-validated code.
 
 **@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
 
-V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
-initialized heaps and then load them back in to avoid the cost of initializing the heap.
+The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process.  By default Electron's processes will all use the same V8 snapshot file.  When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
 
-The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
-process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
-enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
-Other processes will use the V8 snapshot file that they normally do.
+V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
 
-Using separate snapshots for renderer processes and the main process can improve security, especially
-to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
-See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
+Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
 
 ### `grantFileProtocolExtraPrivileges`
 
@@ -123,25 +78,19 @@ See [electron/electron#35170](https://github.com/electron/electron/issues/35170)
 
 **@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
 
-The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
-are given privileges beyond what they would receive in a traditional web browser. This behavior was
-core to Electron apps in original versions of Electron, but is no longer required as apps should be
-[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
-
-If you aren't serving pages from `file://`, you should disable this fuse.
+The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser.  This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.  If you aren't serving pages from `file://` you should disable this fuse.
 
 The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
 
 * `file://` protocol pages can use `fetch` to load other assets over `file://`
 * `file://` protocol pages can use service workers
-* `file://` protocol pages have universal access granted to child frames also running on `file://`
-  protocols regardless of sandbox settings
+* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
 
-## How do I flip fuses?
+## How do I flip the fuses?
 
 ### The easy way
 
-[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
+We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy.  Check out the README of that module for more details on usage and potential error cases.
 
 ```js @ts-nocheck
 const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -157,37 +106,29 @@ flipFuses(
 )
 ```
 
-You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
-app using the `@electron/fuses` CLI.
+You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
 
 ```bash
 npx @electron/fuses read --app /Applications/Foo.app
 ```
 
->[!NOTE]
-> If you are using Electron Forge to distribute your application, you can flip fuses using
-> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
-> which comes pre-installed with all templates.
-
 ### The hard way
 
-> [!IMPORTANT]
-> Glossary:
->
-> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
-> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
-> * **Fuse Schema**: The format/allowed values for the fuse wire
+#### Quick Glossary
 
-Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
-sequence of bytes that represent the state of the fuses you want.
+* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
+* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
+* **Fuse Schema**: The format / allowed values for the fuse wire
 
-Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
+Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
+
+Somewhere in the Electron binary there will be a sequence of bytes that look like this:
 
 ```text
 | ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
 ```
 
-* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
+* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
 * `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
 * `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
 * `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -195,6 +136,6 @@ Somewhere in the Electron binary, there will be a sequence of bytes that look li
   * "1" (0x31) indicates the fuse is enabled
   * "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
 
-To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
+To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
 
 You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

docs/tutorial/installation.md

@@ -26,12 +26,12 @@ any dependencies in your app will not be installed.
 
 ## Customization
 
-If you want to change the architecture that is downloaded (e.g., `x64` on an
-`arm64` machine), you can use the `--arch` flag with npm install or set the
+If you want to change the architecture that is downloaded (e.g., `ia32` on an
+`x64` machine), you can use the `--arch` flag with npm install or set the
 `npm_config_arch` environment variable:
 
 ```shell
-npm install --arch=x64 electron
+npm install --arch=ia32 electron
 ```
 
 In addition to changing the architecture, you can also specify the platform
@@ -60,7 +60,7 @@ where `$VERSION` is the exact version of Electron).
 If you are unable to access GitHub or you need to provide a custom build, you
 can do so by either providing a mirror or an existing cache directory.
 
-### Mirror
+#### Mirror
 
 You can use environment variables to override the base URL, the path at which to
 look for Electron binaries, and the binary filename. The URL used by `@electron/get`
@@ -95,7 +95,7 @@ Electron release you may have to set `electron_use_remote_checksums=1` directly,
 or configure it in a `.npmrc` file, to force Electron to use the remote `SHASUMS256.txt`
 file to verify the checksum instead of the embedded checksums.
 
-### Cache
+#### Cache
 
 Alternatively, you can override the local cache. `@electron/get` will cache
 downloaded binaries in a local directory to not stress your network. You can use
@@ -120,7 +120,7 @@ The cache contains the version's official zip file as well as a checksum, and is
 │   └── electron-v15.3.1-darwin-x64.zip
 ```
 
-## Postinstall script
+## Skip binary download
 
 Under the hood, Electron's JavaScript API binds to a binary that contains its
 implementations. Because this binary is crucial to the function of any Electron app,

docs/tutorial/security.md

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
 You should at least follow these steps to improve the security of your application:
 
 1. [Only load secure content](#1-only-load-secure-content)
-2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
+2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
 3. [Enable context isolation in all renderers](#3-enable-context-isolation)
 4. [Enable process sandboxing](#4-enable-process-sandboxing)
 5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -804,10 +804,10 @@ that your application might have the rights for.
 
 #### How?
 
-[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
+We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
 flipping these fuses easy. Check out the README of that module for more details on usage and
 potential error cases, and refer to
-[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
+[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
 
 ### 20. Do not expose Electron APIs to untrusted web content
 

docs/tutorial/tutorial-2-first-app.md

@@ -55,27 +55,14 @@ There are a few rules to follow for the purposes of this tutorial:
 - _author_, _license_, and _description_ can be any value, but will be necessary for
   [packaging][packaging] later on.
 
-:::caution Install dependencies with a regular `node_modules` folder
-
-Electron's packaging toolchain requires the `node_modules` folder to be physically on disk in the
-way that npm installs Node dependencies. By default, [Yarn Berry](https://yarnpkg.com/) and
-[pnpm](http://pnpm.io/) both use alternative installation strategies.
-
-Therefore, you must set [`nodeLinker: node-modules`](https://yarnpkg.com/configuration/yarnrc#nodeLinker)
-in Yarn or [`nodeLinker: hoisted`](https://pnpm.io/settings#nodelinker) in pnpm if you are using
-those package managers.
-
-:::
-
 Then, install Electron into your app's **devDependencies**, which is the list of external
 development-only package dependencies not required in production.
 
-:::info Why is Electron a dev dependency?
+:::info Why is Electron a devDependency?
 
-This may seem counter-intuitive since your production code is running Electron APIs. Under the hood,
-Electron's JavaScript API binds to a binary that contains its implementations. The packaging step for
-Electron handles the bundling of this binary, eliminating the need to specify it as a production
-dependency.
+This may seem counter-intuitive since your production code is running Electron APIs.
+However, packaged apps will come bundled with the Electron binary, eliminating the need to specify
+it as a production dependency.
 
 :::
 
@@ -83,17 +70,6 @@ dependency.
 npm install electron --save-dev
 ```
 
-:::warning
-
-In order to correctly install Electron, you need to ensure that its `postinstall` lifecycle
-script is able to run. This means avoiding the `--ignore-scripts` flag on npm and allowlisting
-`electron` to run build scripts on other package managers.
-
-This is likely to change in a future version of Electron. See
-[electron/rfcs#22](https://github.com/electron/rfcs/pull/22) for more details.
-
-:::
-
 Your package.json file should look something like this after initializing your package
 and installing Electron. You should also now have a `node_modules` folder containing
 the Electron executable, as well as a `package-lock.json` lockfile that specifies

filenames.gni

@@ -629,6 +629,8 @@ filenames = {
     "shell/common/gin_converters/usb_device_info_converter.h",
     "shell/common/gin_converters/value_converter.cc",
     "shell/common/gin_converters/value_converter.h",
+    "shell/common/gin_helper/arguments.cc",
+    "shell/common/gin_helper/arguments.h",
     "shell/common/gin_helper/callback.cc",
     "shell/common/gin_helper/callback.h",
     "shell/common/gin_helper/cleaned_up_at_exit.cc",

filenames.libcxx.gni

@@ -217,7 +217,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__atomic/check_memory_order.h",
   "//third_party/libc++/src/include/__atomic/contention_t.h",
   "//third_party/libc++/src/include/__atomic/fence.h",
-  "//third_party/libc++/src/include/__atomic/floating_point_helper.h",
   "//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
   "//third_party/libc++/src/include/__atomic/kill_dependency.h",
   "//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -1366,6 +1365,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__tree",
   "//third_party/libc++/src/include/__tuple/find_index.h",
   "//third_party/libc++/src/include/__tuple/ignore.h",
+  "//third_party/libc++/src/include/__tuple/make_tuple_types.h",
   "//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
   "//third_party/libc++/src/include/__tuple/tuple_element.h",
   "//third_party/libc++/src/include/__tuple/tuple_like.h",
@@ -1426,7 +1426,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__type_traits/is_floating_point.h",
   "//third_party/libc++/src/include/__type_traits/is_function.h",
   "//third_party/libc++/src/include/__type_traits/is_fundamental.h",
-  "//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
   "//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
   "//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
   "//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1469,7 +1468,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
   "//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
   "//third_party/libc++/src/include/__type_traits/make_signed.h",
-  "//third_party/libc++/src/include/__type_traits/make_transparent.h",
   "//third_party/libc++/src/include/__type_traits/make_unsigned.h",
   "//third_party/libc++/src/include/__type_traits/maybe_const.h",
   "//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1501,7 +1499,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__utility/cmp.h",
   "//third_party/libc++/src/include/__utility/convert_to_integral.h",
   "//third_party/libc++/src/include/__utility/declval.h",
-  "//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
   "//third_party/libc++/src/include/__utility/element_count.h",
   "//third_party/libc++/src/include/__utility/empty.h",
   "//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1512,7 +1509,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__utility/integer_sequence.h",
   "//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
   "//third_party/libc++/src/include/__utility/is_valid_range.h",
-  "//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
   "//third_party/libc++/src/include/__utility/move.h",
   "//third_party/libc++/src/include/__utility/no_destroy.h",
   "//third_party/libc++/src/include/__utility/pair.h",

lib/browser/init.ts

@@ -162,6 +162,27 @@ require('@electron/internal/browser/api/web-contents-view');
 // Set main startup script of the app.
 const mainStartupScript = packageJson.main || 'index.js';
 
+const KNOWN_XDG_DESKTOP_VALUES = new Set(['Pantheon', 'Unity:Unity7', 'pop:GNOME']);
+
+function currentPlatformSupportsAppIndicator () {
+  if (process.platform !== 'linux') return false;
+  const currentDesktop = process.env.XDG_CURRENT_DESKTOP;
+
+  if (!currentDesktop) return false;
+  if (KNOWN_XDG_DESKTOP_VALUES.has(currentDesktop)) return true;
+  // ubuntu based or derived session (default ubuntu one, communitheme…) supports
+  // indicator too.
+  if (/ubuntu/ig.test(currentDesktop)) return true;
+
+  return false;
+}
+
+// Workaround for electron/electron#5050 and electron/electron#9046
+process.env.ORIGINAL_XDG_CURRENT_DESKTOP = process.env.XDG_CURRENT_DESKTOP;
+if (currentPlatformSupportsAppIndicator()) {
+  process.env.XDG_CURRENT_DESKTOP = 'Unity';
+}
+
 // Quit when all windows are closed and no other one is listening to this.
 app.on('window-all-closed', () => {
   if (app.listenerCount('window-all-closed') === 1) {

npm/cli.js

@@ -5,9 +5,7 @@ const proc = require('child_process');
 const electron = require('./');
 
 const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
-let childClosed = false;
 child.on('close', function (code, signal) {
-  childClosed = true;
   if (code === null) {
     console.error(electron, 'exited with signal', signal);
     process.exit(1);
@@ -17,7 +15,7 @@ child.on('close', function (code, signal) {
 
 const handleTerminationSignal = function (signal) {
   process.on(signal, function signalHandler () {
-    if (!childClosed) {
+    if (!child.killed) {
       child.kill(signal);
     }
   });
@@ -25,4 +23,3 @@ const handleTerminationSignal = function (signal) {
 
 handleTerminationSignal('SIGINT');
 handleTerminationSignal('SIGTERM');
-handleTerminationSignal('SIGUSR2');

package.json

@@ -10,7 +10,7 @@
     "@electron/fiddle-core": "^1.3.4",
     "@electron/github-app-auth": "^2.2.1",
     "@electron/lint-roller": "^3.1.2",
-    "@electron/typescript-definitions": "^9.1.5",
+    "@electron/typescript-definitions": "^9.1.2",
     "@octokit/rest": "^20.1.2",
     "@primer/octicons": "^10.0.0",
     "@types/minimist": "^1.2.5",
@@ -20,7 +20,6 @@
     "@types/temp": "^0.9.4",
     "@typescript-eslint/eslint-plugin": "^8.32.1",
     "@typescript-eslint/parser": "^8.7.0",
-    "@xmldom/xmldom": "^0.8.11",
     "buffer": "^6.0.3",
     "chalk": "^4.1.0",
     "check-for-leaks": "^1.2.1",

patches/boringssl/expose_ripemd160.patch

@@ -22,7 +22,7 @@ index 345c94f6e26e88aac77b9feb92bd8d6665234981..8ef2ab8987da63f321d1dbb79f2eded8
      // hash function when given a signature OID. To avoid unintended lax parsing
      // of hash OIDs, this is no longer supported for lookup by OID or NID.
 diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
-index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
+index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
 --- a/crypto/fipsmodule/digest/digests.cc.inc
 +++ b/crypto/fipsmodule/digest/digests.cc.inc
 @@ -18,6 +18,7 @@

patches/boringssl/revert_track_ssl_error_zero_return_explicitly.patch

@@ -20,10 +20,10 @@ index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a0212
  
      case ssl_open_record_error:
 diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
-index bbe428f20af5e67cf1335c7f1e42516638234af2..507f85f983bdc4a8c654dd10caf38a42634f5026 100644
+index 24c0d496f9d655f0f32634430e9c31d5592be939..b62418ba31927c5c4e2b424b993e40c63c868201 100644
 --- a/ssl/ssl_lib.cc
 +++ b/ssl/ssl_lib.cc
-@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
+@@ -1207,7 +1207,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
    }
  
    if (ret_code == 0) {
@@ -32,7 +32,7 @@ index bbe428f20af5e67cf1335c7f1e42516638234af2..507f85f983bdc4a8c654dd10caf38a42
        return SSL_ERROR_ZERO_RETURN;
      }
      // An EOF was observed which violates the protocol, and the underlying
-@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
+@@ -2568,13 +2568,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
    return CRYPTO_get_ex_data(&ctx->ex_data, idx);
  }
  

patches/chromium/.patches

@@ -110,6 +110,7 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
 fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
 refactor_expose_file_system_access_blocklist.patch
 feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
+fix_font_face_resolution_when_renderer_is_blocked.patch
 feat_enable_passing_exit_code_on_service_process_crash.patch
 chore_remove_reference_to_chrome_browser_themes.patch
 feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
@@ -131,6 +132,7 @@ chore_grandfather_in_electron_views_and_delegates.patch
 refactor_patch_electron_permissiontypes_into_blink.patch
 revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
 build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
+build_set_mac_sdk_minimum_to_10.patch
 fix_add_macos_memory_query_fallback_to_avoid_crash.patch
 fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
 feat_add_support_for_embedder_snapshot_validation.patch
@@ -138,8 +140,3 @@ chore_restore_some_deprecated_wrapper_utility_in_gin.patch
 chore_add_electron_objects_to_wrappablepointertag.patch
 chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
 revert_partial_remove_unused_prehandlemouseevent.patch
-allow_electron_to_depend_on_components_os_crypt_sync.patch
-expose_referrerscriptinfo_hostdefinedoptionsindex.patch
-chore_disable_protocol_handler_dcheck.patch
-fix_check_for_file_existence_before_setting_mtime.patch
-revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

patches/chromium/accelerator.patch

@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
    }
  
 diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
-index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
+index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
 --- a/ui/base/accelerators/accelerator.h
 +++ b/ui/base/accelerators/accelerator.h
-@@ -21,6 +21,7 @@
+@@ -18,6 +18,7 @@
+ #include <vector>
+ 
+ #include "base/component_export.h"
++#include "third_party/abseil-cpp/absl/types/optional.h"
  #include "base/time/time.h"
  #include "build/blink_buildflags.h"
  #include "build/build_config.h"
-+#include "third_party/abseil-cpp/absl/types/optional.h"
- #include "ui/events/event_constants.h"
- #include "ui/events/keycodes/keyboard_codes.h"
- 
-@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
-               << 18);  // masked to 6 bits
+@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
+     return interrupted_by_mouse_event_;
    }
  
 +  absl::optional<char16_t> shifted_char;

patches/chromium/add_contentgpuclient_precreatemessageloop_callback.patch

@@ -10,7 +10,7 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
 This should be upstreamed.
 
 diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
-index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
+index 558575cf06b10b59e114a9f53b90f01d8ecf63c4..0204ce5351a5190a20317f0cef6d3e8421541cac 100644
 --- a/content/gpu/gpu_main.cc
 +++ b/content/gpu/gpu_main.cc
 @@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {

patches/chromium/add_didinstallconditionalfeatures.patch

@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
 context, which can cause some preload scripts to trip.
 
 diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
-index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
+index 284da783658bec333be748941784d43b13f6f244..18714ce8fc27c8d56c5deac27ba335078c452d0a 100644
 --- a/content/public/renderer/render_frame_observer.h
 +++ b/content/public/renderer/render_frame_observer.h
-@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
+@@ -139,6 +139,8 @@ class CONTENT_EXPORT RenderFrameObserver {
    virtual void DidHandleOnloadEvents() {}
    virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
                                        int32_t world_id) {}
@@ -23,10 +23,10 @@ index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b
                                          int32_t world_id) {}
    virtual void DidClearWindowObject() {}
 diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
-index 792ecdf43c810d19641251d3f5eeddccc4c621e9..99d368046177dd92c8b36743f461d348bbf19a2e 100644
+index bc2ec7491d7072be77307d7b8af06e5397e2bdfb..addef4de8a95f47964a895e1d1cc4763f565a028 100644
 --- a/content/renderer/render_frame_impl.cc
 +++ b/content/renderer/render_frame_impl.cc
-@@ -4723,6 +4723,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
+@@ -4679,6 +4679,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
      observer.DidCreateScriptContext(context, world_id);
  }
  
@@ -40,10 +40,10 @@ index 792ecdf43c810d19641251d3f5eeddccc4c621e9..99d368046177dd92c8b36743f461d348
                                                 int world_id) {
    for (auto& observer : observers_)
 diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
-index ce1d8807d624b35fa63ef83e3a95c7cba8f1f22f..61d4ef338cc4c0e99c144d6d95bbe0adba9d3556 100644
+index 2950a6f600aab24226ef59acabddc74c9b67cac8..f0f4335aa815ea50dbf9b720b41e4eb31f27fb90 100644
 --- a/content/renderer/render_frame_impl.h
 +++ b/content/renderer/render_frame_impl.h
-@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
+@@ -602,6 +602,8 @@ class CONTENT_EXPORT RenderFrameImpl
    void DidObserveLayoutShift(double score, bool after_input_or_scroll) override;
    void DidCreateScriptContext(v8::Local<v8::Context> context,
                                int world_id) override;
@@ -53,10 +53,10 @@ index ce1d8807d624b35fa63ef83e3a95c7cba8f1f22f..61d4ef338cc4c0e99c144d6d95bbe0ad
                                  int world_id) override;
    void DidChangeScrollOffset() override;
 diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
-index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
+index 101e727b3a97bc764315eb694dc3975f9a408f9c..52e8828d8fffaba8ab05436cb4d727595f18238a 100644
 --- a/third_party/blink/public/web/web_local_frame_client.h
 +++ b/third_party/blink/public/web/web_local_frame_client.h
-@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
+@@ -661,6 +661,9 @@ class BLINK_EXPORT WebLocalFrameClient {
    virtual void DidCreateScriptContext(v8::Local<v8::Context>,
                                        int32_t world_id) {}
  
@@ -123,10 +123,10 @@ index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e584
                                  int32_t world_id) override;
  
 diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
-index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
+index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
 --- a/third_party/blink/renderer/core/loader/empty_clients.h
 +++ b/third_party/blink/renderer/core/loader/empty_clients.h
-@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
+@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
  
    void DidCreateScriptContext(v8::Local<v8::Context>,
                                int32_t world_id) override {}

patches/chromium/add_electron_deps_to_license_credits_file.patch

@@ -7,10 +7,10 @@ Ensure that licenses for the dependencies introduced by Electron
 are included in `LICENSES.chromium.html`
 
 diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
-index f5bfe41e67b5f9a34db16377528e7fae58f642ab..58d0af6a561a9d309a5a49894786ea382149c034 100755
+index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
 --- a/tools/licenses/licenses.py
 +++ b/tools/licenses/licenses.py
-@@ -342,6 +342,31 @@ SPECIAL_CASES = {
+@@ -337,6 +337,31 @@ SPECIAL_CASES = {
          "License": "Apache 2.0",
          "License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
      },

patches/chromium/add_ui_scopedcliboardwriter_writeunsaferawdata.patch

@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
 https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
 
 diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
-index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
+index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
 --- a/ui/base/clipboard/scoped_clipboard_writer.cc
 +++ b/ui/base/clipboard/scoped_clipboard_writer.cc
-@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
+@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
    }
  }
  
@@ -29,10 +29,10 @@ index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0
    objects_.clear();
    raw_objects_.clear();
 diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
-index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
+index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
 --- a/ui/base/clipboard/scoped_clipboard_writer.h
 +++ b/ui/base/clipboard/scoped_clipboard_writer.h
-@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
+@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
    // This is only used to write custom format data.
    void WriteData(std::u16string_view format, mojo_base::BigBuffer data);
  

patches/chromium/adjust_accessibility_ui_for_electron.patch

@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
 WindowList.
 
 diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
-index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da2967073016 100644
+index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b235308986a8c 100644
 --- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
 +++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
 @@ -48,6 +48,7 @@
@@ -62,7 +62,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
    data.Set(kBrowsersField, std::move(browser_list));
  
  #if BUILDFLAG(IS_WIN)
-@@ -844,7 +845,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
+@@ -845,7 +846,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
    const std::string value = CheckJSValue(data.FindString(kValueField));
  
    if (string_name == kApiTypeField) {
@@ -72,7 +72,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
      pref->SetString(prefs::kShownAccessibilityApiType, value);
    }
  }
-@@ -898,7 +900,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
+@@ -899,7 +901,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
                       AXPropertyFilter::ALLOW_EMPTY);
    AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
  
@@ -82,7 +82,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
    ui::AXApiType::Type api_type =
        ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
    std::string accessibility_contents =
-@@ -925,6 +928,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
+@@ -926,6 +929,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
                       AXPropertyFilter::ALLOW_EMPTY);
    AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
  
@@ -90,7 +90,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
    for (Browser* browser : *BrowserList::GetInstance()) {
      if (browser->session_id().id() == session_id) {
        base::Value::Dict result = BuildTargetDescriptor(browser);
-@@ -937,6 +941,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
+@@ -938,6 +942,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
        return;
      }
    }
@@ -98,7 +98,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
  #endif  // !BUILDFLAG(IS_ANDROID)
    // No browser with the specified |session_id| was found.
    base::Value::Dict result;
-@@ -980,11 +985,13 @@ void AccessibilityUIMessageHandler::StopRecording(
+@@ -981,11 +986,13 @@ void AccessibilityUIMessageHandler::StopRecording(
  }
  
  ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
@@ -115,7 +115,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
    // Check to see if it is in the supported types list.
    if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
        supported_types.end()) {
-@@ -1054,10 +1061,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
+@@ -1055,10 +1062,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
  // static
  void AccessibilityUIMessageHandler::RegisterProfilePrefs(
      user_prefs::PrefRegistrySyncable* registry) {

patches/chromium/allow_disabling_blink_scheduler_throttling_per_renderview.patch

@@ -6,11 +6,11 @@ Subject: allow disabling blink scheduler throttling per RenderView
 This allows us to disable throttling for hidden windows.
 
 diff --git a/content/browser/renderer_host/navigation_controller_impl_unittest.cc b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
-index 74b39146bbb8151a66ecb4f138f769fffc2525b2..a54948fa36c85c5c5dd04b9836951b1ce1279038 100644
+index 1d002528ba2b90d9c361c77ab00aeb1ccd000177..77f3b011f9c3710ac93ad20a92eafea0d35bb9a7 100644
 --- a/content/browser/renderer_host/navigation_controller_impl_unittest.cc
 +++ b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
-@@ -173,6 +173,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
-               (bool supports_draggable_regions),
+@@ -168,6 +168,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
+               (const std::optional<uint64_t> canvas_noise_token),
                (override));
  
 +  MOCK_METHOD(
@@ -23,10 +23,10 @@ index 74b39146bbb8151a66ecb4f138f769fffc2525b2..a54948fa36c85c5c5dd04b9836951b1c
      return receiver_.BindNewEndpointAndPassDedicatedRemote();
    }
 diff --git a/content/browser/renderer_host/render_view_host_impl.cc b/content/browser/renderer_host/render_view_host_impl.cc
-index 270750b9180a8ddab4f3cd2508fd398e07bf6377..20b2ae081a3710443ec919f1487dfbfe8f15de11 100644
+index ac7638da0c0b360d21b88e4e458d3687949884fa..45d2fe002330cb4aa7c81defaa5004d5e62e369a 100644
 --- a/content/browser/renderer_host/render_view_host_impl.cc
 +++ b/content/browser/renderer_host/render_view_host_impl.cc
-@@ -785,6 +785,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
+@@ -786,6 +786,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
    GetWidget()->GetAssociatedFrameWidget()->SetBackgroundOpaque(opaque);
  }
  
@@ -51,25 +51,25 @@ index 7944fe64e0da112fc670358b75506bb199bb5e4a..0e3c16c6af2a078943e9f39808134ab2
    void SendRendererPreferencesToRenderer(
        const blink::RendererPreferences& preferences);
 diff --git a/content/browser/renderer_host/render_widget_host_view_aura.cc b/content/browser/renderer_host/render_widget_host_view_aura.cc
-index d97cbb4fd8e12bcbff19bf8cc8378997110c60c0..1041d25d5ef78abdcf7b85fe8457ec2a20e2a759 100644
+index e98d74fecf4275ef8e7c6d23e5ea5ec3af80b926..0927d69b56d064327f0659d8ffe6ceff98064947 100644
 --- a/content/browser/renderer_host/render_widget_host_view_aura.cc
 +++ b/content/browser/renderer_host/render_widget_host_view_aura.cc
-@@ -632,8 +632,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
+@@ -579,8 +579,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
    // OnShowWithPageVisibility will not call NotifyHostAndDelegateOnWasShown,
    // which updates `visibility_`, unless the host is hidden. Make sure no update
    // is needed.
--  CHECK(host_->IsHidden() || visibility_ == Visibility::VISIBLE);
+-  CHECK(host_->is_hidden() || visibility_ == Visibility::VISIBLE);
 -  OnShowWithPageVisibility(page_visibility);
-+  if (host_->IsHidden() || visibility_ == Visibility::VISIBLE)
++  if (host_->is_hidden() || visibility_ == Visibility::VISIBLE)
 +    OnShowWithPageVisibility(page_visibility);
  }
  
  void RenderWidgetHostViewAura::EnsurePlatformVisibility(
 diff --git a/content/public/browser/render_view_host.h b/content/public/browser/render_view_host.h
-index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060f0a640b1 100644
+index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb19389b72203b 100644
 --- a/content/public/browser/render_view_host.h
 +++ b/content/public/browser/render_view_host.h
-@@ -73,6 +73,9 @@ class CONTENT_EXPORT RenderViewHost {
+@@ -75,6 +75,9 @@ class CONTENT_EXPORT RenderViewHost {
    virtual void WriteIntoTrace(
        perfetto::TracedProto<TraceProto> context) const = 0;
  
@@ -80,34 +80,34 @@ index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060
    // This interface should only be implemented inside content.
    friend class RenderViewHostImpl;
 diff --git a/content/test/test_page_broadcast.h b/content/test/test_page_broadcast.h
-index 8762811ec25069ddd0c57e3ffb50d158532a39b1..f5cdae891cc3b98371ae18dbc119b5e7f379f2bf 100644
+index 0dc1cd52dec74ede2117eb244e423d7f3ad322ea..352c64b3aec50546451a0033114e3a35dcf32136 100644
 --- a/content/test/test_page_broadcast.h
 +++ b/content/test/test_page_broadcast.h
-@@ -54,6 +54,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
+@@ -53,6 +53,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
+       const blink::ColorProviderColorMaps& color_provider_colors) override;
    void UpdateCanvasNoiseToken(
-       std::optional<blink::NoiseToken> canvas_noise_token) override;
-   void SetSupportsDraggableRegions(bool supports_draggable_regions) override;
+       std::optional<uint64_t> canvas_noise_token) override;
 +  void SetSchedulerThrottling(bool allowed) override {}
  
    mojo::AssociatedReceiver<blink::mojom::PageBroadcast> receiver_;
  };
 diff --git a/third_party/blink/public/mojom/page/page.mojom b/third_party/blink/public/mojom/page/page.mojom
-index fb846303b126c0bbaa252b8b6c5b9b2971100c62..e6dcf94dcde8515e9cf73656d6c1659492aac4b4 100644
+index bcf8559d759e73e4f3f00710d263fe24cc801828..556f990868b862452156cec2354a90ae75352251 100644
 --- a/third_party/blink/public/mojom/page/page.mojom
 +++ b/third_party/blink/public/mojom/page/page.mojom
-@@ -186,4 +186,7 @@ interface PageBroadcast {
-   // Indicates that the page's main frame should collect draggable regions set
-   // using the app-region CSS property.
-   SetSupportsDraggableRegions(bool supports_draggable_regions);
+@@ -180,4 +180,7 @@ interface PageBroadcast {
+   // the noise token at ReadyToCommit time and update blink::WebViews that
+   // were made at request time.
+   UpdateCanvasNoiseToken(uint64? canvas_noise_token);
 +
 +  // Whether to enable the Renderer scheduler background throttling.
 +  SetSchedulerThrottling(bool allowed);
  };
 diff --git a/third_party/blink/public/web/web_view.h b/third_party/blink/public/web/web_view.h
-index 11a31c9ed26b5abde0ea812eae6b219340ed711c..a72cf76b820cb86b9495ea147efbdcf53b8a9845 100644
+index b3553c0783a7b00e055f82ef0b72bd866284473d..c91e49807ec0b56d867504831118269116024626 100644
 --- a/third_party/blink/public/web/web_view.h
 +++ b/third_party/blink/public/web/web_view.h
-@@ -366,6 +366,7 @@ class BLINK_EXPORT WebView {
+@@ -365,6 +365,7 @@ class BLINK_EXPORT WebView {
    // Scheduling -----------------------------------------------------------
  
    virtual PageScheduler* Scheduler() const = 0;
@@ -116,10 +116,10 @@ index 11a31c9ed26b5abde0ea812eae6b219340ed711c..a72cf76b820cb86b9495ea147efbdcf5
    // Visibility -----------------------------------------------------------
  
 diff --git a/third_party/blink/renderer/core/exported/web_view_impl.cc b/third_party/blink/renderer/core/exported/web_view_impl.cc
-index 071ede882b2503e22ff97967a7f9cbfd96d048bd..baf06a06756ac7cdcd7f7aef15f812d5d64c04d3 100644
+index 714b713cd466ac289b3d172ac484ddfd2b46190b..be43ac07eb6563dcb72374dfc4f3bd34913e98c3 100644
 --- a/third_party/blink/renderer/core/exported/web_view_impl.cc
 +++ b/third_party/blink/renderer/core/exported/web_view_impl.cc
-@@ -2512,6 +2512,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
+@@ -2500,6 +2500,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
    TRACE_EVENT2("navigation", "WebViewImpl::SetPageLifecycleStateInternal",
                 "old_state", old_state, "new_state", new_state);
  
@@ -130,7 +130,7 @@ index 071ede882b2503e22ff97967a7f9cbfd96d048bd..baf06a06756ac7cdcd7f7aef15f812d5
    bool storing_in_bfcache = new_state->is_in_back_forward_cache &&
                              !old_state->is_in_back_forward_cache;
    bool restoring_from_bfcache = !new_state->is_in_back_forward_cache &&
-@@ -4029,10 +4033,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
+@@ -4009,10 +4013,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
    return GetPage()->GetPageScheduler();
  }
  
@@ -155,10 +155,10 @@ index 071ede882b2503e22ff97967a7f9cbfd96d048bd..baf06a06756ac7cdcd7f7aef15f812d5
    // Do not throttle if the page should be painting.
    bool is_visible =
 diff --git a/third_party/blink/renderer/core/exported/web_view_impl.h b/third_party/blink/renderer/core/exported/web_view_impl.h
-index 9b9dd237525793b149f1e79d26e9e8043131c363..ec1d8054289b1ae6eb5a579fc82b90a92fe438ff 100644
+index 883269126ff93c26765ab62013035c6193f8adbb..f821da879a6b6b04d33ef60037a053f3a5c0851d 100644
 --- a/third_party/blink/renderer/core/exported/web_view_impl.h
 +++ b/third_party/blink/renderer/core/exported/web_view_impl.h
-@@ -452,6 +452,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
+@@ -450,6 +450,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
    LocalDOMWindow* PagePopupWindow() const;
  
    PageScheduler* Scheduler() const override;
@@ -166,7 +166,7 @@ index 9b9dd237525793b149f1e79d26e9e8043131c363..ec1d8054289b1ae6eb5a579fc82b90a9
    void SetVisibilityState(mojom::blink::PageVisibilityState visibility_state,
                            bool is_initial_state) override;
    mojom::blink::PageVisibilityState GetVisibilityState() override;
-@@ -945,6 +946,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
+@@ -943,6 +944,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
    // If true, we send IPC messages when |preferred_size_| changes.
    bool send_preferred_size_changes_ = false;
  

patches/chromium/allow_electron_to_depend_on_components_os_crypt_sync.patch

@@ -1,23 +0,0 @@
-From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
-From: John Kleinschmidt <jkleinsc@electronjs.org>
-Date: Mon, 15 Sep 2025 15:52:55 -0400
-Subject: Allow electron to depend on components/os_crypt/sync.
-
-This is necessary after
-https://chromium-review.googlesource.com/c/chromium/src/+/6944749
-landed.  That CL notes that "new code should use os_crypt async",
-so we can remove this patch once we migrate our code to use
-os_crypt async.
-
-diff --git a/components/os_crypt/sync/BUILD.gn b/components/os_crypt/sync/BUILD.gn
-index 43d25c4826c00af26fad9b4ed3c3bf0fee091fd4..bc1c9d9fe49c54cb635b1ea75bd5bc23ba5e4df2 100644
---- a/components/os_crypt/sync/BUILD.gn
-+++ b/components/os_crypt/sync/BUILD.gn
-@@ -10,6 +10,7 @@ import("//components/os_crypt/sync/features.gni")
- component("sync") {
-   # New code should use os_crypt async.
-   visibility = [
-+    "//electron:*",
-     "//chrome/browser",
-     "//chrome/browser/ui",
-     "//chrome/test:test_support",

patches/chromium/allow_in-process_windows_to_have_different_web_prefs.patch

@@ -8,7 +8,7 @@ WebPreferences of in-process child windows, rather than relying on
 process-level command line switches, as before.
 
 diff --git a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
-index dd803e6537c9c7eb1d6e5b36c4268ce2c2314622..c84364663dbb0bcbc51048f1d41bfb6f962dfea4 100644
+index e66a1b104fbcb6ac81b745a28588a994533745ff..08abd32cebf89d434bf60b4fd420430e88540adc 100644
 --- a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
 +++ b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
 @@ -148,6 +148,19 @@ bool StructTraits<blink::mojom::WebPreferencesDataView,
@@ -32,7 +32,7 @@ index dd803e6537c9c7eb1d6e5b36c4268ce2c2314622..c84364663dbb0bcbc51048f1d41bfb6f
    out->accelerated_video_decode_enabled =
        data.accelerated_video_decode_enabled();
 diff --git a/third_party/blink/public/common/web_preferences/web_preferences.h b/third_party/blink/public/common/web_preferences/web_preferences.h
-index 2a2ccea94b2a1af9ed54b884e1c0cdf67c4a6c32..24c3c81c5170291974cef00f201d69a9ce93ef0f 100644
+index 39eefd4970a93bef42487d51e9c0bdfd76a001a0..a76da90ca59e07ad57ae85ee765b90875b82819c 100644
 --- a/third_party/blink/public/common/web_preferences/web_preferences.h
 +++ b/third_party/blink/public/common/web_preferences/web_preferences.h
 @@ -9,6 +9,7 @@
@@ -43,7 +43,7 @@ index 2a2ccea94b2a1af9ed54b884e1c0cdf67c4a6c32..24c3c81c5170291974cef00f201d69a9
  #include "build/build_config.h"
  #include "net/nqe/effective_connection_type.h"
  #include "third_party/blink/public/common/common_export.h"
-@@ -463,6 +464,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
+@@ -462,6 +463,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
    bool increment_local_surface_id_for_mainframe_same_doc_navigation = true;
  #endif  // BUILDFLAG(IS_ANDROID)
  
@@ -64,7 +64,7 @@ index 2a2ccea94b2a1af9ed54b884e1c0cdf67c4a6c32..24c3c81c5170291974cef00f201d69a9
    // chrome, except for the cases where it would require lots of extra work for
    // the embedder to use the same default value.
 diff --git a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
-index ccba9b7353c87d2e2bced7770920c976865c0d65..4d93ef8c1976cf533c32bc9c17dbf6b81f2b59c6 100644
+index 36e04a5f887fd9102b3d74a4230132ecee780c1b..8e53242f1be83920ca64c95c31aa674e04d2bb81 100644
 --- a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
 +++ b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
 @@ -8,6 +8,7 @@
@@ -129,7 +129,7 @@ index ccba9b7353c87d2e2bced7770920c976865c0d65..4d93ef8c1976cf533c32bc9c17dbf6b8
      return r.cookie_enabled;
    }
 diff --git a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
-index a8bae4875ba2a8dd3d2574f55d6c229fc8025aa0..b5162c90cc3036ce97ceae590ef905033e10b399 100644
+index dd6185b0eacf942d902505ac23bf88059bf2786a..f3f1c71f241db0a90144909971412009e5510b6e 100644
 --- a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
 +++ b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
 @@ -8,9 +8,11 @@ import "third_party/blink/public/mojom/css/preferred_color_scheme.mojom";

patches/chromium/blink_local_frame.patch

@@ -49,10 +49,10 @@ index cdb5b9246087b5678cf6a0f2713f6238dafc13de..7efbe7524c5ddd3785fff0e2d8901f93
    // its owning reference back to our owning LocalFrame.
    client_->Detached(type);
 diff --git a/third_party/blink/renderer/core/frame/local_frame.cc b/third_party/blink/renderer/core/frame/local_frame.cc
-index 9338d883b1441e1ddd4b39a87f56cd62d6c0eff7..e7f9b2ebfd5a04290b8d2d8a75141534e35bc4c6 100644
+index 7d0f966131a4e91efd4652e23dec8287e98b82a9..75975a8d48b05ba25b169b93b62bb7d34eb3f5b7 100644
 --- a/third_party/blink/renderer/core/frame/local_frame.cc
 +++ b/third_party/blink/renderer/core/frame/local_frame.cc
-@@ -747,10 +747,6 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
+@@ -751,10 +751,6 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
    }
    DCHECK(!view_ || !view_->IsAttached());
  
@@ -63,7 +63,7 @@ index 9338d883b1441e1ddd4b39a87f56cd62d6c0eff7..e7f9b2ebfd5a04290b8d2d8a75141534
    if (!Client())
      return false;
  
-@@ -804,6 +800,11 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
+@@ -808,6 +804,11 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
    DCHECK(!view_->IsAttached());
    Client()->WillBeDetached();
  

patches/chromium/build_add_electron_tracing_category.patch

@@ -8,10 +8,10 @@ categories in use are known / declared.  This patch is required for us
 to introduce a new Electron category for Electron-specific tracing.
 
 diff --git a/base/trace_event/builtin_categories.h b/base/trace_event/builtin_categories.h
-index 0781468366f8684b0e245bd6df85c1f48b5a915a..5d4ea347e2cba761870462ff1e623792416dbf4c 100644
+index 28d3c301465335cc664dad51e41133cd04fa8a62..290363dfa65a3207e5ade788825d470122a4afc8 100644
 --- a/base/trace_event/builtin_categories.h
 +++ b/base/trace_event/builtin_categories.h
-@@ -128,6 +128,7 @@ PERFETTO_DEFINE_CATEGORIES_IN_NAMESPACE_WITH_ATTRS(
+@@ -126,6 +126,7 @@ PERFETTO_DEFINE_CATEGORIES_IN_NAMESPACE_WITH_ATTRS(
      perfetto::Category("drm"),
      perfetto::Category("drmcursor"),
      perfetto::Category("dwrite"),

patches/chromium/build_allow_electron_mojom_interfaces_to_depend_on_blink.patch

@@ -10,10 +10,10 @@ Needed for:
 2) //electron/shell/common:web_contents_utility
 
 diff --git a/content/public/common/BUILD.gn b/content/public/common/BUILD.gn
-index b6511498e08e6d0a280b89175fcfdb61c7e40df4..e214d7ea5e7108baf9f9910d6b44deff587914c2 100644
+index 981abc2963aaaa8f4cf283cdc0807907500b65eb..4be2f078f0c9890d0bcca635a82711386abae077 100644
 --- a/content/public/common/BUILD.gn
 +++ b/content/public/common/BUILD.gn
-@@ -370,6 +370,8 @@ mojom("interfaces") {
+@@ -382,6 +382,8 @@ mojom("interfaces") {
      "//content/common/*",
      "//extensions/common:mojom",
      "//extensions/common:mojom_blink",

patches/chromium/build_disable_thin_lto_mac.patch

@@ -11,15 +11,15 @@ This patch can (and should) be removed when we can prevent those symbols
 from being stripped in the release build.
 
 diff --git a/build/config/compiler/compiler.gni b/build/config/compiler/compiler.gni
-index 2cf6def300d9d92d476ca4ca792347a49bafc26a..8e54f1d3e50a2c56b0cf35a8e56f97f6622401d5 100644
+index 0611cd47ef35d3b137a3278896a9174ae2fc3c31..a076c0f461b50fea86679a148b857739f7ec2c3d 100644
 --- a/build/config/compiler/compiler.gni
 +++ b/build/config/compiler/compiler.gni
-@@ -85,7 +85,7 @@ declare_args() {
-   # Chrome's clang. crbug.com/1033839
+@@ -88,7 +88,7 @@ declare_args() {
+   # have the same LLVM revisions as us, making bitcode useless to them.
    use_thin_lto =
        is_cfi || (is_clang && is_official_build && chrome_pgo_phase != 1 &&
--                 (is_linux || is_win || is_mac || (is_ios && use_lld) ||
-+                 (is_linux || is_win || (is_ios && use_lld) ||
+-                 (is_linux || is_win || is_mac ||
++                 (is_linux || is_win ||
+                   (is_ios && use_lld && !is_cronet_build) ||
                    (is_android && target_os != "chromeos") ||
                    (is_chromeos && is_chromeos_device)))
- 

patches/chromium/build_do_not_depend_on_packed_resource_integrity.patch

@@ -11,10 +11,10 @@ if we ever align our .pak file generation with Chrome we can remove this
 patch.
 
 diff --git a/chrome/BUILD.gn b/chrome/BUILD.gn
-index e7ee2d88b136be97e0668874a309085554041a5a..1ed28fa85bf906bea9628da146627067b105d94f 100644
+index e648bb4ed2ff72441faa8773e449e0b6174f5af5..fd2c1d3ac575d10de7d5c09e4418d17217a43b77 100644
 --- a/chrome/BUILD.gn
 +++ b/chrome/BUILD.gn
-@@ -196,11 +196,16 @@ if (!is_android && !is_mac) {
+@@ -195,11 +195,16 @@ if (!is_android && !is_mac) {
          "common/crash_keys.h",
        ]
  
@@ -33,7 +33,7 @@ index e7ee2d88b136be97e0668874a309085554041a5a..1ed28fa85bf906bea9628da146627067
          "//base",
          "//build:branding_buildflags",
 diff --git a/chrome/browser/BUILD.gn b/chrome/browser/BUILD.gn
-index 03767f1fa536107112eee7106323238caeeedf2c..0df5df319e4d84daed9d9017691950579fce7ae3 100644
+index f2f0b13a9b96b906d39cfad4236a7e72b9439e06..7a2dc270b8c19f4418074ad23dd793d15223b33a 100644
 --- a/chrome/browser/BUILD.gn
 +++ b/chrome/browser/BUILD.gn
 @@ -4811,7 +4811,7 @@ static_library("browser") {
@@ -46,10 +46,10 @@ index 03767f1fa536107112eee7106323238caeeedf2c..0df5df319e4d84daed9d901769195057
        # than here in :chrome_dll.
        deps += [ "//chrome:packed_resources_integrity_header" ]
 diff --git a/chrome/test/BUILD.gn b/chrome/test/BUILD.gn
-index 932793506ca9259d6c4f67f6e2bbbd654b2c7be3..eff32d19f785d871e9ec9a63fe52151ee485dc1e 100644
+index c60cdd5bf0b3327b5495238c9296b99413c7c226..433a20d22a4df2355d6d407963047491bf3f3b2b 100644
 --- a/chrome/test/BUILD.gn
 +++ b/chrome/test/BUILD.gn
-@@ -7563,9 +7563,12 @@ test("unit_tests") {
+@@ -7515,9 +7515,12 @@ test("unit_tests") {
        "//chrome/notification_helper",
      ]
  
@@ -63,7 +63,7 @@ index 932793506ca9259d6c4f67f6e2bbbd654b2c7be3..eff32d19f785d871e9ec9a63fe52151e
        "//chrome//services/util_win:unit_tests",
        "//chrome/app:chrome_dll_resources",
        "//chrome/app:win_unit_tests",
-@@ -8499,6 +8502,10 @@ test("unit_tests") {
+@@ -8447,6 +8450,10 @@ test("unit_tests") {
        "../browser/performance_manager/policies/background_tab_loading_policy_unittest.cc",
      ]
  
@@ -74,7 +74,7 @@ index 932793506ca9259d6c4f67f6e2bbbd654b2c7be3..eff32d19f785d871e9ec9a63fe52151e
      sources += [
        # The importer code is not used on Android.
        "../common/importer/firefox_importer_utils_unittest.cc",
-@@ -8555,7 +8562,6 @@ test("unit_tests") {
+@@ -8503,7 +8510,6 @@ test("unit_tests") {
      # TODO(crbug.com/417513088): Maybe merge with the non-android `deps` declaration above?
      deps += [
        "../browser/screen_ai:screen_ai_install_state",

patches/chromium/build_gn.patch

@@ -7,7 +7,7 @@ These are variables we add to the root BUILDCONFIG so that they're available
 everywhere, without having to import("//electron/.../flags.gni").
 
 diff --git a/build/config/BUILDCONFIG.gn b/build/config/BUILDCONFIG.gn
-index 29b0bbeae4dd412876fdaa15688bd248c93216b4..1a1b2fa45cf6e565359ae84256e6dbe5246322c5 100644
+index 24a1d143954ae05ae0b79b0994b76ef9218fb848..5c9b2ed8ba48a1056560ca1cd1d5b976aee4815c 100644
 --- a/build/config/BUILDCONFIG.gn
 +++ b/build/config/BUILDCONFIG.gn
 @@ -123,6 +123,9 @@ if (current_os == "") {

patches/chromium/build_libc_as_static_library.patch

@@ -7,10 +7,10 @@ Build libc++ as static library to compile and pass
 nan tests
 
 diff --git a/buildtools/third_party/libc++/BUILD.gn b/buildtools/third_party/libc++/BUILD.gn
-index f1ac049db7df5637c94893009287b53c6127158f..ebf028bdb2934ca2f9f2ab7b7c3e6d3daa544d37 100644
+index 7dcefd2bceb209c6e74445259fac00e3e2280ff7..3a233d2e9dafc2093ead8f9c9104d06fe6176252 100644
 --- a/buildtools/third_party/libc++/BUILD.gn
 +++ b/buildtools/third_party/libc++/BUILD.gn
-@@ -481,6 +481,7 @@ target(libcxx_target_type, "libc++") {
+@@ -841,6 +841,7 @@ target(libcxx_target_type, "libc++") {
    # need to explicitly depend on libc++.
    visibility = [
      "//build/config:common_deps",

patches/chromium/build_run_reclient_cfg_generator_after_chrome.patch

@@ -20,10 +20,10 @@ index 17103061c4752e6fcac07413dbf574e0c6fd6d39..848be71fa6dc81a64b7274b31d461f9d
  /win-cross/
  reproxy.cfg
 diff --git a/buildtools/reclient_cfgs/configure_reclient_cfgs.py b/buildtools/reclient_cfgs/configure_reclient_cfgs.py
-index 8779d4609c9eed155c414a1c97d3598906857b22..731ac034f85c8c5ebee6d29a0395f6e828b41ab0 100755
+index 128bda296c91eac5f0c2fcfeed0c553deb5514dd..f1e33d36810dba80a42608655beb27c6e197a888 100755
 --- a/buildtools/reclient_cfgs/configure_reclient_cfgs.py
 +++ b/buildtools/reclient_cfgs/configure_reclient_cfgs.py
-@@ -334,4 +334,13 @@ def main():
+@@ -344,4 +344,13 @@ def main():
  
  
  if __name__ == "__main__":

patches/chromium/build_set_mac_sdk_minimum_to_10.patch

@@ -0,0 +1,26 @@
+From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
+From: Keeley Hammond <khammond@slack-corp.com>
+Date: Tue, 1 Jul 2025 15:40:02 -0700
+Subject: build: Set MacOS SDK minimum back to 10
+
+This commit reverts 6493969: Update mac_sdk_min to
+match minimum required SDK version |
+https://chromium-review.googlesource.com/c/chromium/src/+/6493969
+
+This patch is purely to unblock nightlies while
+we merge an upstream fix and allocate additional space
+on the Mac runners. If this patch is still in main
+anytime after July 30, 2025, find @VerteDinde and yell
+at her.
+
+diff --git a/build/config/mac/mac_sdk_overrides.gni b/build/config/mac/mac_sdk_overrides.gni
+index 8f8ac1c218ce15fa5c1aecbbcd0b93281f6c52f2..15ddfd5cffbaba0704b3217e1ae4f2825f399d96 100644
+--- a/build/config/mac/mac_sdk_overrides.gni
++++ b/build/config/mac/mac_sdk_overrides.gni
+@@ -7,5 +7,5 @@
+ 
+ declare_args() {
+   # Minimum supported version of the Mac SDK.
+-  mac_sdk_min = "15"
++  mac_sdk_min = "10.15"
+ }

patches/chromium/can_create_window.patch

@@ -9,10 +9,10 @@ potentially prevent a window from being created.
 TODO(loc): this patch is currently broken.
 
 diff --git a/content/browser/renderer_host/render_frame_host_impl.cc b/content/browser/renderer_host/render_frame_host_impl.cc
-index 55ba21754555cccb095707d30fcefeaf15ea13c6..e76cccefbbf77fcfb886c41d501bcff4fd27be2f 100644
+index 666ed8890f60cd0477b814b4b44571002eca9bff..73f730ff05a22938a834921d4842bf1f9faaca67 100644
 --- a/content/browser/renderer_host/render_frame_host_impl.cc
 +++ b/content/browser/renderer_host/render_frame_host_impl.cc
-@@ -9861,6 +9861,7 @@ void RenderFrameHostImpl::CreateNewWindow(
+@@ -9823,6 +9823,7 @@ void RenderFrameHostImpl::CreateNewWindow(
            last_committed_origin_, params->window_container_type,
            params->target_url, params->referrer.To<Referrer>(),
            params->frame_name, params->disposition, *params->features,
@@ -21,10 +21,10 @@ index 55ba21754555cccb095707d30fcefeaf15ea13c6..e76cccefbbf77fcfb886c41d501bcff4
            &no_javascript_access);
  
 diff --git a/content/browser/web_contents/web_contents_impl.cc b/content/browser/web_contents/web_contents_impl.cc
-index 49d18f7595e463cc98c888a942f837757a27a596..a7ea73a46936ab4f82880121767376383864959b 100644
+index 3677a957465f59ab80ac059bfcb5afdf98513b48..7a6760e0efdf6972eb497407b68202c5bfffd006 100644
 --- a/content/browser/web_contents/web_contents_impl.cc
 +++ b/content/browser/web_contents/web_contents_impl.cc
-@@ -5350,6 +5350,10 @@ FrameTree* WebContentsImpl::CreateNewWindow(
+@@ -5298,6 +5298,10 @@ FrameTree* WebContentsImpl::CreateNewWindow(
    create_params.initially_hidden = renderer_started_hidden;
    create_params.initial_popup_url = params.target_url;
  
@@ -35,7 +35,7 @@ index 49d18f7595e463cc98c888a942f837757a27a596..a7ea73a46936ab4f8288012176737638
    // Even though all codepaths leading here are in response to a renderer
    // trying to open a new window, if the new window ends up in a different
    // browsing instance, then the RenderViewHost, RenderWidgetHost,
-@@ -5404,6 +5408,12 @@ FrameTree* WebContentsImpl::CreateNewWindow(
+@@ -5353,6 +5357,12 @@ FrameTree* WebContentsImpl::CreateNewWindow(
    // Sets the newly created WebContents WindowOpenDisposition.
    new_contents_impl->original_window_open_disposition_ = params.disposition;
  
@@ -48,7 +48,7 @@ index 49d18f7595e463cc98c888a942f837757a27a596..a7ea73a46936ab4f8288012176737638
    // If the new frame has a name, make sure any SiteInstances that can find
    // this named frame have proxies for it.  Must be called after
    // SetSessionStorageNamespace, since this calls CreateRenderView, which uses
-@@ -5445,12 +5455,6 @@ FrameTree* WebContentsImpl::CreateNewWindow(
+@@ -5394,12 +5404,6 @@ FrameTree* WebContentsImpl::CreateNewWindow(
      AddWebContentsDestructionObserver(new_contents_impl);
    }
  
@@ -62,10 +62,10 @@ index 49d18f7595e463cc98c888a942f837757a27a596..a7ea73a46936ab4f8288012176737638
                               new_contents_impl, opener, params.target_url,
                               params.referrer.To<Referrer>(), params.disposition,
 diff --git a/content/common/frame.mojom b/content/common/frame.mojom
-index 15a83f61ed4e31ba34cbc19995cd9d68b1599f1d..9cf9fefad46a6c2ead4085adc76e0c07369f641a 100644
+index 90cc84198b7f23c6a07ab503f60a577fdfba5baa..722b27b8adaf86624058ace5f9b5871ff0ede627 100644
 --- a/content/common/frame.mojom
 +++ b/content/common/frame.mojom
-@@ -662,6 +662,10 @@ struct CreateNewWindowParams {
+@@ -661,6 +661,10 @@ struct CreateNewWindowParams {
    pending_associated_remote<blink.mojom.Widget> widget;
    pending_associated_receiver<blink.mojom.FrameWidgetHost> frame_widget_host;
    pending_associated_remote<blink.mojom.FrameWidget> frame_widget;
@@ -77,10 +77,10 @@ index 15a83f61ed4e31ba34cbc19995cd9d68b1599f1d..9cf9fefad46a6c2ead4085adc76e0c07
  
  // Operation result when the renderer asks the browser to create a new window.
 diff --git a/content/public/browser/content_browser_client.cc b/content/public/browser/content_browser_client.cc
-index 7b813d46382672421e569f68204f6f127bab7dce..64ad3e62245ad9b1fd0b8e0487b6d14d34a6d5f3 100644
+index 750edc0c6767ab6a59d010b4f3f02770e50450b0..60e7eebb4f40df18e3fa28f57b7bbb20733477e7 100644
 --- a/content/public/browser/content_browser_client.cc
 +++ b/content/public/browser/content_browser_client.cc
-@@ -881,6 +881,8 @@ bool ContentBrowserClient::CanCreateWindow(
+@@ -884,6 +884,8 @@ bool ContentBrowserClient::CanCreateWindow(
      const std::string& frame_name,
      WindowOpenDisposition disposition,
      const blink::mojom::WindowFeatures& features,
@@ -90,10 +90,10 @@ index 7b813d46382672421e569f68204f6f127bab7dce..64ad3e62245ad9b1fd0b8e0487b6d14d
      bool opener_suppressed,
      bool* no_javascript_access) {
 diff --git a/content/public/browser/content_browser_client.h b/content/public/browser/content_browser_client.h
-index 3f0599ae229b9785146fcd29528d183f2d04a8e7..ef9073ffcf8a5fa51fa028667cf3328cfae6f994 100644
+index eb7b1fdf7c3b3373201db40f03fc498c4ee08d25..f27b387da5ff4e4f20d28d80043151ad2f2e9d51 100644
 --- a/content/public/browser/content_browser_client.h
 +++ b/content/public/browser/content_browser_client.h
-@@ -196,6 +196,7 @@ class NetworkService;
+@@ -201,6 +201,7 @@ class NetworkService;
  class TrustedURLLoaderHeaderClient;
  }  // namespace mojom
  struct ResourceRequest;
@@ -101,7 +101,7 @@ index 3f0599ae229b9785146fcd29528d183f2d04a8e7..ef9073ffcf8a5fa51fa028667cf3328c
  }  // namespace network
  
  namespace sandbox {
-@@ -1454,6 +1455,8 @@ class CONTENT_EXPORT ContentBrowserClient {
+@@ -1449,6 +1450,8 @@ class CONTENT_EXPORT ContentBrowserClient {
        const std::string& frame_name,
        WindowOpenDisposition disposition,
        const blink::mojom::WindowFeatures& features,
@@ -111,10 +111,10 @@ index 3f0599ae229b9785146fcd29528d183f2d04a8e7..ef9073ffcf8a5fa51fa028667cf3328c
        bool opener_suppressed,
        bool* no_javascript_access);
 diff --git a/content/public/browser/web_contents_delegate.cc b/content/public/browser/web_contents_delegate.cc
-index edee20df7f5bb087df9c134c7892f4befe2f14b9..df972f1ce594f2d4651202b650ff2d41fe19ecd0 100644
+index a8c0f1c63847f814b6e71fe24ae9aed24b26ba19..80d004eb9060e33af9e60b31a862a7dcecb254e8 100644
 --- a/content/public/browser/web_contents_delegate.cc
 +++ b/content/public/browser/web_contents_delegate.cc
-@@ -34,6 +34,17 @@ namespace content {
+@@ -33,6 +33,17 @@ namespace content {
  
  WebContentsDelegate::WebContentsDelegate() = default;
  
@@ -133,7 +133,7 @@ index edee20df7f5bb087df9c134c7892f4befe2f14b9..df972f1ce594f2d4651202b650ff2d41
      WebContents* source,
      const OpenURLParams& params,
 diff --git a/content/public/browser/web_contents_delegate.h b/content/public/browser/web_contents_delegate.h
-index caf97e0c94edfa1106b465e793190c82f646ebdb..38b61d04446736bcc44a412f633c01ed9aca5399 100644
+index 1af915fcc91ae29bb9a6e2fc51f788178365ee4c..6a43f8c30857bfb32867e63d570ad26459af9ae8 100644
 --- a/content/public/browser/web_contents_delegate.h
 +++ b/content/public/browser/web_contents_delegate.h
 @@ -18,6 +18,7 @@
@@ -152,7 +152,7 @@ index caf97e0c94edfa1106b465e793190c82f646ebdb..38b61d04446736bcc44a412f633c01ed
  #include "content/public/common/window_container_type.mojom-forward.h"
  #include "third_party/blink/public/common/input/web_mouse_event.h"
  #include "third_party/blink/public/common/mediastream/media_stream_request.h"
-@@ -388,6 +390,16 @@ class CONTENT_EXPORT WebContentsDelegate {
+@@ -381,6 +383,16 @@ class CONTENT_EXPORT WebContentsDelegate {
        const StoragePartitionConfig& partition_config,
        SessionStorageNamespace* session_storage_namespace);
  
@@ -170,10 +170,10 @@ index caf97e0c94edfa1106b465e793190c82f646ebdb..38b61d04446736bcc44a412f633c01ed
    // typically happens when popups are created.
    virtual void WebContentsCreated(WebContents* source_contents,
 diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
-index 66714ce46183169853952879cca77069ad248017..792ecdf43c810d19641251d3f5eeddccc4c621e9 100644
+index a8d472bb78f3a9478b70cf3d98c35affec7caf39..bc2ec7491d7072be77307d7b8af06e5397e2bdfb 100644
 --- a/content/renderer/render_frame_impl.cc
 +++ b/content/renderer/render_frame_impl.cc
-@@ -6815,6 +6815,10 @@ WebView* RenderFrameImpl::CreateNewWindow(
+@@ -6772,6 +6772,10 @@ WebView* RenderFrameImpl::CreateNewWindow(
            request.HasUserGesture(), GetWebFrame()->IsAdFrame(),
            GetWebFrame()->IsAdScriptInStack());
  
@@ -185,10 +185,10 @@ index 66714ce46183169853952879cca77069ad248017..792ecdf43c810d19641251d3f5eeddcc
    // moved on send.
    bool is_background_tab =
 diff --git a/content/web_test/browser/web_test_content_browser_client.cc b/content/web_test/browser/web_test_content_browser_client.cc
-index 576fd50ec4c27c6c2da9674e68f65fd0a21d1d68..b44304f128fb97523c9c9046b5edece8c09c5c0f 100644
+index 66a10226b043a490295e518230c20bba0ed71d6c..14b78014d93ce459789fd497dfcfb71e2cc769bd 100644
 --- a/content/web_test/browser/web_test_content_browser_client.cc
 +++ b/content/web_test/browser/web_test_content_browser_client.cc
-@@ -538,6 +538,8 @@ bool WebTestContentBrowserClient::CanCreateWindow(
+@@ -537,6 +537,8 @@ bool WebTestContentBrowserClient::CanCreateWindow(
      const std::string& frame_name,
      WindowOpenDisposition disposition,
      const blink::mojom::WindowFeatures& features,
@@ -232,10 +232,10 @@ index 82e9d3dfb5f7da76d89fe15ae61d379fa46e177d..fd035512099a54dff6cc951a2226c23a
  
  }  // namespace blink
 diff --git a/third_party/blink/renderer/core/frame/local_dom_window.cc b/third_party/blink/renderer/core/frame/local_dom_window.cc
-index 29a3e6f8640c8c574803dde123639d52e089e421..15f9762af0726b52657982e2005d8a40a011a848 100644
+index 68ab3d483fe60671de50ec8952a0f71f103e4ad3..7ea5e45c08d7af439cf3eec041391ed7902ec865 100644
 --- a/third_party/blink/renderer/core/frame/local_dom_window.cc
 +++ b/third_party/blink/renderer/core/frame/local_dom_window.cc
-@@ -2347,6 +2347,8 @@ DOMWindow* LocalDOMWindow::open(v8::Isolate* isolate,
+@@ -2333,6 +2333,8 @@ DOMWindow* LocalDOMWindow::open(v8::Isolate* isolate,
    WebWindowFeatures window_features =
        GetWindowFeaturesFromString(features, entered_window);
  

patches/chromium/chore_add_electron_deps_to_gitignores.patch

@@ -6,10 +6,10 @@ Subject: chore: add electron deps to gitignores
 Makes things like "git status" quicker when developing electron locally
 
 diff --git a/.gitignore b/.gitignore
-index 22985d0edf211adc576c14ddb0fb21192a636d99..210132f7864c04ac7ffab70875b1c8905bd00e62 100644
+index 5eb6e4d1815a7a56c7fff1d6f095e6c7e8127b84..808d897ba80abb9cced32a02cb7026305afe0dd2 100644
 --- a/.gitignore
 +++ b/.gitignore
-@@ -228,6 +228,7 @@ vs-chromium-project.txt
+@@ -226,6 +226,7 @@ vs-chromium-project.txt
  /data
  /delegate_execute
  /device/serial/device_serial_mojo.xml
@@ -18,10 +18,10 @@ index 22985d0edf211adc576c14ddb0fb21192a636d99..210132f7864c04ac7ffab70875b1c890
  /google_apis/gcm/gcm.xml
  /googleurl
 diff --git a/third_party/.gitignore b/third_party/.gitignore
-index 6be9e9e6feeedd0d1f566758e8da75870bc1d9c7..a0bacf9e5c4809d76093c449065d7f4f5bb47b02 100644
+index a750ba32fa50d4367682bf11b88e6a8a4700dc46..c3188f418a6368b35adfdcb2cd96de1614826d39 100644
 --- a/third_party/.gitignore
 +++ b/third_party/.gitignore
-@@ -45,7 +45,9 @@
+@@ -46,7 +46,9 @@
  /directxsdk
  /dragonbox/src
  /edk2

patches/chromium/chore_add_electron_objects_to_wrappablepointertag.patch

@@ -8,21 +8,20 @@ electron objects that extend gin::Wrappable and gets
 allocated on the cpp heap
 
 diff --git a/gin/public/wrappable_pointer_tags.h b/gin/public/wrappable_pointer_tags.h
-index 82fc9e311ec84b19a15818a501b3a29329eff004..1199be7426139cdc77cee2e620eb8427092c74dd 100644
+index 80ec409efe1635390887d1324be661643818abff..2e20b63d1fca56efb43c18d0fa04b1e2b4cf339a 100644
 --- a/gin/public/wrappable_pointer_tags.h
 +++ b/gin/public/wrappable_pointer_tags.h
-@@ -74,7 +74,13 @@ enum WrappablePointerTag : uint16_t {
-   kTextInputControllerBindings,  // content::TextInputControllerBindings
-   kWebAXObjectProxy,             // content::WebAXObjectProxy
-   kWrappedExceptionHandler,      // extensions::WrappedExceptionHandler
+@@ -66,7 +66,12 @@ enum WrappablePointerTag : uint16_t {
+   kTextInputControllerBindings,         // content::TextInputControllerBindings
+   kWebAXObjectProxy,                    // content::WebAXObjectProxy
+   kWrappedExceptionHandler,             // extensions::WrappedExceptionHandler
 -  kLastPointerTag = kWrappedExceptionHandler,
 +  kElectronApp,                         // electron::api::App
 +  kElectronDebugger,                    // electron::api::Debugger
 +  kElectronEvent,                       // gin_helper::internal::Event
-+  kElectronMenu,                        // electron::api::Menu
 +  kElectronNetLog,                      // electron::api::NetLog
 +  kElectronSession,                     // electron::api::Session
-+  kLastPointerTag = kElectronSession,
++  kLastPointerTag = kElectronEvent,
  };
  
  static_assert(kLastPointerTag <

patches/chromium/chore_disable_protocol_handler_dcheck.patch

@@ -1,29 +0,0 @@
-From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
-From: Samuel Maddock <smaddock@slack-corp.com>
-Date: Thu, 9 Oct 2025 22:07:38 -0400
-Subject: chore: disable protocol handler dcheck
-
-https://chromium-review.googlesource.com/c/chromium/src/+/6727594
-
-The above CL introduces a new extensions API to register custom protocol
-handlers. A DCHECK causes Electron to crash until we provide our own
-registry. This patch disables the check until we support this.
-
-diff --git a/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc b/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc
-index 902cf488c7d84923365c4197a70b06e61e3af038..dce80684853f89a68a2d21997102f48feb3df8f8 100644
---- a/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc
-+++ b/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc
-@@ -129,7 +129,12 @@ void ProtocolHandlersManager::ProtocolHandlersSanityCheck() {
-   auto* ph_registry =
-       ExtensionsBrowserClient::Get()->GetProtocolHandlerRegistry(
-           browser_context_);
--  DCHECK(ph_registry);
-+
-+  // TODO(samuelmaddock): Add support for extensions protocol handler. For now,
-+  // let's ignore this.
-+  if (!ph_registry)
-+    return;
-+
-   for (const auto& handler : ph_registry->GetExtensionProtocolHandlers()) {
-     DCHECK(handler.extension_id());
-     if (!enabled_ids.contains(*handler.extension_id())) {

patches/chromium/chore_expose_isolate_parameter_in_script_lifecycle_observers.patch

@@ -20,10 +20,10 @@ index 79d59c3f4d3d2d5ff39bd65ded489183247656a8..20b49742578ccf363738ee032228f30a
        int64_t service_worker_version_id,
        const GURL& service_worker_scope,
 diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
-index bbfac47a74f989482343c222b78f187b70297e4e..3677ca3345fbc775d139684a12fe36241827a729 100644
+index 18714ce8fc27c8d56c5deac27ba335078c452d0a..263405c605a0477b7a39bc274d7ee03be0b9cac5 100644
 --- a/content/public/renderer/render_frame_observer.h
 +++ b/content/public/renderer/render_frame_observer.h
-@@ -143,7 +143,8 @@ class CONTENT_EXPORT RenderFrameObserver {
+@@ -141,7 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
                                        int32_t world_id) {}
    virtual void DidInstallConditionalFeatures(v8::Local<v8::Context> context,
                                               int32_t world_id) {}
@@ -34,10 +34,10 @@ index bbfac47a74f989482343c222b78f187b70297e4e..3677ca3345fbc775d139684a12fe3624
    virtual void DidClearWindowObject() {}
    virtual void DidChangeScrollOffset() {}
 diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
-index 99d368046177dd92c8b36743f461d348bbf19a2e..b0a1859d22063cf6d5a73b5ccd5ea6fb86f9a6b9 100644
+index addef4de8a95f47964a895e1d1cc4763f565a028..8bef2220b9a416011cebf4da672c15d117a34efa 100644
 --- a/content/renderer/render_frame_impl.cc
 +++ b/content/renderer/render_frame_impl.cc
-@@ -4729,10 +4729,11 @@ void RenderFrameImpl::DidInstallConditionalFeatures(
+@@ -4685,10 +4685,11 @@ void RenderFrameImpl::DidInstallConditionalFeatures(
      observer.DidInstallConditionalFeatures(context, world_id);
  }
  
@@ -52,10 +52,10 @@ index 99d368046177dd92c8b36743f461d348bbf19a2e..b0a1859d22063cf6d5a73b5ccd5ea6fb
  
  void RenderFrameImpl::DidChangeScrollOffset() {
 diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
-index 61d4ef338cc4c0e99c144d6d95bbe0adba9d3556..ce7ba31d2a2ebab213be4b123f6af93c99b74149 100644
+index f0f4335aa815ea50dbf9b720b41e4eb31f27fb90..319f222565e4ef25206cc44d33ec5e291b8ea089 100644
 --- a/content/renderer/render_frame_impl.h
 +++ b/content/renderer/render_frame_impl.h
-@@ -605,7 +605,8 @@ class CONTENT_EXPORT RenderFrameImpl
+@@ -604,7 +604,8 @@ class CONTENT_EXPORT RenderFrameImpl
                                int world_id) override;
    void DidInstallConditionalFeatures(v8::Local<v8::Context> context,
                                       int world_id) override;
@@ -66,10 +66,10 @@ index 61d4ef338cc4c0e99c144d6d95bbe0adba9d3556..ce7ba31d2a2ebab213be4b123f6af93c
    void DidChangeScrollOffset() override;
    blink::WebMediaStreamDeviceObserver* MediaStreamDeviceObserver() override;
 diff --git a/content/renderer/service_worker/service_worker_context_client.cc b/content/renderer/service_worker/service_worker_context_client.cc
-index bf221ce102ea9ca25655f14a7cd90c625799d4b0..c4d81b211016616f6cbbdfcfae6620d4931ce775 100644
+index 37691ecee7a72b2ec47ff575239f628116cf136b..c67e3faf7440514e203e5b15a68fc34525a045a2 100644
 --- a/content/renderer/service_worker/service_worker_context_client.cc
 +++ b/content/renderer/service_worker/service_worker_context_client.cc
-@@ -322,6 +322,7 @@ void ServiceWorkerContextClient::WorkerContextStarted(
+@@ -318,6 +318,7 @@ void ServiceWorkerContextClient::WorkerContextStarted(
  }
  
  void ServiceWorkerContextClient::WillEvaluateScript(
@@ -77,7 +77,7 @@ index bf221ce102ea9ca25655f14a7cd90c625799d4b0..c4d81b211016616f6cbbdfcfae6620d4
      v8::Local<v8::Context> v8_context) {
    DCHECK(worker_task_runner_->RunsTasksInCurrentSequence());
    start_timing_->script_evaluation_start_time = base::TimeTicks::Now();
-@@ -340,8 +341,8 @@ void ServiceWorkerContextClient::WillEvaluateScript(
+@@ -336,8 +337,8 @@ void ServiceWorkerContextClient::WillEvaluateScript(
  
    DCHECK(proxy_);
    GetContentClient()->renderer()->WillEvaluateServiceWorkerOnWorkerThread(
@@ -89,10 +89,10 @@ index bf221ce102ea9ca25655f14a7cd90c625799d4b0..c4d81b211016616f6cbbdfcfae6620d4
  
  void ServiceWorkerContextClient::DidEvaluateScript(bool success) {
 diff --git a/content/renderer/service_worker/service_worker_context_client.h b/content/renderer/service_worker/service_worker_context_client.h
-index 2f3ba35491d17aa76f9baf8ba1cd53680a923654..477c6ac5a77c69cc4f062366c52adff3a36bdc76 100644
+index 1f5e24bc38d6ced52e4773236522e9520efc6f6d..a22ca5968fce5e6a0c436ec9b40f0e2f7c1482cf 100644
 --- a/content/renderer/service_worker/service_worker_context_client.h
 +++ b/content/renderer/service_worker/service_worker_context_client.h
-@@ -168,7 +168,8 @@ class ServiceWorkerContextClient
+@@ -165,7 +165,8 @@ class ServiceWorkerContextClient
    void WorkerContextStarted(
        blink::WebServiceWorkerContextProxy* proxy,
        scoped_refptr<base::SequencedTaskRunner> worker_task_runner) override;
@@ -103,10 +103,10 @@ index 2f3ba35491d17aa76f9baf8ba1cd53680a923654..477c6ac5a77c69cc4f062366c52adff3
    void WillInitializeWorkerContext() override;
    void WillDestroyWorkerContext(v8::Local<v8::Context> context) override;
 diff --git a/extensions/renderer/dispatcher.cc b/extensions/renderer/dispatcher.cc
-index 7b5398b4199ce6df9e1c9624771a5444d7f07eb3..77f896aa6a53bf7d277b963fba54d623eed8068b 100644
+index 37fc43bfc6804c2abb0cf107e2575c72cfca9023..9f3c88be38b9c8960a38649c7f3bf71dff182383 100644
 --- a/extensions/renderer/dispatcher.cc
 +++ b/extensions/renderer/dispatcher.cc
-@@ -615,6 +615,7 @@ void Dispatcher::DidInitializeServiceWorkerContextOnWorkerThread(
+@@ -612,6 +612,7 @@ void Dispatcher::DidInitializeServiceWorkerContextOnWorkerThread(
  
  void Dispatcher::WillEvaluateServiceWorkerOnWorkerThread(
      blink::WebServiceWorkerContextProxy* context_proxy,
@@ -167,10 +167,10 @@ index f96781a047056876b030581b539be0507acc3a1c..cd9be80be2500a001b1895c81ee597dd
    // Called when initial script evaluation finished for the main script.
    // |success| is true if the evaluation completed with no uncaught exception.
 diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
-index 4520c9edccf63bdb9e35bf3a99a8ddb39170da24..dd2c5bd50075c345262b05952ecf3f2aa300b6ff 100644
+index 52e8828d8fffaba8ab05436cb4d727595f18238a..6743653f5018c06d3e173aaacdca7275c6ec703f 100644
 --- a/third_party/blink/public/web/web_local_frame_client.h
 +++ b/third_party/blink/public/web/web_local_frame_client.h
-@@ -671,7 +671,8 @@ class BLINK_EXPORT WebLocalFrameClient {
+@@ -665,7 +665,8 @@ class BLINK_EXPORT WebLocalFrameClient {
                                               int32_t world_id) {}
  
    // WebKit is about to release its reference to a v8 context for a frame.
@@ -245,10 +245,10 @@ index 16066fe34ee0335a0dabe00b6890e5844349c0b5..cc84479f65bdbe56cb4b38bfcef0d752
  
    // Returns true if we should allow register V8 extensions to be added.
 diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
-index d46f3b764f653c990e57fb2c67121c8fd6b1b115..fe30a119d9befbde7c461637cf670a4b861efe05 100644
+index d8f3b11c98fd58baa9995762a29847b9fd760c84..5a9c9356a2098dfa9d28a5d30b19b492463216c8 100644
 --- a/third_party/blink/renderer/core/loader/empty_clients.h
 +++ b/third_party/blink/renderer/core/loader/empty_clients.h
-@@ -426,7 +426,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
+@@ -422,7 +422,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
                                int32_t world_id) override {}
    void DidInstallConditionalFeatures(v8::Local<v8::Context>,
                                       int32_t world_id) override {}
@@ -259,10 +259,10 @@ index d46f3b764f653c990e57fb2c67121c8fd6b1b115..fe30a119d9befbde7c461637cf670a4b
    bool AllowScriptExtensions() override { return false; }
  
 diff --git a/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc b/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc
-index 17860c80651c526e03fd06e4b644c3332b241be7..741a8587e95789038168eb500d3995724e11b47d 100644
+index eff817cda59a7b6e746813d5c42911d80547b5bd..217c4f76d62dd4910e89d4cb4cff4206fc84cfb1 100644
 --- a/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc
 +++ b/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc
-@@ -181,6 +181,7 @@ void ServiceWorkerGlobalScopeProxy::WillEvaluateScript() {
+@@ -180,6 +180,7 @@ void ServiceWorkerGlobalScopeProxy::WillEvaluateScript() {
    ScriptState::Scope scope(
        WorkerGlobalScope()->ScriptController()->GetScriptState());
    Client().WillEvaluateScript(

patches/chromium/chore_grandfather_in_electron_views_and_delegates.patch

@@ -10,10 +10,10 @@ Subject: chore: "grandfather in" Electron Views and Delegates
 6448510: Lock further access to View::set_owned_by_client(). | https://chromium-review.googlesource.com/c/chromium/src/+/6448510
 
 diff --git a/ui/views/view.h b/ui/views/view.h
-index 4fada89e37b9c63f7690fbbdd2ef4ecf86b5d756..73dd5aa59d8d1bb05aaed080e27426cc58da2d61 100644
+index ee028fccef7dcc9c3522d09e503d2ac49ffd329a..a56c2f87ee21a2bba2cb65acd426cb192124fa85 100644
 --- a/ui/views/view.h
 +++ b/ui/views/view.h
-@@ -81,6 +81,19 @@ class ArcNotificationContentView;
+@@ -80,6 +80,19 @@ class ArcNotificationContentView;
  class WideFrameView;
  }  // namespace ash
  
@@ -33,7 +33,7 @@ index 4fada89e37b9c63f7690fbbdd2ef4ecf86b5d756..73dd5aa59d8d1bb05aaed080e27426cc
  namespace exo {
  class ShellSurfaceBase;
  }
-@@ -325,6 +338,14 @@ class VIEWS_EXPORT View : public ui::LayerDelegate,
+@@ -324,6 +337,14 @@ class VIEWS_EXPORT View : public ui::LayerDelegate,
   public:
    class OwnedByClientPassKey {
     private:
@@ -49,7 +49,7 @@ index 4fada89e37b9c63f7690fbbdd2ef4ecf86b5d756..73dd5aa59d8d1bb05aaed080e27426cc
      // These existing cases are "grandfathered in", but there shouldn't be more.
      // See comments atop class.
 diff --git a/ui/views/widget/widget_delegate.h b/ui/views/widget/widget_delegate.h
-index 1f9c24adbdbe5d2bbd72099d234569c9fdbf863d..b437dd07f15f99cfaa35874f69fd4f19a1b343ba 100644
+index ff9c5abfdb02d9798b1491e2bbc296f2c7c74398..47d8a897d58b0d3829734105e81b887684dd009b 100644
 --- a/ui/views/widget/widget_delegate.h
 +++ b/ui/views/widget/widget_delegate.h
 @@ -168,6 +168,12 @@ namespace crostini {
@@ -81,7 +81,7 @@ index 1f9c24adbdbe5d2bbd72099d234569c9fdbf863d..b437dd07f15f99cfaa35874f69fd4f19
      // DO NOT ADD TO THIS LIST!
      // These existing cases are "grandfathered in", but there shouldn't be more.
      // See comments atop `RegisterDeleteDelegateCallback()`.
-@@ -920,6 +928,7 @@ class VIEWS_EXPORT WidgetDelegateView : public WidgetDelegate, public View {
+@@ -921,6 +929,7 @@ class VIEWS_EXPORT WidgetDelegateView : public WidgetDelegate, public View {
    View* GetContentsView() override;
  
   private:

patches/chromium/chore_introduce_blocking_api_for_electron.patch

@@ -7,7 +7,7 @@ This patch comes after Chromium removed the ScopedAllowIO API in favor
 of explicitly adding ScopedAllowBlocking calls as friends.
 
 diff --git a/base/threading/thread_restrictions.h b/base/threading/thread_restrictions.h
-index f10a4040b9460baf1b962f53b3dd54d01f49cdc7..ab2858e7a0fd7fcbc0c03b1a8c086ec4ce90c515 100644
+index 5625973d8cb18de3c77fbf001e02fdf2827f60fb..5d50a77051a9d2d906ec547796469d980eb42a35 100644
 --- a/base/threading/thread_restrictions.h
 +++ b/base/threading/thread_restrictions.h
 @@ -133,6 +133,7 @@ class KeyStorageLinux;
@@ -36,7 +36,7 @@ index f10a4040b9460baf1b962f53b3dd54d01f49cdc7..ab2858e7a0fd7fcbc0c03b1a8c086ec4
    friend class ::ProfileImpl;
    friend class ::ScopedAllowBlockingForProfile;
    friend class ::StartupTabProviderImpl;
-@@ -616,6 +621,7 @@ class BASE_EXPORT ScopedAllowBlocking {
+@@ -615,6 +620,7 @@ class BASE_EXPORT ScopedAllowBlocking {
    friend class cronet::CronetPrefsManager;
    friend class crypto::ScopedAllowBlockingForNSS;  // http://crbug.com/59847
    friend class drive::FakeDriveService;

patches/chromium/chore_modify_chromium_handling_of_mouse_events.patch

@@ -34,10 +34,10 @@ index 2dc44d4787d5198cff7be2cf98ad5acf2d3a9a0b..27a0335aac2bd4239616cf71f5d015c9
  
  class ScrollEvent;
 diff --git a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc
-index 5dd2b9b0897131897596e88e74701293c69e012d..89287b68398e9121959e7750644d37072e8e489b 100644
+index 7dd0e38866576389d59aecdd5a9ecc712996a597..4c626e026e5b19db737533607957d0ff2fbeae28 100644
 --- a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc
 +++ b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc
-@@ -1382,6 +1382,10 @@ HBRUSH DesktopWindowTreeHostWin::GetBackgroundPaintBrush() {
+@@ -1367,6 +1367,10 @@ HBRUSH DesktopWindowTreeHostWin::GetBackgroundPaintBrush() {
    return background_paint_brush_;
  }
  
@@ -49,10 +49,10 @@ index 5dd2b9b0897131897596e88e74701293c69e012d..89287b68398e9121959e7750644d3707
  DesktopWindowTreeHostWin::GetSingletonDesktopNativeCursorManager() {
    return new DesktopNativeCursorManagerWin();
 diff --git a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h
-index 8b34b44095ba7884947d5e83da847783126b3e62..1e30bce5ca5bf47726fd846f2f26705d52a8ce57 100644
+index dcda976f4c3cc0ba6bcf015d5bf7435df009ae30..13cfa18bf406f244ec361a1230ccce440ad9785a 100644
 --- a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h
 +++ b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h
-@@ -274,6 +274,7 @@ class VIEWS_EXPORT DesktopWindowTreeHostWin
+@@ -273,6 +273,7 @@ class VIEWS_EXPORT DesktopWindowTreeHostWin
    void HandleWindowScaleFactorChanged(float window_scale_factor) override;
    void HandleHeadlessWindowBoundsChanged(const gfx::Rect& bounds) override;
    HBRUSH GetBackgroundPaintBrush() override;
@@ -61,10 +61,10 @@ index 8b34b44095ba7884947d5e83da847783126b3e62..1e30bce5ca5bf47726fd846f2f26705d
    Widget* GetWidget();
    const Widget* GetWidget() const;
 diff --git a/ui/views/win/hwnd_message_handler.cc b/ui/views/win/hwnd_message_handler.cc
-index 10480326f56bcfebd6f9851d5cef401ee56f010c..0265177961817083e32e8357117e7ae158ba6ef3 100644
+index 76893d462786eaff21838614a8251b97bec92a79..72474adfb09f85118b4f752a22d121ab2b4c588a 100644
 --- a/ui/views/win/hwnd_message_handler.cc
 +++ b/ui/views/win/hwnd_message_handler.cc
-@@ -3240,15 +3240,19 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
+@@ -3239,15 +3239,19 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
      }
      // We must let Windows handle the caption buttons if it's drawing them, or
      // they won't work.
@@ -86,7 +86,7 @@ index 10480326f56bcfebd6f9851d5cef401ee56f010c..0265177961817083e32e8357117e7ae1
        return 0;
      }
    }
-@@ -3271,6 +3275,7 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
+@@ -3270,6 +3274,7 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
      // handle alt-space, or in the frame itself.
      is_right_mouse_pressed_on_caption_ = false;
      ReleaseCapture();
@@ -94,7 +94,7 @@ index 10480326f56bcfebd6f9851d5cef401ee56f010c..0265177961817083e32e8357117e7ae1
      // |point| is in window coordinates, but WM_NCHITTEST and TrackPopupMenu()
      // expect screen coordinates.
      POINT screen_point = CR_POINT_INITIALIZER_FROM_LPARAM(l_param);
-@@ -3278,7 +3283,17 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
+@@ -3277,7 +3282,17 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
      w_param = static_cast<WPARAM>(SendMessage(
          hwnd(), WM_NCHITTEST, 0, MAKELPARAM(screen_point.x, screen_point.y)));
      if (w_param == HTCAPTION || w_param == HTSYSMENU) {
@@ -114,10 +114,10 @@ index 10480326f56bcfebd6f9851d5cef401ee56f010c..0265177961817083e32e8357117e7ae1
      }
    } else if (message == WM_NCLBUTTONDOWN &&
 diff --git a/ui/views/win/hwnd_message_handler_delegate.h b/ui/views/win/hwnd_message_handler_delegate.h
-index 20cfb50af8d5131ca87d1fafce6f2ab43771f67b..eee40a56bebe52187a35daacfc788bf2f1f27e29 100644
+index 15e8cde9508170addec55290c859c91224bb2c33..a34948b9a42f030c71e453f1c534215fc2e671fa 100644
 --- a/ui/views/win/hwnd_message_handler_delegate.h
 +++ b/ui/views/win/hwnd_message_handler_delegate.h
-@@ -260,6 +260,10 @@ class VIEWS_EXPORT HWNDMessageHandlerDelegate {
+@@ -256,6 +256,10 @@ class VIEWS_EXPORT HWNDMessageHandlerDelegate {
    // if the default should be used.
    virtual HBRUSH GetBackgroundPaintBrush() = 0;
  

patches/chromium/chore_partial_revert_of.patch

@@ -14,10 +14,10 @@ track down the source of this problem & figure out if we can fix it
 by changing something in Electron.
 
 diff --git a/content/browser/web_contents/web_contents_impl.cc b/content/browser/web_contents/web_contents_impl.cc
-index 2636b49a902570bf3b92675db7792893fcc949f9..b489867c2567739ac200cd1e4c4863b3a0aa8235 100644
+index 2fd9e3ce15869b284ff8716c02ce8dc6392b2a7b..7bda1bd1d7c34e369c27e4ec283888fe4d50458d 100644
 --- a/content/browser/web_contents/web_contents_impl.cc
 +++ b/content/browser/web_contents/web_contents_impl.cc
-@@ -5321,7 +5321,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
+@@ -5269,7 +5269,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
            : IsGuest();
    // While some guest types do not have a guest SiteInstance, the ones that
    // don't all override WebContents creation above.

patches/chromium/chore_patch_out_partition_attribute_dcheck_for_webviews.patch

@@ -14,10 +14,10 @@ This change patches it out to prevent the DCHECK.
 It can be removed once/if we see a better solution to the problem.
 
 diff --git a/content/browser/site_instance_impl.cc b/content/browser/site_instance_impl.cc
-index ff8cd27f46f49ff3b445becf7cb0c628af147899..8702ca4da61aa296c957a9c50b26e921c5e5b19f 100644
+index 354a5870ef5b07a5903a1b40fcbb00462bf4a64b..bf3af2152ff7ca54412442b275ec7eedd60110ba 100644
 --- a/content/browser/site_instance_impl.cc
 +++ b/content/browser/site_instance_impl.cc
-@@ -227,7 +227,7 @@ scoped_refptr<SiteInstanceImpl> SiteInstanceImpl::CreateForGuest(
+@@ -225,7 +225,7 @@ scoped_refptr<SiteInstanceImpl> SiteInstanceImpl::CreateForGuest(
      BrowserContext* browser_context,
      const StoragePartitionConfig& partition_config) {
    DCHECK(browser_context);

patches/chromium/chore_patch_out_profile_methods.patch

@@ -7,7 +7,7 @@ Electron does not support Profiles, so we need to patch it out of any
 code that we use.
 
 diff --git a/chrome/browser/pdf/chrome_pdf_stream_delegate.cc b/chrome/browser/pdf/chrome_pdf_stream_delegate.cc
-index bd19708922b3d9224cc3a05f515c455ce4fb1e69..7198d9f9b22c8725c7ecdf6931ff36859ffaf506 100644
+index c390a83277f564f1a67a7dcffa36b9d77a35bc0b..b13273a4b194ad5e8ca2d1639ebca831f9607b1e 100644
 --- a/chrome/browser/pdf/chrome_pdf_stream_delegate.cc
 +++ b/chrome/browser/pdf/chrome_pdf_stream_delegate.cc
 @@ -45,6 +45,7 @@ namespace {
@@ -27,10 +27,10 @@ index bd19708922b3d9224cc3a05f515c455ce4fb1e69..7198d9f9b22c8725c7ecdf6931ff3685
    //  When the enterprise policy is not set, use finch/feature flag choice.
    return base::FeatureList::IsEnabled(
 diff --git a/chrome/browser/pdf/pdf_extension_util.cc b/chrome/browser/pdf/pdf_extension_util.cc
-index 328abdd79d287225d0e6ec6becc455e169d6e5d0..10e5e702a43dbb70e13d00b48000e0b4cc974e7a 100644
+index 32e9d7e81ee8008b7e8fd491ec16afc01b5ff35e..51213f193cc5977f9f30dd39548eaf012a4857fa 100644
 --- a/chrome/browser/pdf/pdf_extension_util.cc
 +++ b/chrome/browser/pdf/pdf_extension_util.cc
-@@ -248,10 +248,13 @@ bool IsPrintingEnabled(content::BrowserContext* context) {
+@@ -234,10 +234,13 @@ bool IsPrintingEnabled(content::BrowserContext* context) {
  
  #if BUILDFLAG(ENABLE_PDF_INK2)
  bool IsPdfAnnotationsEnabledByPolicy(content::BrowserContext* context) {
@@ -84,7 +84,7 @@ index bc0bad82ebcdceadc505e912ff27202b452fefab..6b77c57fccc4619a1df3b4ed661d2bdd
  
  ProfileSelection ProfileSelections::GetProfileSelection(
 diff --git a/chrome/browser/spellchecker/spellcheck_service.cc b/chrome/browser/spellchecker/spellcheck_service.cc
-index eba2400655be58628ad1dbf37692a963cc031bf8..02da80b42f936f347c9043f4499d9a324bdf43d2 100644
+index 4c52386f9ddf13f1453903cda3954b6c596028f2..8fbb2025d157e58c90c701f9e3478f6c99b88aa1 100644
 --- a/chrome/browser/spellchecker/spellcheck_service.cc
 +++ b/chrome/browser/spellchecker/spellcheck_service.cc
 @@ -21,8 +21,10 @@

patches/chromium/chore_provide_iswebcontentscreationoverridden_with_full_params.patch

@@ -7,10 +7,10 @@ Pending upstream patch, this gives us fuller access to the window.open params
 so that we will be able to decide whether to cancel it or not.
 
 diff --git a/chrome/browser/media/offscreen_tab.cc b/chrome/browser/media/offscreen_tab.cc
-index 047f1258f951f763df2ca0ba355b19d19337826b..9fc7114312212fbe38ddec740b4aebbcd72cb0f8 100644
+index 7a9effeec99682ef063ebe71f209e6ed9fc4cad4..71ef44be47a8665ee36449a38333ddf9cff33ad4 100644
 --- a/chrome/browser/media/offscreen_tab.cc
 +++ b/chrome/browser/media/offscreen_tab.cc
-@@ -285,8 +285,7 @@ bool OffscreenTab::IsWebContentsCreationOverridden(
+@@ -287,8 +287,7 @@ bool OffscreenTab::IsWebContentsCreationOverridden(
      content::SiteInstance* source_site_instance,
      content::mojom::WindowContainerType window_container_type,
      const GURL& opener_url,
@@ -35,7 +35,7 @@ index 231e3595f218aeebe28d0b13ce6182e7a4d6f4e1..609bd205d1cd0404cab3471765bef8b0
        content::RenderFrameHost* requesting_frame,
        const blink::mojom::FullscreenOptions& options) final;
 diff --git a/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc b/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc
-index 7f99bf8c0c79de2cb8a812a7bfe8b4255697444a..d39aee929900cca756a6293b782a44228725f6fc 100644
+index a17c406b59530a8f57f6cb48905a697dd208a41f..0e22e90c1d570eb4c86ac1f24c5a6e9159be8ea1 100644
 --- a/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc
 +++ b/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc
 @@ -80,8 +80,7 @@ class ChromeKeyboardContentsDelegate : public content::WebContentsDelegate,
@@ -49,7 +49,7 @@ index 7f99bf8c0c79de2cb8a812a7bfe8b4255697444a..d39aee929900cca756a6293b782a4422
    }
  
 diff --git a/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc b/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc
-index e4e42249c476ccae58f0ba42e7dbae299f1e36bd..670c30ed4b7f1a07eb4b8abaa95e5a8a9d94bd8d 100644
+index 08c84ca91f7e477e4e8d6370513d90d2fb9801f1..41e04444274f40fdedbf8d97bfd149f2ac682e53 100644
 --- a/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc
 +++ b/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc
 @@ -121,10 +121,9 @@ bool AshWebViewImpl::IsWebContentsCreationOverridden(
@@ -66,7 +66,7 @@ index e4e42249c476ccae58f0ba42e7dbae299f1e36bd..670c30ed4b7f1a07eb4b8abaa95e5a8a
                                  /*from_user_gesture=*/true);
      return true;
 diff --git a/chrome/browser/ui/ash/web_view/ash_web_view_impl.h b/chrome/browser/ui/ash/web_view/ash_web_view_impl.h
-index 39fa45f0a0f9076bd7ac0be6f455dd540a276512..3d0381d463eed73470b28085830f2a23751659a7 100644
+index b6582b4013d9682d32bd524b4053b443a4df00f8..afcbce72e0f247b4d5a637b27c9f25d913cfa14b 100644
 --- a/chrome/browser/ui/ash/web_view/ash_web_view_impl.h
 +++ b/chrome/browser/ui/ash/web_view/ash_web_view_impl.h
 @@ -60,8 +60,7 @@ class AshWebViewImpl : public ash::AshWebView,
@@ -80,20 +80,20 @@ index 39fa45f0a0f9076bd7ac0be6f455dd540a276512..3d0381d463eed73470b28085830f2a23
        content::WebContents* source,
        const content::OpenURLParams& params,
 diff --git a/chrome/browser/ui/browser.cc b/chrome/browser/ui/browser.cc
-index 78a55026a56c5c2846c7cf13a6080456f8022ddc..f507a45212491b46954e1e30f8fc8c525aff0b25 100644
+index 00cea7307c68c3d8ae93f5ed6df33cef9065fe7b..c2a3892b0ade29d59b06753fdc84f44dc0890f39 100644
 --- a/chrome/browser/ui/browser.cc
 +++ b/chrome/browser/ui/browser.cc
-@@ -2378,7 +2378,8 @@ bool Browser::IsWebContentsCreationOverridden(
+@@ -2359,7 +2359,8 @@ bool Browser::IsWebContentsCreationOverridden(
      content::mojom::WindowContainerType window_container_type,
      const GURL& opener_url,
      const std::string& frame_name,
 -    const GURL& target_url) {
 +    const GURL& target_url,
 +    const content::mojom::CreateNewWindowParams& params) {
-   if (HasActorTask(profile(), opener)) {
-     // If an ExecutionEngine is acting on the opener, prevent it from creating a
-     // new WebContents. We'll instead force the navigation to happen in the same
-@@ -2391,7 +2392,7 @@ bool Browser::IsWebContentsCreationOverridden(
+   if (actor::IsActorOperatingOnWebContents(
+           profile(), content::WebContents::FromRenderFrameHost(opener))) {
+     // If an ExecutionEngine is acting on the opener, prevent it from creating
+@@ -2371,7 +2372,7 @@ bool Browser::IsWebContentsCreationOverridden(
    return (window_container_type ==
                content::mojom::WindowContainerType::BACKGROUND &&
            ShouldCreateBackgroundContents(source_site_instance, opener_url,
@@ -103,10 +103,10 @@ index 78a55026a56c5c2846c7cf13a6080456f8022ddc..f507a45212491b46954e1e30f8fc8c52
  
  WebContents* Browser::CreateCustomWebContents(
 diff --git a/chrome/browser/ui/browser.h b/chrome/browser/ui/browser.h
-index 12b5a5ca3603b815182621f81827635667528ca0..0bfd322dd59de0247a7e8bd09b462b943e206f3c 100644
+index 636b265a6813b01a44930ae73655523b739cafd2..23dad43a14673966af3002263b03bb0cfb91e8f6 100644
 --- a/chrome/browser/ui/browser.h
 +++ b/chrome/browser/ui/browser.h
-@@ -943,8 +943,7 @@ class Browser : public TabStripModelObserver,
+@@ -946,8 +946,7 @@ class Browser : public TabStripModelObserver,
        content::SiteInstance* source_site_instance,
        content::mojom::WindowContainerType window_container_type,
        const GURL& opener_url,
@@ -145,10 +145,10 @@ index 3fc06be01f20e8cd314d95d73a3f58c2f0742fe9..c07910ae59a185442f37ea6e7b96fdf3
    // The profile used for the presentation.
    raw_ptr<Profile, DanglingUntriaged> otr_profile_;
 diff --git a/chrome/browser/ui/views/hats/hats_next_web_dialog.cc b/chrome/browser/ui/views/hats/hats_next_web_dialog.cc
-index 3bbd4e568ba99245622a96f0801d2b6cd203025f..1e0b7d16b33daed980961dd49c667a3b254c186f 100644
+index 08b9f7ad8544011ee1cbb9bc9857ea06e2fa2c0b..69f666bdc05662bc40e133022b5364cbbbbbdb39 100644
 --- a/chrome/browser/ui/views/hats/hats_next_web_dialog.cc
 +++ b/chrome/browser/ui/views/hats/hats_next_web_dialog.cc
-@@ -104,8 +104,7 @@ class HatsNextWebDialog::HatsWebView : public views::WebView {
+@@ -103,8 +103,7 @@ class HatsNextWebDialog::HatsWebView : public views::WebView {
        content::SiteInstance* source_site_instance,
        content::mojom::WindowContainerType window_container_type,
        const GURL& opener_url,
@@ -159,10 +159,10 @@ index 3bbd4e568ba99245622a96f0801d2b6cd203025f..1e0b7d16b33daed980961dd49c667a3b
    }
    content::WebContents* CreateCustomWebContents(
 diff --git a/components/embedder_support/android/delegate/web_contents_delegate_android.cc b/components/embedder_support/android/delegate/web_contents_delegate_android.cc
-index 279f7501a197380dd63c8fe7827854b16d46e5f7..2b80f1970a067e91794a81fcc19e5be64b6b2944 100644
+index a560d65e113ba4fad4c56d9a2a19df1772079d07..4f621733276141248169b7f5ecc5b6f09140f774 100644
 --- a/components/embedder_support/android/delegate/web_contents_delegate_android.cc
 +++ b/components/embedder_support/android/delegate/web_contents_delegate_android.cc
-@@ -205,14 +205,13 @@ bool WebContentsDelegateAndroid::IsWebContentsCreationOverridden(
+@@ -204,14 +204,13 @@ bool WebContentsDelegateAndroid::IsWebContentsCreationOverridden(
      content::SiteInstance* source_site_instance,
      content::mojom::WindowContainerType window_container_type,
      const GURL& opener_url,
@@ -180,10 +180,10 @@ index 279f7501a197380dd63c8fe7827854b16d46e5f7..2b80f1970a067e91794a81fcc19e5be6
                                                                    java_gurl);
  }
 diff --git a/components/embedder_support/android/delegate/web_contents_delegate_android.h b/components/embedder_support/android/delegate/web_contents_delegate_android.h
-index 261d38394a9ff6f81848b94d6b183b2062c37ba9..0c6a26599bb8fef6f9ee6180fc0a98760d857b19 100644
+index a13f342976cb57b091ebfc95538f9ef91bb9e6fa..40506e913c0506e38cd141a46468a7669d6c2093 100644
 --- a/components/embedder_support/android/delegate/web_contents_delegate_android.h
 +++ b/components/embedder_support/android/delegate/web_contents_delegate_android.h
-@@ -78,8 +78,7 @@ class WebContentsDelegateAndroid : public content::WebContentsDelegate {
+@@ -84,8 +84,7 @@ class WebContentsDelegateAndroid : public content::WebContentsDelegate {
        content::SiteInstance* source_site_instance,
        content::mojom::WindowContainerType window_container_type,
        const GURL& opener_url,
@@ -222,10 +222,10 @@ index b969f1d97b7e3396119b579cfbe61e19ff7d2dd4..b8d6169652da28266a514938b45b39c5
    content::WebContents* AddNewContents(
        content::WebContents* source,
 diff --git a/content/browser/web_contents/web_contents_impl.cc b/content/browser/web_contents/web_contents_impl.cc
-index 6efc40408fb64d4e4c4e6671b606912edc013a41..35fe43c6ac99666d070036f7d862529ad364a359 100644
+index 4e2e910c62534106209758a0e5aeb329cfbaa529..b7967a4ab1c9d2c7b2a49a610af10190bcd6e0f0 100644
 --- a/content/browser/web_contents/web_contents_impl.cc
 +++ b/content/browser/web_contents/web_contents_impl.cc
-@@ -5284,8 +5284,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
+@@ -5232,8 +5232,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
    if (delegate_ &&
        delegate_->IsWebContentsCreationOverridden(
            opener, source_site_instance, params.window_container_type,
@@ -236,10 +236,10 @@ index 6efc40408fb64d4e4c4e6671b606912edc013a41..35fe43c6ac99666d070036f7d862529a
          static_cast<WebContentsImpl*>(delegate_->CreateCustomWebContents(
              opener, source_site_instance, is_new_browsing_instance,
 diff --git a/content/public/browser/web_contents_delegate.cc b/content/public/browser/web_contents_delegate.cc
-index df972f1ce594f2d4651202b650ff2d41fe19ecd0..a92305042eef86fbabeae6fe02b48668a349be99 100644
+index 80d004eb9060e33af9e60b31a862a7dcecb254e8..ea179bdf3e702fb1d5be55affe3958f77901cd08 100644
 --- a/content/public/browser/web_contents_delegate.cc
 +++ b/content/public/browser/web_contents_delegate.cc
-@@ -160,8 +160,7 @@ bool WebContentsDelegate::IsWebContentsCreationOverridden(
+@@ -155,8 +155,7 @@ bool WebContentsDelegate::IsWebContentsCreationOverridden(
      SiteInstance* source_site_instance,
      mojom::WindowContainerType window_container_type,
      const GURL& opener_url,
@@ -250,10 +250,10 @@ index df972f1ce594f2d4651202b650ff2d41fe19ecd0..a92305042eef86fbabeae6fe02b48668
  }
  
 diff --git a/content/public/browser/web_contents_delegate.h b/content/public/browser/web_contents_delegate.h
-index 38b61d04446736bcc44a412f633c01ed9aca5399..3c982afb1af048618506a36ca3532b15720d8869 100644
+index 6a43f8c30857bfb32867e63d570ad26459af9ae8..97def739ec2418286b76c0039c61b501293c8f5d 100644
 --- a/content/public/browser/web_contents_delegate.h
 +++ b/content/public/browser/web_contents_delegate.h
-@@ -368,8 +368,7 @@ class CONTENT_EXPORT WebContentsDelegate {
+@@ -361,8 +361,7 @@ class CONTENT_EXPORT WebContentsDelegate {
        SiteInstance* source_site_instance,
        mojom::WindowContainerType window_container_type,
        const GURL& opener_url,
@@ -264,7 +264,7 @@ index 38b61d04446736bcc44a412f633c01ed9aca5399..3c982afb1af048618506a36ca3532b15
    // Allow delegate to creates a custom WebContents when
    // WebContents::CreateNewWindow() is called. This function is only called
 diff --git a/extensions/browser/guest_view/app_view/app_view_guest.cc b/extensions/browser/guest_view/app_view/app_view_guest.cc
-index af80323215e2cb6ff7bdb802f8da4bdbe0067f71..187816751bde435e9c622921c457873d4b3172cd 100644
+index 3b1fe9ef59fbcd3684348fb518ce67210a639dc1..dc38462f8e29066bec4970cc820b8d6077106b85 100644
 --- a/extensions/browser/guest_view/app_view/app_view_guest.cc
 +++ b/extensions/browser/guest_view/app_view/app_view_guest.cc
 @@ -153,8 +153,7 @@ bool AppViewGuest::IsWebContentsCreationOverridden(
@@ -300,7 +300,7 @@ index 7695578f626f2a0c7fefae2bc1d5c35e5ac154f2..78958bff12ce41ae5ad77f43279a4b35
        content::RenderFrameHost* opener,
        content::SiteInstance* source_site_instance,
 diff --git a/extensions/browser/guest_view/extension_options/extension_options_guest.cc b/extensions/browser/guest_view/extension_options/extension_options_guest.cc
-index 0ab40dfd23d1071212c4d30d01fa8e7755458d4a..f032127a94c52beb3f509d6ea84c7e55f21084e2 100644
+index 5bd9d59a961a03f3cd3a806bc1af58c3eaee2b58..40d7ae8d6248163524a8c1350b625e107a8ae64a 100644
 --- a/extensions/browser/guest_view/extension_options/extension_options_guest.cc
 +++ b/extensions/browser/guest_view/extension_options/extension_options_guest.cc
 @@ -263,8 +263,7 @@ bool ExtensionOptionsGuest::IsWebContentsCreationOverridden(
@@ -328,7 +328,7 @@ index 56d86e3d1179df2d5f34eb6216989aef2687f49f..236f3ccf8354b156737e03929ee538f9
        content::RenderFrameHost* opener,
        content::SiteInstance* source_site_instance,
 diff --git a/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc b/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc
-index 23705fa50cf79865b68d8352f6ec72444ca5233e..efa5e78ed92464a6d47319f7b2087555d683bd8c 100644
+index 3e689ad6bdb51ccd7419eb87e4ba2cdbf2f1a8e9..c219b456721a43d9dfdf69612909a2d4f82cd33d 100644
 --- a/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc
 +++ b/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc
 @@ -424,8 +424,7 @@ bool MimeHandlerViewGuest::IsWebContentsCreationOverridden(
@@ -356,10 +356,10 @@ index 7eeffdfbda9611806c6f260f0c68f6d84689cb7e..5d8f6d132068d7fabaa52bc61354c71a
        content::RenderFrameHost* opener,
        content::SiteInstance* source_site_instance,
 diff --git a/fuchsia_web/webengine/browser/frame_impl.cc b/fuchsia_web/webengine/browser/frame_impl.cc
-index 44fdb7377fc4d09137d0718de0f960b0d190c99f..46bde9f83510116f8723d400d5947f9cc6ba3ab5 100644
+index fdc6afbf9048fa254d6f361b36765cf95d5eb521..16d297a3f6bde6bc4c038b79a057700aec68b689 100644
 --- a/fuchsia_web/webengine/browser/frame_impl.cc
 +++ b/fuchsia_web/webengine/browser/frame_impl.cc
-@@ -585,8 +585,7 @@ bool FrameImpl::IsWebContentsCreationOverridden(
+@@ -584,8 +584,7 @@ bool FrameImpl::IsWebContentsCreationOverridden(
      content::SiteInstance* source_site_instance,
      content::mojom::WindowContainerType window_container_type,
      const GURL& opener_url,
@@ -384,7 +384,7 @@ index 756d4192271d6a65cfe8e1511737c565b543cb1f..5688f6f745056565c3c01947f741c4d1
                            int opener_render_process_id,
                            int opener_render_frame_id,
 diff --git a/headless/lib/browser/headless_web_contents_impl.cc b/headless/lib/browser/headless_web_contents_impl.cc
-index 617d6cbd13ad3ce5eb9626bb54162e4afdfd24bd..85281656a467262076c081eb974e35590c573dab 100644
+index 1d95f5b521d7ab586fcecda6d6f822b432480367..b534327a8bd5b2c31522339b30caf123734c5cc3 100644
 --- a/headless/lib/browser/headless_web_contents_impl.cc
 +++ b/headless/lib/browser/headless_web_contents_impl.cc
 @@ -208,8 +208,7 @@ class HeadlessWebContentsImpl::Delegate : public content::WebContentsDelegate {
@@ -398,10 +398,10 @@ index 617d6cbd13ad3ce5eb9626bb54162e4afdfd24bd..85281656a467262076c081eb974e3559
          ->options()
          ->block_new_web_contents();
 diff --git a/ui/views/controls/webview/web_dialog_view.cc b/ui/views/controls/webview/web_dialog_view.cc
-index f56882565de72fa9ab660b4a8d86f08c7392becd..439586a03288822bab8f5f21d0c38b678ed52fb6 100644
+index 3a6d0c589ee634b68e929c17ee912a6b1c19b4f6..b13d80623d1fd0d0798cec33cb92f73ed5947ffa 100644
 --- a/ui/views/controls/webview/web_dialog_view.cc
 +++ b/ui/views/controls/webview/web_dialog_view.cc
-@@ -489,8 +489,7 @@ bool WebDialogView::IsWebContentsCreationOverridden(
+@@ -490,8 +490,7 @@ bool WebDialogView::IsWebContentsCreationOverridden(
      content::SiteInstance* source_site_instance,
      content::mojom::WindowContainerType window_container_type,
      const GURL& opener_url,
@@ -412,10 +412,10 @@ index f56882565de72fa9ab660b4a8d86f08c7392becd..439586a03288822bab8f5f21d0c38b67
      return delegate_->HandleShouldOverrideWebContentsCreation();
    }
 diff --git a/ui/views/controls/webview/web_dialog_view.h b/ui/views/controls/webview/web_dialog_view.h
-index 720611a58300a0252d5dd66e1e7c98282dc82646..eb0abf978651266fe7e4d6a8e9af30024fceb7d1 100644
+index 0fa7e807d22f6f04b84f2d949fbdf892b94996bf..b0490ae36c9999a766bbf346e35807740f4f9af6 100644
 --- a/ui/views/controls/webview/web_dialog_view.h
 +++ b/ui/views/controls/webview/web_dialog_view.h
-@@ -167,8 +167,7 @@ class WEBVIEW_EXPORT WebDialogView : public ClientView,
+@@ -168,8 +168,7 @@ class WEBVIEW_EXPORT WebDialogView : public ClientView,
        content::SiteInstance* source_site_instance,
        content::mojom::WindowContainerType window_container_type,
        const GURL& opener_url,

patches/chromium/chore_remove_check_is_test_on_script_injection_tracker.patch

@@ -9,7 +9,7 @@ Electron when a session is non persistent we do not initialize the
 ExtensionSystem, so this check is not relevant for Electron.
 
 diff --git a/extensions/browser/script_injection_tracker.cc b/extensions/browser/script_injection_tracker.cc
-index 8331e06da9055fddd647dbe54051584b101286b0..6a9ddc0060dc272cd4511fc96f358005ad0ee043 100644
+index 09e5575f67c0a7484663d0ecbee5963be622cb8f..b206eca9426491921e6cacfad3fb764d474e7945 100644
 --- a/extensions/browser/script_injection_tracker.cc
 +++ b/extensions/browser/script_injection_tracker.cc
 @@ -177,7 +177,6 @@ std::vector<const UserScript*> GetLoadedDynamicScripts(

patches/chromium/chore_remove_reference_to_chrome_browser_themes.patch

@@ -11,10 +11,10 @@ not need this dependency.
 refs https://chromium-review.googlesource.com/c/chromium/src/+/5573603
 
 diff --git a/chrome/browser/ui/color/BUILD.gn b/chrome/browser/ui/color/BUILD.gn
-index db1a2f393af2b561cb7d13861bc37f81ab3227c8..d371808e1e59e2dbb2da8790a2212cc001caa772 100644
+index fffee1ca3d0ab493c616e18ecdc0a4fb6525f974..11816e864deb4244c4a2d87ccd89c0a5f632a024 100644
 --- a/chrome/browser/ui/color/BUILD.gn
 +++ b/chrome/browser/ui/color/BUILD.gn
-@@ -87,9 +87,6 @@ source_set("mixers") {
+@@ -85,9 +85,6 @@ source_set("mixers") {
      ]
    }
  
@@ -23,4 +23,4 @@ index db1a2f393af2b561cb7d13861bc37f81ab3227c8..d371808e1e59e2dbb2da8790a2212cc0
 -  }
  }
  
- if (!is_android) {
+ if (!is_ios && !is_android) {

patches/chromium/chore_restore_some_deprecated_wrapper_utility_in_gin.patch

@@ -9,10 +9,10 @@ Patch can be removed once cppgc migration is complete
 https://github.com/electron/electron/issues/47922
 
 diff --git a/gin/function_template.h b/gin/function_template.h
-index c80020b2bda2af39b38295dad3c6208cb8294b88..873015289db9709c00c32080e5387d9cdfea1f69 100644
+index 84ab9585240a49048774811718f7ebd6f988e485..f062163cdd81def12fae7e507d18a9133dd0804d 100644
 --- a/gin/function_template.h
 +++ b/gin/function_template.h
-@@ -79,6 +79,7 @@ class GIN_EXPORT CallbackHolderBase {
+@@ -77,6 +77,7 @@ class GIN_EXPORT CallbackHolderBase {
                      CallbackHolderBase* holder);
      ~DisposeObserver() override;
      void OnBeforeDispose(v8::Isolate* isolate) override;
@@ -21,7 +21,7 @@ index c80020b2bda2af39b38295dad3c6208cb8294b88..873015289db9709c00c32080e5387d9c
  
     private:
 diff --git a/gin/isolate_holder.cc b/gin/isolate_holder.cc
-index 1943413560f23c212d98fa1b368204c6e062bab2..bf0053833c782c9bc0187bb093a7ffd81ca9d754 100644
+index 083d59f78c542f4900e1b210a0935276516b894b..e32658e386853e2142c325a60ec385635256b758 100644
 --- a/gin/isolate_holder.cc
 +++ b/gin/isolate_holder.cc
 @@ -225,6 +225,7 @@ void IsolateHolder::WillCreateMicrotasksRunner() {

patches/chromium/command-ismediakey.patch

@@ -39,10 +39,10 @@ index e87c180342b967756efeb701c73207fcee8754f1..42e37564e585987d367921568f0f1d2b
            NOTREACHED();
        }
 diff --git a/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc b/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc
-index ce768e551dd96678c04035503a481d375f5887bd..0cec5e73e4ae4441262461ba3c8446cdd8dc04a0 100644
+index b6985bd63a34c55154fcfae601add6ce6c451704..fb44cc65b1a15c8b69410a2a2cb925a0326bb438 100644
 --- a/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc
 +++ b/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc
-@@ -153,7 +153,8 @@ bool GlobalAcceleratorListenerOzone::StartListeningForAccelerator(
+@@ -147,7 +147,8 @@ bool GlobalAcceleratorListenerOzone::StartListeningForAccelerator(
    const bool registered =
        platform_global_shortcut_listener_->RegisterAccelerator(
            accelerator.key_code(), accelerator.IsAltDown(),
@@ -52,7 +52,7 @@ index ce768e551dd96678c04035503a481d375f5887bd..0cec5e73e4ae4441262461ba3c8446cd
    if (registered) {
      registered_hot_keys_.insert(accelerator);
    }
-@@ -168,14 +169,15 @@ void GlobalAcceleratorListenerOzone::StopListeningForAccelerator(
+@@ -162,14 +163,15 @@ void GlobalAcceleratorListenerOzone::StopListeningForAccelerator(
  
    platform_global_shortcut_listener_->UnregisterAccelerator(
        accelerator.key_code(), accelerator.IsAltDown(), accelerator.IsCtrlDown(),
@@ -70,7 +70,7 @@ index ce768e551dd96678c04035503a481d375f5887bd..0cec5e73e4ae4441262461ba3c8446cd
    int modifiers = 0;
    if (is_alt_down) {
      modifiers |= ui::EF_ALT_DOWN;
-@@ -186,6 +188,9 @@ void GlobalAcceleratorListenerOzone::OnKeyPressed(ui::KeyboardCode key_code,
+@@ -180,6 +182,9 @@ void GlobalAcceleratorListenerOzone::OnKeyPressed(ui::KeyboardCode key_code,
    if (is_shift_down) {
      modifiers |= ui::EF_SHIFT_DOWN;
    }

patches/chromium/crash_allow_setting_more_options.patch

@@ -63,10 +63,10 @@ index 7c890b331be4aaaf20c7efe8a4bcc2f6e9012b7a..c573524d05c07ec67d35046bc8548cc1
    // Used by WebView to sample crashes without generating the unwanted dumps. If
    // the returned value is less than 100, crash dumping will be sampled to that
 diff --git a/components/crash/core/app/crashpad_linux.cc b/components/crash/core/app/crashpad_linux.cc
-index d4d3555891b19d61676465c856055fb04e0168bc..3228888f5449df723f4385a0f2c9b456caa472f0 100644
+index 5d9b3bd5386ecbdb74cc470dbe65308c3afa0a61..dc29a4bedc0533e27affb26367cfcc2c3f9544f3 100644
 --- a/components/crash/core/app/crashpad_linux.cc
 +++ b/components/crash/core/app/crashpad_linux.cc
-@@ -219,6 +219,7 @@ bool PlatformCrashpadInitialization(
+@@ -218,6 +218,7 @@ bool PlatformCrashpadInitialization(
      // where crash_reporter provides it's own values for lsb-release.
      annotations["lsb-release"] = base::GetLinuxDistro();
  #endif
@@ -74,7 +74,7 @@ index d4d3555891b19d61676465c856055fb04e0168bc..3228888f5449df723f4385a0f2c9b456
  
      std::vector<std::string> arguments;
      if (crash_reporter_client->ShouldMonitorCrashHandlerExpensively()) {
-@@ -240,6 +241,13 @@ bool PlatformCrashpadInitialization(
+@@ -239,6 +240,13 @@ bool PlatformCrashpadInitialization(
      }
  #endif
  
@@ -86,10 +86,10 @@ index d4d3555891b19d61676465c856055fb04e0168bc..3228888f5449df723f4385a0f2c9b456
 +    }
 +
      CHECK(client.StartHandler(handler_path, *database_path, metrics_path, url,
-                               annotations, arguments, false, false,
-                               attachments));
+                               annotations, arguments, false, false));
+   } else {
 diff --git a/components/crash/core/app/crashpad_mac.mm b/components/crash/core/app/crashpad_mac.mm
-index 3b131e1fc804a55c80b3b2704686270211fcf9fb..f14ab66f240a236bd90ff4240089a0036ce7d460 100644
+index 42fe73aefe44f218d6a5e8cb1550ff48859c4b70..a1235f0c7ad44ae9c9fdc805af5b9dc5669f5aad 100644
 --- a/components/crash/core/app/crashpad_mac.mm
 +++ b/components/crash/core/app/crashpad_mac.mm
 @@ -86,6 +86,8 @@
@@ -101,7 +101,7 @@ index 3b131e1fc804a55c80b3b2704686270211fcf9fb..f14ab66f240a236bd90ff4240089a003
    return annotations;
  }
  
-@@ -159,6 +161,13 @@ bool PlatformCrashpadInitialization(
+@@ -156,6 +158,13 @@ bool PlatformCrashpadInitialization(
  
        std::vector<std::string> arguments;
  
@@ -116,10 +116,10 @@ index 3b131e1fc804a55c80b3b2704686270211fcf9fb..f14ab66f240a236bd90ff4240089a003
          arguments.push_back("--monitor-self");
        }
 diff --git a/components/crash/core/app/crashpad_win.cc b/components/crash/core/app/crashpad_win.cc
-index a7af39181e259b4c793fa9a39cb95e4f86ac47d1..6101018813315074a1e06bea318ecf3f91188415 100644
+index 5b811cbbc51544cbff7c2e99c3a7ced824990002..f2376d74fbd2c8196184035fc0fb24a0a8ebfe0e 100644
 --- a/components/crash/core/app/crashpad_win.cc
 +++ b/components/crash/core/app/crashpad_win.cc
-@@ -94,6 +94,7 @@ bool PlatformCrashpadInitialization(
+@@ -93,6 +93,7 @@ bool PlatformCrashpadInitialization(
  
      std::map<std::string, std::string> process_annotations;
      GetPlatformCrashpadAnnotations(&process_annotations);
@@ -127,7 +127,7 @@ index a7af39181e259b4c793fa9a39cb95e4f86ac47d1..6101018813315074a1e06bea318ecf3f
  
      std::string url = crash_reporter_client->GetUploadUrl();
  
-@@ -134,6 +135,13 @@ bool PlatformCrashpadInitialization(
+@@ -133,6 +134,13 @@ bool PlatformCrashpadInitialization(
  
      std::vector<std::string> arguments(start_arguments);
  

patches/chromium/create_browser_v8_snapshot_file_name_fuse.patch

@@ -7,10 +7,10 @@ By default, chromium sets up one v8 snapshot to be used in all v8 contexts. This
 to have a dedicated browser process v8 snapshot defined by the file `browser_v8_context_snapshot.bin`.
 
 diff --git a/content/app/content_main_runner_impl.cc b/content/app/content_main_runner_impl.cc
-index 9240e8485a8dc895eb455b1418fc7559e52a5dd5..e9444e765ac8ac595b799be7feeb6a483c6acf9f 100644
+index 46c7c57b5ff40b0e40d66bbeb8ec3f2b7f86cea0..46d144563983dee5a793948d9fd11852fb311088 100644
 --- a/content/app/content_main_runner_impl.cc
 +++ b/content/app/content_main_runner_impl.cc
-@@ -273,8 +273,13 @@ void AsanProcessInfoCB(const char*, bool*) {
+@@ -272,8 +272,13 @@ void AsanProcessInfoCB(const char*, bool*) {
  }
  #endif  // defined(ADDRESS_SANITIZER)
  
@@ -25,7 +25,7 @@ index 9240e8485a8dc895eb455b1418fc7559e52a5dd5..e9444e765ac8ac595b799be7feeb6a48
  #if BUILDFLAG(IS_POSIX) && !BUILDFLAG(IS_MAC)
    base::FileDescriptorStore& file_descriptor_store =
        base::FileDescriptorStore::GetInstance();
-@@ -303,11 +308,12 @@ bool ShouldLoadV8Snapshot(const base::CommandLine& command_line,
+@@ -302,11 +307,12 @@ bool ShouldLoadV8Snapshot(const base::CommandLine& command_line,
  
  #endif  // V8_USE_EXTERNAL_STARTUP_DATA
  
@@ -40,7 +40,7 @@ index 9240e8485a8dc895eb455b1418fc7559e52a5dd5..e9444e765ac8ac595b799be7feeb6a48
  #endif  // V8_USE_EXTERNAL_STARTUP_DATA
  }
  
-@@ -951,7 +957,7 @@ int ContentMainRunnerImpl::Initialize(ContentMainParams params) {
+@@ -950,7 +956,7 @@ int ContentMainRunnerImpl::Initialize(ContentMainParams params) {
      return TerminateForFatalInitializationError();
  #endif  // BUILDFLAG(IS_ANDROID) && (ICU_UTIL_DATA_IMPL == ICU_UTIL_DATA_FILE)
  
@@ -50,7 +50,7 @@ index 9240e8485a8dc895eb455b1418fc7559e52a5dd5..e9444e765ac8ac595b799be7feeb6a48
    blink::TrialTokenValidator::SetOriginTrialPolicyGetter(
        base::BindRepeating([]() -> blink::OriginTrialPolicy* {
 diff --git a/content/public/app/content_main_delegate.cc b/content/public/app/content_main_delegate.cc
-index fee2fab8ab33a3829f055b0408e9e763443016cc..678c636c9ca08f8113dc67aafaf9761f33a7f0e5 100644
+index 8b02f553e2fc29da88c3e14c05a7ee82210eab51..14f2e66d5ecda6e860724a3ab946eaaffba33d6d 100644
 --- a/content/public/app/content_main_delegate.cc
 +++ b/content/public/app/content_main_delegate.cc
 @@ -5,6 +5,7 @@
@@ -73,7 +73,7 @@ index fee2fab8ab33a3829f055b0408e9e763443016cc..678c636c9ca08f8113dc67aafaf9761f
    return new ContentClient();
  }
 diff --git a/content/public/app/content_main_delegate.h b/content/public/app/content_main_delegate.h
-index 8151396412bf6981f3424526386ad6257b8c895d..ac5041c1666ac968251768f604f92434d92e374d 100644
+index db611d99a6c0f18f39967b38791822fda7d175b5..cc150475de655d5ef20a107ae3ef80c08af8c7fb 100644
 --- a/content/public/app/content_main_delegate.h
 +++ b/content/public/app/content_main_delegate.h
 @@ -9,6 +9,7 @@
@@ -84,8 +84,8 @@ index 8151396412bf6981f3424526386ad6257b8c895d..ac5041c1666ac968251768f604f92434
  #include <vector>
  
  #include "base/notreached.h"
-@@ -181,6 +182,8 @@ class CONTENT_EXPORT ContentMainDelegate {
-   virtual bool ShouldInitializePerfetto(InvokedIn invoked_in);
+@@ -174,6 +175,8 @@ class CONTENT_EXPORT ContentMainDelegate {
+   virtual bool ShouldHandleConsoleControlEvents();
  #endif
  
 +  virtual std::string_view GetBrowserV8SnapshotFilename();

patches/chromium/custom_protocols_plzserviceworker.patch

@@ -8,10 +8,10 @@ Allow registering custom protocols to handle service worker main script fetching
 Refs https://bugs.chromium.org/p/chromium/issues/detail?id=996511
 
 diff --git a/content/browser/service_worker/service_worker_context_wrapper.cc b/content/browser/service_worker/service_worker_context_wrapper.cc
-index cdd2f243082290767abbee39b4e80a67c705a789..7168d496663675455b417f709339aab08aabc9f0 100644
+index 25c9e17bd063cc07fd2727474395a9276c4a000d..413f3019bd55388e8ebc8fe39af766b7c61e9924 100644
 --- a/content/browser/service_worker/service_worker_context_wrapper.cc
 +++ b/content/browser/service_worker/service_worker_context_wrapper.cc
-@@ -1972,6 +1972,26 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
+@@ -1957,6 +1957,26 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
        loader_factory_bundle_info =
            context()->loader_factory_bundle_for_update_check()->Clone();
  
@@ -38,9 +38,9 @@ index cdd2f243082290767abbee39b4e80a67c705a789..7168d496663675455b417f709339aab0
    if (auto* config = content::WebUIConfigMap::GetInstance().GetConfig(
            browser_context(), scope)) {
      // If this is a Service Worker for a WebUI, the WebUI's URLDataSource
-@@ -1991,9 +2011,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
+@@ -1976,9 +1996,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
              features::kEnableServiceWorkersForChromeScheme) &&
-         scope.scheme() == kChromeUIScheme) {
+         scope.scheme_piece() == kChromeUIScheme) {
        config->RegisterURLDataSource(browser_context());
 -      static_cast<blink::PendingURLLoaderFactoryBundle*>(
 -          loader_factory_bundle_info.get())
@@ -49,9 +49,9 @@ index cdd2f243082290767abbee39b4e80a67c705a789..7168d496663675455b417f709339aab0
            .emplace(kChromeUIScheme, CreateWebUIServiceWorkerLoaderFactory(
                                          browser_context(), kChromeUIScheme,
                                          base::flat_set<std::string>()));
-@@ -2001,9 +2019,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
+@@ -1986,9 +2004,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
                     features::kEnableServiceWorkersForChromeUntrusted) &&
-                scope.scheme() == kChromeUIUntrustedScheme) {
+                scope.scheme_piece() == kChromeUIUntrustedScheme) {
        config->RegisterURLDataSource(browser_context());
 -      static_cast<blink::PendingURLLoaderFactoryBundle*>(
 -          loader_factory_bundle_info.get())

patches/chromium/desktop_media_list.patch

@@ -82,10 +82,10 @@ index 786c526588d81b8b5b1b5dd3760719a53e005995..f66b7d0b4dfcbb8ed3dde5a9ff463ae2
    const Source& GetSource(int index) const override;
    DesktopMediaList::Type GetMediaListType() const override;
 diff --git a/chrome/browser/media/webrtc/native_desktop_media_list.cc b/chrome/browser/media/webrtc/native_desktop_media_list.cc
-index 3be638f1032815d39634b5725031d7f3124e1ad2..fce3e30bc736ac72a42d24956d4abf9f49c8fc41 100644
+index 4383a2dd4a132e3012c206404399d73ac2d40ad4..912921c2b448e2badac50e8a7ed527aeb8f433a9 100644
 --- a/chrome/browser/media/webrtc/native_desktop_media_list.cc
 +++ b/chrome/browser/media/webrtc/native_desktop_media_list.cc
-@@ -216,9 +216,13 @@ content::DesktopMediaID::Id GetUpdatedWindowId(
+@@ -214,9 +214,13 @@ content::DesktopMediaID::Id GetUpdatedWindowId(
      }
    }
  #elif BUILDFLAG(IS_MAC)
@@ -99,7 +99,7 @@ index 3be638f1032815d39634b5725031d7f3124e1ad2..fce3e30bc736ac72a42d24956d4abf9f
  #endif
  
    return window_id;
-@@ -321,7 +325,7 @@ class NativeDesktopMediaList::Worker
+@@ -319,7 +323,7 @@ class NativeDesktopMediaList::Worker
    base::WeakPtr<NativeDesktopMediaList> media_list_;
  
    DesktopMediaID::Type source_type_;
@@ -108,7 +108,7 @@ index 3be638f1032815d39634b5725031d7f3124e1ad2..fce3e30bc736ac72a42d24956d4abf9f
    const ThumbnailCapturer::FrameDeliveryMethod frame_delivery_method_;
    const bool add_current_process_windows_;
    const bool auto_show_delegated_source_list_;
-@@ -603,6 +607,12 @@ void NativeDesktopMediaList::Worker::RefreshNextThumbnail() {
+@@ -601,6 +605,12 @@ void NativeDesktopMediaList::Worker::RefreshNextThumbnail() {
        FROM_HERE,
        base::BindOnce(&NativeDesktopMediaList::UpdateNativeThumbnailsFinished,
                       media_list_));
@@ -121,7 +121,7 @@ index 3be638f1032815d39634b5725031d7f3124e1ad2..fce3e30bc736ac72a42d24956d4abf9f
  }
  
  void NativeDesktopMediaList::Worker::OnCaptureResult(
-@@ -1009,6 +1019,11 @@ void NativeDesktopMediaList::RefreshForVizFrameSinkWindows(
+@@ -1008,6 +1018,11 @@ void NativeDesktopMediaList::RefreshForVizFrameSinkWindows(
          FROM_HERE, base::BindOnce(&Worker::RefreshThumbnails,
                                    base::Unretained(worker_.get()),
                                    std::move(native_ids), thumbnail_size_));