Compare commits

..

214 Commits

Author SHA1 Message Date
Soobin Rho
1234b4cbb8 docs: clearer wording (performance common pitfalls)
Signed-off-by: Soobin Rho <soobinrho@gmail.com>
2025-12-01 20:02:10 -06:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
595 changed files with 30050 additions and 17985 deletions

View File

@@ -1,3 +1,6 @@
> [!IMPORTANT]
> Please note that code reviews and merges will be delayed during our [quiet period in December](https://www.electronjs.org/blog/dec-quiet-period-25) and might not happen until January.
#### Description of Change
<!--

View File

@@ -60,14 +60,28 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
if [ "$TARGET_PLATFORM" = "win" ]; then
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
else
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
fi
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -75,11 +89,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -89,7 +102,6 @@ runs:
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
e build --target electron:electron_mksnapshot_zip
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -123,7 +135,6 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
@@ -133,11 +144,6 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -157,17 +163,11 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -180,18 +180,6 @@ runs:
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip
e build --target electron:libcxxabi_headers_zip
e build --target electron:libcxx_objects_zip
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
@@ -200,7 +188,7 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash

View File

@@ -152,7 +152,7 @@ runs:
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
npx node src/electron/script/patches-stats.mjs --upload-stats || true
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD
@@ -172,7 +172,6 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

View File

@@ -17,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -60,18 +62,28 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=c13f4bdb50e65da46a4703f8f882079dd21fd99e
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -6,7 +6,7 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
id: yarn-cache
with:
@@ -18,4 +18,14 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

View File

@@ -3,19 +3,23 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Setting Up Dig Site
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
@@ -41,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -16,15 +16,25 @@ jobs:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444 # v5.0.0
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- name: Sparse checkout repository
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
@@ -73,6 +83,8 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -6,9 +6,13 @@ on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root
@@ -19,7 +23,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -30,6 +34,8 @@ jobs:
build-git-cache-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -41,7 +47,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -52,6 +58,8 @@ jobs:
build-git-cache-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
@@ -64,7 +72,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -43,10 +43,13 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -54,7 +57,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -63,6 +66,10 @@ jobs:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
@@ -80,6 +87,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
@@ -89,6 +98,8 @@ jobs:
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
@@ -98,6 +109,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -111,7 +124,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -126,6 +139,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -141,7 +156,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -155,6 +170,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -171,7 +188,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -185,16 +202,20 @@ jobs:
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
@@ -207,6 +228,8 @@ jobs:
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
@@ -225,7 +248,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
@@ -244,7 +267,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
@@ -310,7 +333,7 @@ jobs:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -400,6 +423,8 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
steps:

View File

@@ -1,16 +1,20 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -31,6 +32,8 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -72,7 +75,7 @@ jobs:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@9861779a695cf1898bd984c727f685f351cfc372 # v3.7.2
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,6 +11,7 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -28,6 +29,7 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -35,18 +37,29 @@ jobs:
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -77,7 +90,6 @@ jobs:
labelExists = true;
} catch {}
const { ElectronVersions } = await import('${{ github.workspace }}/node_modules/@electron/fiddle-core/dist/index.js');
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
@@ -134,7 +146,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@9861779a695cf1898bd984c727f685f351cfc372 # v3.7.2
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -10,6 +10,7 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels

View File

@@ -17,9 +17,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -31,7 +35,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -40,6 +44,8 @@ jobs:
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-linux
with:
environment: production-release
@@ -55,6 +61,8 @@ jobs:
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-linux
with:
environment: production-release
@@ -70,6 +78,8 @@ jobs:
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-linux
with:
environment: production-release

104
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,104 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -32,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -44,10 +48,12 @@ jobs:
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -59,10 +65,12 @@ jobs:
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -74,10 +82,12 @@ jobs:
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -89,10 +99,12 @@ jobs:
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -64,14 +64,13 @@ concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -86,6 +85,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
@@ -19,11 +21,13 @@ jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -50,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -19,11 +21,13 @@ jobs:
lint:
name: Lint
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -74,11 +78,11 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json

View File

@@ -59,6 +59,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -66,6 +68,7 @@ concurrency:
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
@@ -80,16 +83,19 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -113,9 +119,9 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
@@ -157,7 +163,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -35,10 +35,7 @@ concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -53,6 +50,10 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
@@ -68,11 +69,12 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
@@ -110,11 +112,6 @@ jobs:
configure_sys_tccdb "$values"
fi
done
# Ref: https://github.com/getsentry/sentry-cocoa/blob/main/scripts/ci-enable-permissions.sh
if [ "$OSTYPE" = "darwin24" ]; then
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
fi
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
@@ -122,11 +119,17 @@ jobs:
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
@@ -165,43 +168,36 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
Expand-Archive -Force chromedriver.zip -DestinationPath ./
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
- name: Run Electron Tests
shell: bash
env:
@@ -227,7 +223,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -244,9 +240,14 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
- name: Upload Test results to Datadog
@@ -258,13 +259,14 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -39,6 +41,8 @@ jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +97,8 @@ jobs:
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +138,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

View File

@@ -11,6 +11,7 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
@@ -19,12 +20,16 @@ jobs:
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@f1f6e5f6af878fb37288ce1c627459e94dbf7d01 # v3.29.5
uses: github/codeql-action/upload-sarif@fdbfb4d2750291e159f0156def62b853c2798ca2 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:

View File

@@ -11,6 +11,7 @@ jobs:
check-stable-prep-items:
name: Check Stable Prep Items
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -10,13 +10,14 @@ permissions: {}
jobs:
stale:
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,10 +28,11 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
permissions: {}
if: ${{ always() }}
needs: stale
steps:
@@ -39,7 +41,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -36,7 +40,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -48,6 +52,8 @@ jobs:
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-windows
with:
environment: production-release
@@ -62,6 +68,8 @@ jobs:
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-windows
with:
environment: production-release
@@ -76,6 +84,8 @@ jobs:
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-windows
with:
environment: production-release

2
.gitignore vendored
View File

@@ -53,3 +53,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

2
.nvmrc
View File

@@ -1 +1 @@
20
22

942
.yarn/releases/yarn-4.11.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

12
.yarnrc.yml Normal file
View File

@@ -0,0 +1,12 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
yarnPath: .yarn/releases/yarn-4.11.0.cjs

View File

@@ -480,6 +480,7 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
@@ -586,7 +587,13 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -755,11 +762,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]
@@ -1619,6 +1628,29 @@ group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"

13
DEPS
View File

@@ -2,17 +2,17 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'141.0.7390.7',
'144.0.7527.0',
'node_version':
'v22.19.0',
'v24.11.1',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
'74ab5baccc6f7202c8ac69a8d1e152c29dc1ea76',
'mantle_version':
'78d3966b3c331292ea29ec38661b25df0a245948',
'2a8e2123a3931038179ee06105c9e6ec336b12ea',
'engflow_reclient_configs_version':
'955335c30a752e9ef7bff375baab5e0819b6c00d',
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.22.22',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -155,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.11.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -37,9 +37,9 @@ For more installation options and troubleshooting tips, see
Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* macOS (Monterey and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 140
node_module_version = 143
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"
@@ -19,15 +19,15 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false
dawn_enable_vulkan_validation_layers = false
# Removes dxc dll's that are only used experimentally.
# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
dawn_use_built_dxc = false
# These are disabled because they cause the zip manifest to differ between
# testing and release builds.
# See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.
@@ -72,3 +72,6 @@ enterprise_cloud_content_analysis = false
# We don't use anything from here, and it causes target collisions
enable_linux_installer = false
# Disable "Save to Drive" feature in PDF viewer
enable_pdf_save_to_drive = false

View File

@@ -383,6 +383,8 @@ static_library("chrome") {
"//chrome/browser/pdf/chrome_pdf_stream_delegate.h",
"//chrome/browser/pdf/pdf_extension_util.cc",
"//chrome/browser/pdf/pdf_extension_util.h",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.cc",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.h",
"//chrome/browser/pdf/pdf_viewer_stream_manager.cc",
"//chrome/browser/pdf/pdf_viewer_stream_manager.h",
"//chrome/browser/plugins/pdf_iframe_navigation_throttle.cc",
@@ -391,6 +393,8 @@ static_library("chrome") {
deps += [
"//components/pdf/browser",
"//components/pdf/renderer",
"//ui/base/interaction",
"//ui/webui/resources/cr_components/help_bubble:mojo_bindings",
]
}
} else {

View File

@@ -421,6 +421,7 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.
@@ -564,8 +565,9 @@ and subscribing to the `ready` event if the app is not ready yet.
* `steal` boolean _macOS_ - Make the receiver the active app even if another app is
currently active.
On Linux, focuses on the first visible window. On macOS, makes the application
the active app. On Windows, focuses on the application's first window.
On macOS, makes the application the active app. On Windows, focuses on the application's
first window. On Linux, either focuses on the first visible window (X11) or requests
focus but may instead show a notification or flash the app icon (Wayland).
You should seek to use the `steal` option as sparingly as possible.
@@ -1214,6 +1216,13 @@ Disables hardware acceleration for current app.
This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently enabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.
### `app.disableDomainBlockingFor3DAPIs()`
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
@@ -1397,7 +1406,75 @@ details. Disabled by default.
This API must be called after the `ready` event is emitted.
> [!NOTE]
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
Notes:
* The array may be empty if no accessibility modes are active.
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
prefer this method for granular diagnostics or telemetry.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
// Change some app UI to better work with Screen Readers.
}
})
```
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
* `features` string[] - An array of the accessibility features to enable.
Possible values are:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
To disable all supported features, pass an empty array `[]`.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
// Enable a subset of features:
app.setAccessibilitySupportFeatures([
'screenReader',
'pdfPrinting',
'webContents'
])
// Other logic
// Some time later, disable all features:
app.setAccessibilitySupportFeatures([])
})
```
### `app.showAboutPanel()`

View File

@@ -1262,15 +1262,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1284,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -140,6 +140,10 @@ state is `hidden` in order to minimize power consumption.
move.
* On Linux the type of modal windows will be changed to `dialog`.
* On Linux many desktop environments do not support hiding a modal window.
* On Wayland (Linux) it is generally not possible to programmatically resize windows
after creation, or to position, move, focus, or blur windows without user input.
If your app needs these capabilities, run it in Xwayland by appending the flag
`--ozone-platform=x11`.
## Class: BrowserWindow extends `BaseWindow`
@@ -656,10 +660,15 @@ the [close event](#event-close).
Focuses on the window.
On Wayland (Linux), the desktop environment may show a notification or flash
the app icon if the window or app is not already focused.
#### `win.blur()`
Removes focus from the window.
Not supported on Wayland (Linux).
#### `win.isFocused()`
Returns `boolean` - Whether the window is focused.
@@ -676,6 +685,8 @@ Shows and gives focus to the window.
Shows the window but doesn't focus on it.
Not supported on Wayland (Linux).
#### `win.hide()`
Hides the window.
@@ -824,6 +835,8 @@ Closes the currently open [Quick Look][quick-look] panel.
Resizes and moves the window to the supplied bounds. Any properties that are not supplied will default to their current values.
On Wayland (Linux), has the same limitations as `setSize` and `setPosition`.
```js
const { BrowserWindow } = require('electron')
@@ -866,6 +879,8 @@ See [Setting `backgroundColor`](#setting-the-backgroundcolor-property).
Resizes and moves the window's client area (e.g. the web page) to
the supplied bounds.
On Wayland (Linux), has the same limitations as `setContentSize` and `setPosition`.
#### `win.getContentBounds()`
Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window's client area as `Object`.
@@ -895,6 +910,8 @@ Returns `boolean` - whether the window is enabled.
Resizes the window to `width` and `height`. If `width` or `height` are below any set minimum size constraints the window will snap to its minimum size.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getSize()`
Returns `Integer[]` - Contains the window's width and height.
@@ -907,6 +924,8 @@ Returns `Integer[]` - Contains the window's width and height.
Resizes the window's client area (e.g. the web page) to `width` and `height`.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getContentSize()`
Returns `Integer[]` - Contains the window's client area's width and height.
@@ -1044,12 +1063,16 @@ this method throws an error.
#### `win.moveTop()`
Moves window to top(z-order) regardless of focus
Moves window to top(z-order) regardless of focus.
Not supported on Wayland (Linux).
#### `win.center()`
Moves window to the center of the screen.
Not supported on Wayland (Linux).
#### `win.setPosition(x, y[, animate])`
* `x` Integer
@@ -1058,6 +1081,8 @@ Moves window to the center of the screen.
Moves window to `x` and `y`.
Not supported on Wayland (Linux).
#### `win.getPosition()`
Returns `Integer[]` - Contains the window's current position.
@@ -1227,7 +1252,8 @@ Captures a snapshot of the page within `rect`. Omitting `rect` will capture the
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see [`did-fail-load`](web-contents.md#event-did-fail-load)).
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Same as [`webContents.loadURL(url[, options])`](web-contents.md#contentsloadurlurl-options).
@@ -1442,15 +1468,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1463,11 +1490,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_
@@ -1570,11 +1600,18 @@ events.
Prevents the window contents from being captured by other apps.
On macOS it sets the NSWindow's [`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc) to [`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
On Windows it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
On Windows, it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
For Windows 10 version 2004 and up the window will be removed from capture entirely,
older Windows versions behave as if `WDA_MONITOR` is applied capturing a black window.
On macOS, it sets the `NSWindow`'s
[`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc)
to
[`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
Unfortunately, due to an intentional change in macOS, newer Mac applications that use
`ScreenCaptureKit` will capture your window despite `win.setContentProtection(true)`.
See [here](https://github.com/electron/electron/issues/48258#issuecomment-3269893618).
#### `win.isContentProtected()` _macOS_ _Windows_
Returns `boolean` - whether or not content protection is currently enabled.

View File

@@ -25,6 +25,11 @@ following properties:
with which the request is associated. Defaults to the empty string. The
`session` option supersedes `partition`. Thus if a `session` is explicitly
specified, `partition` is ignored.
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
custom protocol handlers registered for the request's URL scheme will not be
called. This allows forwarding an intercepted request to the built-in
handler. [webRequest](web-request.md) handlers will still be triggered
when bypassing custom protocols. Defaults to `false`.
* `credentials` string (optional) - Can be `include`, `omit` or
`same-origin`. Whether to send
[credentials](https://fetch.spec.whatwg.org/#credentials) with this

View File

@@ -2,7 +2,16 @@
> Perform copy and paste operations on the system clipboard.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) _Deprecated_ (non-sandboxed only)
> [!NOTE]
> Using the `clipoard` API from the renderer process is deprecated.
> [!IMPORTANT]
> If you want to call this API from a renderer process,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
On Linux, there is also a `selection` clipboard. To manipulate it
you need to pass `selection` to each method:

View File

@@ -49,6 +49,10 @@ Disables the disk cache for HTTP requests.
Disable HTTP/2 and SPDY/3.1 protocols.
### --disable-geolocation _macOS_
Disables the Geolocation API. Permission requests for geolocation will be denied internally regardless of the decision made by a handler set via `session.setPermissionRequestHandler`. This functionality is currently implemented only for macOS. Has no effect on other platforms.
### --disable-renderer-backgrounding
Prevents Chromium from lowering the priority of invisible pages' renderer
@@ -193,6 +197,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The following is an example of setting up Electron to automatically submit
crash reports to a remote server:

View File

@@ -102,6 +102,10 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
## Caveats
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -186,14 +186,3 @@ the one downloaded by `npm install`. Usage:
```sh
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
## Set By Electron
Electron sets some variables in your environment at runtime.
### `ORIGINAL_XDG_CURRENT_DESKTOP`
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
to affect other logic within Chromium so if you want access to the _original_ value
you should look up this environment variable instead.

View File

@@ -20,6 +20,12 @@ changes:
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `ipcRenderer` module is an [EventEmitter][event-emitter]. It provides a few
methods so you can send synchronous and asynchronous messages from the render
process (web page) to the main process. You can also receive replies from the

View File

@@ -34,7 +34,8 @@ See [`Menu`](menu.md) for examples.
* `sublabel` string (optional) _macOS_ - Available in macOS >= 14.4
* `toolTip` string (optional) _macOS_ - Hover text for this menu item.
* `accelerator` string (optional) - An [Accelerator](../tutorial/keyboard-shortcuts.md#accelerators) string.
* `icon` ([NativeImage](native-image.md) | string) (optional)
* `icon` ([NativeImage](native-image.md) | string) (optional) - Can be a
[NativeImage](native-image.md) or the file path of an icon.
* `enabled` boolean (optional) - If false, the menu item will be greyed out and
unclickable.
* `acceleratorWorksWhenHidden` boolean (optional) _macOS_ - default is `true`, and when `false` will prevent the accelerator from triggering the item if the item is not visible.

View File

@@ -2,10 +2,15 @@
## Class: Menu
> Create native application menus and context menus.
> Create application menus and context menus.
Process: [Main](../glossary.md#main-process)
The presentation of menus varies depending on the operating system:
- Under Windows and Linux, menus are visually similar to Chromium.
- Under macOS, these will be native menus.
> [!TIP]
> See also: [A detailed guide about how to implement menus in your application](../tutorial/menus.md).

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `nativeImage` module provides a unified interface for manipulating
system images. These can be handy if you want to provide multiple scaled
versions of the same icon or take advantage of macOS [template images][template-image].
@@ -196,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
Returns `NativeImage`
Creates a new `NativeImage` instance from the `NSImage` that maps to the
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
documentation for a list of possible values.
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
The `hslShift` is applied to the image with the following rules:
@@ -225,6 +230,15 @@ echo -e '#import <Cocoa/Cocoa.h>\nint main() { NSLog(@"%@", SYSTEM_IMAGE_NAME);
where `SYSTEM_IMAGE_NAME` should be replaced with any value from [this list](https://developer.apple.com/documentation/appkit/nsimagename?language=objc).
For SF Symbols, usage looks as follows:
```js
const image = nativeImage.createFromNamedImage('square.and.pencil')
```
where `'square.and.pencil'` is the symbol name from the
[SF Symbols app](https://developer.apple.com/sf-symbols/).
## Class: NativeImage
> Natively wrap images such as tray, dock, and application icons.

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session

View File

@@ -0,0 +1,58 @@
# sharedTexture
> Import shared textures into Electron and converts platform specific handles into [`VideoFrame`](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame). Supports all Web rendering systems, and can be transferred across Electron processes. Read [here](https://github.com/electron/electron/blob/main/shell/common/api/shared_texture/README.md) for more information.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
## Methods
The `sharedTexture` module has the following methods:
**Note:** Experimental APIs are marked as such and could be removed in the future.
### `sharedTexture.importSharedTexture(options)` _Experimental_
* `options` Object - Options for importing shared textures.
* `textureInfo` [SharedTextureImportTextureInfo](structures/shared-texture-import-texture-info.md) - The information of the shared texture to import.
* `allReferencesReleased` Function (optional) - Called when all references in all processes are released. You should keep the imported texture valid until this callback is called.
Imports the shared texture from the given options.
> [!NOTE]
> This method is only available in the main process.
Returns `SharedTextureImported` - The imported shared texture.
### `sharedTexture.sendSharedTexture(options, ...args)` _Experimental_
* `options` Object - Options for sending shared texture.
* `frame` [WebFrameMain](web-frame-main.md) - The target frame to transfer the shared texture to. For `WebContents`, you can pass `webContents.mainFrame`. If you provide a `webFrameMain` that is not a main frame, you'll need to enable `webPreferences.nodeIntegrationInSubFrames` for this, since this feature requires [IPC](https://www.electronjs.org/docs/latest/api/web-frame-main#frameipc-readonly) between main and the frame.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments to pass to the renderer process.
Send the imported shared texture to a renderer process. You must register a receiver at renderer process before calling this method. This method has a 1000ms timeout. Ensure the receiver is set and the renderer process is alive before calling this method.
> [!NOTE]
> This method is only available in the main process.
Returns `Promise<void>` - Resolves when the transfer is complete.
### `sharedTexture.setSharedTextureReceiver(callback)` _Experimental_
* `callback` Function\<Promise\<void\>\> - The function to receive the imported shared texture.
* `receivedSharedTextureData` Object - The data received from the main process.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments passed from the main process.
Set a callback to receive imported shared textures from the main process.
> [!NOTE]
> This method is only available in the renderer process.
## Properties
The `sharedTexture` module has the following properties:
### `sharedTexture.subtle` _Experimental_
A [`SharedTextureSubtle`](structures/shared-texture-subtle.md) property, provides subtle APIs for interacting with shared texture for advanced users.

View File

@@ -72,6 +72,9 @@
some GTK+3 desktop environments. Default is `false`.
* `transparent` boolean (optional) - Makes the window [transparent](../../tutorial/custom-window-styles.md#transparent-windows).
Default is `false`. On Windows, does not work unless the window is frameless.
When you add a [`View`](../view.md) to a `BaseWindow`, you'll need to call
[`view.setBackgroundColor`](../view.md#viewsetbackgroundcolorcolor) with a transparent
background color on that view to make its background transparent as well.
* `type` string (optional) - The type of window, default is normal window. See more about
this below.
* `visualEffectState` string (optional) _macOS_ - Specify how the material
@@ -102,9 +105,10 @@
should have rounded corners. Default is `true`. Setting this property
to `false` will prevent the window from being fullscreenable on macOS.
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
* `thickFrame` boolean (optional) - Use `WS_THICKFRAME` style for frameless windows on
Windows, which adds standard window frame. Setting it to `false` will remove
window shadow and window animations. Default is `true`.
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
frameless windows on Windows, which adds the standard window frame. Setting it
to `false` will remove window shadow and window animations, and disable window
resizing via dragging the window edges. Default is `true`.
* `vibrancy` string (optional) _macOS_ - Add a type of vibrancy effect to
the window, only on macOS. Can be `appearance-based`, `titlebar`, `selection`,
`menu`, `popover`, `sidebar`, `header`, `sheet`, `window`, `hud`, `fullscreen-ui`,

View File

@@ -2,7 +2,10 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.

View File

@@ -8,6 +8,7 @@
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` Integer - The exit code of the process, unless `reason` is
`launch-failed`, in which case `exitCode` will be a platform-specific
launch failure error code.

View File

@@ -0,0 +1,12 @@
# SharedTextureImportTextureInfo Object
* `pixelFormat` string - The pixel format of the texture.
* `bgra` - 32bpp BGRA (byte-order), 1 plane.
* `rgba` - 32bpp RGBA (byte-order), 1 plane.
* `rgbaf16` - Half float RGBA, 1 plane.
* `nv12` - 12bpp with Y plane followed by a 2x2 interleaved UV plane.
* `colorSpace` [ColorSpace](color-space.md) (optional) - The color space of the texture.
* `codedSize` [Size](size.md) - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) (optional) - A subsection of [0, 0, codedSize.width, codedSize.height]. In common cases, it is the full section area.
* `timestamp` number (optional) - A timestamp in microseconds that will be reflected to `VideoFrame`.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle.

View File

@@ -0,0 +1,9 @@
# SharedTextureImportedSubtle Object
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release the resources. If you transferred and get multiple `SharedTextureImported` objects, you have to `release` every one of them. The resource on the GPU process will be destroyed when the last one is released.
* `callback` Function (optional) - Callback when the GPU command buffer finishes using this shared texture. It provides a precise event to safely release dependent resources. For example, if this object is created by `finishTransferSharedTexture`, you can use this callback to safely release the original one that called `startTransferSharedTexture` in other processes. You can also release the source shared texture that was used to `importSharedTexture` safely.
* `startTransferSharedTexture` Function\<[SharedTextureTransfer](shared-texture-transfer.md)\> - Create a `SharedTextureTransfer` that can be serialized and transferred to other processes.
* `getFrameCreationSyncToken` Function\<[SharedTextureSyncToken](shared-texture-sync-token.md)\> - This method is for advanced users. If used, it is typically called after `finishTransferSharedTexture`, and should be passed to the object which was called `startTransferSharedTexture` to prevent the source object release the underlying resource before the target object actually acquire the reference at gpu process asyncly.
* `setReleaseSyncToken` Function - This method is for advanced users. If used, this object's underlying resource will not be released until the set sync token is fulfilled at gpu process. By using sync tokens, users are not required to use release callbacks for lifetime management.
* `syncToken` [SharedTextureSyncToken](shared-texture-sync-token.md) - The sync token to set.

View File

@@ -0,0 +1,6 @@
# SharedTextureImported Object
* `textureId` string - The unique identifier of the imported shared texture.
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release this object's reference of the imported shared texture. The underlying resource will be alive until every reference is released.
* `subtle` [SharedTextureImportedSubtle](shared-texture-imported-subtle.md) - Provides subtle APIs to interact with the imported shared texture for advanced users.

View File

@@ -0,0 +1,6 @@
# SharedTextureSubtle Object
* `importSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Imports the shared texture from the given options. Returns the imported shared texture.
* `textureInfo` [SharedTextureImportTextureInfo](shared-texture-import-texture-info.md) - The information of shared texture to import.
* `finishTransferSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Finishes the transfer of the shared texture and gets the transferred shared texture. Returns the imported shared texture from the transfer object.
* `transfer` [SharedTextureTransfer](shared-texture-transfer.md) - The transfer object of the shared texture.

View File

@@ -0,0 +1,3 @@
# SharedTextureSyncToken Object
* `syncToken` string - The opaque data for sync token.

View File

@@ -0,0 +1,10 @@
# SharedTextureTransfer Object
* `transfer` string _Readonly_ - The opaque transfer data of the shared texture. This can be transferred across Electron processes.
* `syncToken` string _Readonly_ - The opaque sync token data for frame creation.
* `pixelFormat` string _Readonly_ - The pixel format of the transferring texture.
* `codedSize` [Size](size.md) _Readonly_ - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) _Readonly_ - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In common cases, it is the full section area.
* `timestamp` number _Readonly_ - A timestamp in microseconds that will be reflected to `VideoFrame`.
Use `sharedTexture.subtle.finishTransferSharedTexture` to get [`SharedTextureImportedSubtle`](shared-texture-imported-subtle.md) back.

View File

@@ -21,7 +21,9 @@
associated with the window, making it compatible with the Chromium
OS-level sandbox and disabling the Node.js engine. This is not the same as
the `nodeIntegration` option and the APIs available to the preload script
are more limited. Read more about the option [here](../../tutorial/sandbox.md).
are more limited. Default is `true` since Electron 20. The sandbox will
automatically be disabled when `nodeIntegration` is set to `true`.
Read more about the option [here](../../tutorial/sandbox.md).
* `session` [Session](../session.md#class-session) (optional) - Sets the session used by the
page. Instead of passing the Session object directly, you can also choose to
use the `partition` option instead, which accepts a partition string. When
@@ -87,6 +89,11 @@
paint event. Defaults to `false`. See the
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
more details.
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
the specified `preload` script in a separate JavaScript context. Defaults
to `true`. The context that the `preload` script runs in will only have

View File

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
The `systemPreferences` object emits the following events:
### Event: 'accent-color-changed' _Windows_
### Event: 'accent-color-changed' _Windows_ _Linux_
Returns:
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
or global value of a `key` previously set with `setUserDefault`.
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
### `systemPreferences.getAccentColor()`
Returns `string` - The users current system wide accent color preference in RGBA
hexadecimal form.

View File

@@ -1079,7 +1079,7 @@ Emitted when the [mainFrame](web-contents.md#contentsmainframe-readonly), an `<i
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors.
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Loads the `url` in the window. The `url` must contain the protocol prefix,
e.g. the `http://` or `file://`. If the load should bypass http cache then

View File

@@ -4,6 +4,12 @@
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
`webFrame` export of the Electron module is an instance of the `WebFrame`
class representing the current frame. Sub-frames can be retrieved by
certain properties and methods (e.g. `webFrame.firstChild`).
@@ -139,7 +145,7 @@ by its key, which is returned from `webFrame.insertCSS(css)`.
Inserts `text` to the focused element.
### `webFrame.executeJavaScript(code[, userGesture, callback])`
### `webFrame.executeJavaScript(code[, userGesture][, callback])`
* `code` string
* `userGesture` boolean (optional) - Default is `false`.
@@ -160,7 +166,7 @@ In the browser window some HTML APIs like `requestFullScreen` can only be
invoked by a gesture from the user. Setting `userGesture` to `true` will remove
this limitation.
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture, callback])`
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture][, callback])`
* `worldId` Integer - The ID of the world to run the javascript
in, `0` is the default main world (where content runs), `999` is the

View File

@@ -4,6 +4,12 @@
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
## Methods
The `webUtils` module has the following methods:
@@ -17,11 +23,27 @@ Returns `string` - The file system path that this `File` object points to. In th
This method superseded the previous augmentation to the `File` object with the `path` property. An example is included below.
```js @ts-nocheck
// Before
const oldPath = document.querySelector('input').files[0].path
// After
const { webUtils } = require('electron')
const newPath = webUtils.getPathForFile(document.querySelector('input').files[0])
// Before (renderer)
const oldPath = document.querySelector('input[type=file]').files[0].path
```
```js @ts-nocheck
// After
// Renderer:
const file = document.querySelector('input[type=file]').files[0]
electronApi.doSomethingWithFile(file)
// Preload script:
const { contextBridge, webUtils } = require('electron')
contextBridge.exposeInMainWorld('electronApi', {
doSomethingWithFile (file) {
const path = webUtils.getPathForFile(file)
// Do something with the path, e.g., send it over IPC to the main process.
// It's best not to expose the full file path to the web content if possible.
}
})
```

View File

@@ -39,8 +39,8 @@ consider using `webContents.setWindowOpenHandler` to customize the
BrowserWindow creation.
A subset of [`WebPreferences`](structures/web-preferences.md) can be set directly,
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `preload`,
`javascript`, `contextIsolation`, and `webviewTag`.
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `javascript`,
`contextIsolation`, and `webviewTag`.
For example:

View File

@@ -12,6 +12,19 @@ This document uses the following convention to categorize breaking changes:
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
## Planned Breaking API Changes (40.0)
### Deprecated: `clipboard` API access from renderer processes
Using the `clipboard` API directly in the renderer process is deprecated.
If you want to call this API from a renderer process, place the API call in
your preload script and expose it using the [contextBridge](https://www.electronjs.org/docs/latest/api/context-bridge) API.
### Behavior Changed: MacOS dSYM files now compressed with tar.xz
Debug symbols for MacOS (dSYM) now use xz compression in order to handle larger file sizes. `dsym.zip` files are now
`dsym.tar.xz` files. End users using debug symbols may need to update their zip utilities.
## Planned Breaking API Changes (39.0)
### Deprecated: `--host-rules` command line switch
@@ -41,15 +54,21 @@ webContents.setWindowOpenHandler((details) => {
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
See [here](https://www.electronjs.org/docs/latest/api/structures/offscreen-shared-texture) for more details.
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
## Planned Breaking API Changes (38.0)
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
The default value of the `--ozone-platform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
Electron now defaults to running as a native Wayland app when launched in a Wayland session (when `XDG_SESSION_TYPE=wayland`).
Users can force XWayland by passing `--ozone-platform=x11`.
### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overriden and now reflects the actual desktop environment.
### Removed: macOS 11 support

View File

@@ -6,77 +6,17 @@ Follow the guidelines below for building **Electron itself** on Linux, for the p
## Prerequisites
* At least 25GB disk space and 8GB RAM.
* Python >= 3.9.
* [Node.js](https://nodejs.org/download/) >= 22.12.0
* [clang](https://clang.llvm.org/get_started.html) 3.4 or later.
* Development headers of GTK 3 and libnotify.
Due to Electron's dependency on Chromium, prerequisites and dependencies for Electron change over time. [Chromium's documentation on building on Linux](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/linux/build_instructions.md) has up to date information for building Chromium on Linux. This documentation can generally
be followed for building Electron on Linux as well.
On Ubuntu >= 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libasound2-dev libcap-dev \
libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python3-dbusmock openjdk-8-jre
```
On Ubuntu < 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libgnome-keyring-dev \
libasound2-dev libcap-dev libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python-dbusmock openjdk-8-jre
```
On RHEL / CentOS, install the following libraries:
```sh
$ sudo yum install clang dbus-devel gtk3-devel libnotify-devel \
libgnome-keyring-devel xorg-x11-server-utils libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock openjdk-8-jre
```
On Fedora, install the following libraries:
```sh
$ sudo dnf install clang dbus-devel gperf gtk3-devel \
libnotify-devel libgnome-keyring-devel libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock
```
On Arch Linux / Manjaro, install the following libraries:
```sh
$ sudo pacman -Syu base-devel clang libdbus gtk2 libnotify \
libgnome-keyring alsa-lib libcap libcups libxtst \
libxss nss gcc-multilib curl gperf bison \
python2 python-dbusmock jdk8-openjdk
```
Other distributions may offer similar packages for installation via package
managers such as pacman. Or one can compile from source code.
Additionally, Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) can be referenced to get the current dependencies that Electron requires in addition to what Chromium installs via [build/install-deps.sh](https://chromium.googlesource.com/chromium/src/+/HEAD/build/install-build-deps.sh).
### Cross compilation
If you want to build for an `arm` target you should also install the following
dependencies:
If you want to build for an `arm` target, you can use Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) to install the additional dependencies by passing the `--arm argument`:
```sh
$ sudo apt-get install libc6-dev-armhf-cross linux-libc-dev-armhf-cross \
g++-arm-linux-gnueabihf
```
Similarly for `arm64`, install the following:
```sh
$ sudo apt-get install libc6-dev-arm64-cross linux-libc-dev-arm64-cross \
g++-aarch64-linux-gnu
$ sudo install-deps.sh --arm
```
And to cross-compile for `arm` or targets, you should pass the

View File

@@ -12,19 +12,28 @@ network problems. The best resolution is to try switching networks, or
wait a bit and try installing again.
You can also attempt to download Electron directly from
[electron/electron/releases](https://github.com/electron/electron/releases)
[GitHub Releases](https://github.com/electron/electron/releases)
if installing via `npm` is failing.
## When will Electron upgrade to latest Chrome?
If you need to install Electron through a custom mirror or proxy, see
the [Advanced Installation](./tutorial/installation.md) documentation for more details.
The Chrome version of Electron is usually bumped within one or two weeks after
a new stable Chrome version gets released. This estimate is not guaranteed and
depends on the amount of work involved with upgrading.
## How are Electron binaries downloaded?
Only the stable channel of Chrome is used. If an important fix is in beta or dev
channel, we will back-port it.
When you run `npm install electron`, the Electron binary for the corresponding version is downloaded
into your project's `node_modules` folder via npm's `postinstall` lifecycle script.
For more information, please see the [security introduction](tutorial/security.md).
This logic is handled by the [`@electron/get`](https://github.com/electron/get) utility package
under the hood.
## When will Electron upgrade to latest Chromium?
Every new major version of Electron releases with a Chromium major version upgrade. By releasing every
8 weeks, Electron is able to pull in every other major Chromium release on the very same day that it
releases upstream. Security fixes will be backported to stable release channels ahead of time.
See the [Electron Releases](./tutorial/electron-timelines.md) documentation for more details or
[releases.electronjs.org](https://releases.electronjs.org) to see our Release Status dashboard.
## When will Electron upgrade to latest Node.js?

View File

@@ -12,6 +12,15 @@ The ASAR format was created primarily to improve performance on Windows when
reading large quantities of small files (e.g. when loading your app's JavaScript
dependency tree from `node_modules`).
### ASAR integrity
ASAR integrity is an security feature that validates the contents of your app's
ASAR archives at runtime. When enabled, your Electron app will verify the
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
hashes, the app will forcefully terminate.
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
### code signing
Code signing is a process where an app developer digitally signs their code to

View File

@@ -5,7 +5,7 @@ slug: asar-integrity
hide_title: false
---
ASAR integrity is an experimental feature that validates the contents of your app's
ASAR integrity is a security feature that validates the contents of your app's
[ASAR archives](./asar-archives.md) at runtime.
## Version support
@@ -64,13 +64,10 @@ flipFuses(
)
```
:::tip Fuses in Electron Forge
With Electron Forge, you can configure your app's fuses with
[@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
in your Forge configuration file.
:::
> [!TIP]
> With Electron Forge, you can configure your app's fuses with
> [@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
> in your Forge configuration file.
## Providing the header hash
@@ -80,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
### Using Electron tooling
Electron Forge and Electron Packager do this setup automatically for you with no additional
configuration. The minimum required versions for ASAR integrity are:
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
* `@electron/packager@18.3.1`
* `@electron/forge@7.4.0`
@@ -109,7 +106,7 @@ Valid `algorithm` values are currently `SHA256` only. The `hash` is a hash of th
The `@electron/asar` package exposes a `getRawHeader` method whose result can then be hashed to generate this value
(e.g. using the [`node:crypto`](https://nodejs.org/api/crypto.html) module).
### Windows
#### Windows
When packaging for Windows, you must populate a valid [resource](https://learn.microsoft.com/en-us/windows/win32/menurc/resources)
entry of type `Integrity` and name `ElectronAsar`. The value of this resource should be a JSON encoded dictionary
@@ -125,9 +122,6 @@ in the form included below:
]
```
:::info
For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
in the Electron Packager code.
:::
> [!NOTE]
> For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
> in the Electron Packager code.

View File

@@ -233,10 +233,10 @@ can find [its documentation here](https://www.electron.build/code-signing).
[Azure Trusted Signing][] is Microsoft's modern cloud-based alternative to EV certificates.
It is the cheapest option for code signing on Windows, and it gets rid of SmartScreen warnings.
As of May 2025, Azure Trusted Signing is [available][trusted-signing-availability] to US and
Canada-based organizations with 3+ years of verifiable business history. Microsoft is looking
to make the program more widely available. If you're reading this at a later point, it could
make sense to check if the eligibility criteria have changed.
As of October 2025, Azure Trusted Signing is available to US and Canada-based organizations
with 3+ years of verifiable business history and to individual developers in the US and Canada.
Microsoft is looking to make the program more widely available. If you're reading this at a
later point, it could make sense to check if the eligibility criteria have changed.
#### Using Electron Forge
@@ -267,6 +267,5 @@ See the [Windows Store Guide][].
[maker-squirrel]: https://www.electronforge.io/config/makers/squirrel.windows
[maker-msi]: https://www.electronforge.io/config/makers/wix-msi
[azure trusted signing]: https://azure.microsoft.com/en-us/products/trusted-signing
[trusted-signing-availability]: https://techcommunity.microsoft.com/blog/microsoft-security-blog/trusted-signing-public-preview-update/4399713
[forge-trusted-signing]: https://www.electronforge.io/guides/code-signing/code-signing-windows#using-azure-trusted-signing
[builder-trusted-signing]: https://www.electron.build/code-signing-win#using-azure-trusted-signing-beta

View File

@@ -94,7 +94,7 @@ If the extension works on Chrome but not on Electron, file a bug in Electron's
[issue tracker][issue-tracker] and describe which part
of the extension is not working as expected.
[devtools-extension]: https://developer.chrome.com/extensions/devtools
[devtools-extension]: https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools
[session]: ../api/session.md
[react-devtools]: https://chrome.google.com/webstore/detail/react-developer-tools/fmkadmapgofadopljbjfkapdkoienihi
[load-extension]: ../api/extensions-api.md#extensionsloadextensionpath-options

View File

@@ -9,10 +9,11 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
| Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
| ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | TBD | ✅ |
| 40.0.0 | 2025-Oct-30 | 2025-Dec-03 | 2026-Jan-13 | 2026-Jun-30 | M144 | TBD | ✅ |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
| 37.0.0 | 2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
| 34.0.0 | 2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
| 33.0.0 | 2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
@@ -121,22 +122,3 @@ and that number is reduced to two in major version 10, the three-argument versio
continue to work until, at minimum, major version 12. Past the minimum two-version
threshold, we will attempt to support backwards compatibility beyond two versions
until the maintainers feel the maintenance burden is too high to continue doing so.
### End-of-life
When a release branch reaches the end of its support cycle, the series
will be deprecated in NPM and a final end-of-support release will be
made. This release will add a warning to inform that an unsupported
version of Electron is in use.
These steps are to help app developers learn when a branch they're
using becomes unsupported, but without being excessively intrusive
to end users.
If an application has exceptional circumstances and needs to stay
on an unsupported series of Electron, developers can silence the
end-of-support warning by omitting the final release from the app's
`package.json` `devDependencies`. For example, since the 1-6-x series
ended with an end-of-support 1.6.18 release, developers could choose
to stay in the 1-6-x series without warnings with `devDependency` of
`"electron": 1.6.0 - 1.6.17`.

View File

@@ -32,7 +32,7 @@ This table gives a general overview of where ESM is supported and which ESM load
| Main | Node.js | N/A | <ul><li> [You must use `await` generously before the app's `ready` event](#you-must-use-await-generously-before-the-apps-ready-event) </li></ul> |
| Renderer (Sandboxed) | Chromium | Unsupported | <ul><li> [Sandboxed preload scripts can't use ESM imports](#sandboxed-preload-scripts-cant-use-esm-imports) </li></ul> |
| Renderer (Unsandboxed & Context Isolated) | Chromium | Node.js | <ul><li> [Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content) </li> <li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li><li>[ESM preload scripts must be context isolated to use dynamic Node.js ESM imports](#esm-preload-scripts-must-be-context-isolated-to-use-dynamic-nodejs-esm-imports)</li></ul> |
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
## Main process

View File

@@ -4,11 +4,24 @@
## What are fuses?
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
From a security perspective, it makes sense to disable certain unused Electron features
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
subset of "living off the land" attacks.
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
We also don't want Electron consumers forking to achieve this goal, as building from source and
maintaining a fork is a massive technical challenge and costs a lot of time and money.
## Current Fuses
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
Because they are flipped at package time before you code sign your app, the OS becomes responsible
for ensuring those bits aren't flipped back via OS-level code signing validation
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
on Windows).
## Current fuses
### `runAsNode`
@@ -16,7 +29,11 @@ Fuses are the solution to this problem, at a high level they are "magic bits" in
**@electron/fuses:** `FuseV1Options.RunAsNode`
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
as expected, as it depends on this environment variable to function. Instead, we recommend that you
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
standalone Node.js process (e.g. a SQLite server process).
### `cookieEncryption`
@@ -24,7 +41,12 @@ The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variab
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
### `nodeOptions`
@@ -32,7 +54,11 @@ The cookieEncryption fuse toggles whether the cookie store on disk is encrypted
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
Most apps can safely disable this fuse.
### `nodeCliInspect`
@@ -40,7 +66,9 @@ The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
inspector. Most apps can safely disable this fuse.
### `embeddedAsarIntegrityValidation`
@@ -48,9 +76,12 @@ The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. f
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
Most apps can safely enable this fuse.
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
### `onlyLoadAppFromAsar`
@@ -58,7 +89,15 @@ For more information on how to use asar integrity validation please read the [As
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
By default, Electron will search for this code in the following order:
1. `app.asar`
1. `app`
1. `default_app.asar`
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
it is impossible to load non-validated code.
### `loadBrowserProcessSpecificV8Snapshot`
@@ -66,11 +105,17 @@ The onlyLoadAppFromAsar fuse changes the search system that Electron uses to loc
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
initialized heaps and then load them back in to avoid the cost of initializing the heap.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
Other processes will use the V8 snapshot file that they normally do.
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
Using separate snapshots for renderer processes and the main process can improve security, especially
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
### `grantFileProtocolExtraPrivileges`
@@ -78,19 +123,25 @@ Using separate snapshots for renderer processes and the main process can improve
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
are given privileges beyond what they would receive in a traditional web browser. This behavior was
core to Electron apps in original versions of Electron, but is no longer required as apps should be
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
If you aren't serving pages from `file://`, you should disable this fuse.
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
* `file://` protocol pages can use `fetch` to load other assets over `file://`
* `file://` protocol pages can use service workers
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
* `file://` protocol pages have universal access granted to child frames also running on `file://`
protocols regardless of sandbox settings
## How do I flip the fuses?
## How do I flip fuses?
### The easy way
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
```js @ts-nocheck
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -106,29 +157,37 @@ flipFuses(
)
```
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
app using the `@electron/fuses` CLI.
```bash
npx @electron/fuses read --app /Applications/Foo.app
```
>[!NOTE]
> If you are using Electron Forge to distribute your application, you can flip fuses using
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
> which comes pre-installed with all templates.
### The hard way
#### Quick Glossary
> [!IMPORTANT]
> Glossary:
>
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
> * **Fuse Schema**: The format/allowed values for the fuse wire
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
* **Fuse Schema**: The format / allowed values for the fuse wire
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
sequence of bytes that represent the state of the fuses you want.
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
```text
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
```
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -136,6 +195,6 @@ Somewhere in the Electron binary there will be a sequence of bytes that look lik
* "1" (0x31) indicates the fuse is enabled
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

View File

@@ -26,12 +26,12 @@ any dependencies in your app will not be installed.
## Customization
If you want to change the architecture that is downloaded (e.g., `ia32` on an
`x64` machine), you can use the `--arch` flag with npm install or set the
If you want to change the architecture that is downloaded (e.g., `x64` on an
`arm64` machine), you can use the `--arch` flag with npm install or set the
`npm_config_arch` environment variable:
```shell
npm install --arch=ia32 electron
npm install --arch=x64 electron
```
In addition to changing the architecture, you can also specify the platform
@@ -60,7 +60,7 @@ where `$VERSION` is the exact version of Electron).
If you are unable to access GitHub or you need to provide a custom build, you
can do so by either providing a mirror or an existing cache directory.
#### Mirror
### Mirror
You can use environment variables to override the base URL, the path at which to
look for Electron binaries, and the binary filename. The URL used by `@electron/get`
@@ -95,7 +95,7 @@ Electron release you may have to set `electron_use_remote_checksums=1` directly,
or configure it in a `.npmrc` file, to force Electron to use the remote `SHASUMS256.txt`
file to verify the checksum instead of the embedded checksums.
#### Cache
### Cache
Alternatively, you can override the local cache. `@electron/get` will cache
downloaded binaries in a local directory to not stress your network. You can use
@@ -120,7 +120,7 @@ The cache contains the version's official zip file as well as a checksum, and is
│ └── electron-v15.3.1-darwin-x64.zip
```
## Skip binary download
## Postinstall script
Under the hood, Electron's JavaScript API binds to a binary that contains its
implementations. Because this binary is crucial to the function of any Electron app,

View File

@@ -110,4 +110,10 @@ the item is a Markdown file located in the root of the project:
![Drag and drop](../images/drag-and-drop.gif)
## Dragging files into your app
You can use the standard
[Drag and Drop web API](https://developer.mozilla.org/en-US/docs/Web/API/HTML_Drag_and_Drop_API)
for dragging and dropping files into your app.
[`contextBridge`]: ../api/context-bridge.md

View File

@@ -2,15 +2,15 @@
## Overview
[Online and offline event](https://developer.mozilla.org/en-US/docs/Online_and_offline_events)
detection can be implemented in the Renderer process using the
[`navigator.onLine`](http://html5index.org/Offline%20-%20NavigatorOnLine.html)
attribute, part of standard HTML5 API.
Online and offline event detection can be implemented in both the main and renderer processes:
- **Renderer process**: Use the [`navigator.onLine`](http://html5index.org/Offline%20-%20NavigatorOnLine.html) attribute and [online/offline events](https://developer.mozilla.org/en-US/docs/Online_and_offline_events), part of standard HTML5 API.
- **Main process**: Use the [`net.isOnline()`](../api/net.md#netisonline) method or the [`net.online`](../api/net.md#netonline-readonly) property.
The `navigator.onLine` attribute returns:
* `false` if all network requests are guaranteed to fail (e.g. when disconnected from the network).
* `true` in all other cases.
- `false` if all network requests are guaranteed to fail (e.g. when disconnected from the network).
- `true` in all other cases.
Since many cases return `true`, you should treat with care situations of
getting false positives, as we cannot always assume that `true` value means
@@ -19,7 +19,27 @@ is running a virtualization software that has virtual Ethernet adapters in "alwa
connected" state. Therefore, if you want to determine the Internet access
status of Electron, you should develop additional means for this check.
## Example
## Main Process Detection
In the main process, you can use the `net` module to detect online/offline status:
```js
const { net } = require('electron')
// Method 1: Using net.isOnline()
const isOnline = net.isOnline()
console.log('Online status:', isOnline)
// Method 2: Using net.online property
console.log('Online status:', net.online)
```
Both `net.isOnline()` and `net.online` return the same boolean value with the same reliability characteristics as `navigator.onLine` - they provide a strong indicator when offline (`false`), but a `true` value doesn't guarantee successful internet connectivity.
> [!NOTE]
> The `net` module is only available after the app emits the `ready` event.
## Renderer Process Example
Starting with an HTML file `index.html`, this example will demonstrate how the `navigator.onLine` API can be used to build a connection status indicator.
@@ -84,4 +104,4 @@ After launching the Electron application, you should see the notification:
![Connection status](../images/connection-status.png)
> [!NOTE]
> If you need to communicate the connection status to the main process, use the [IPC renderer](../api/ipc-renderer.md) API.
> If you need to check the connection status in the main process, you can use [`net.isOnline()`](../api/net.md#netisonline) directly instead of communicating from the renderer process via [IPC](../api/ipc-renderer.md).

View File

@@ -60,7 +60,7 @@ at once, consider the [Chrome Tracing](https://www.chromium.org/developers/how-t
## Checklist: Performance recommendations
Chances are that your app could be a little leaner, faster, and generally less
resource-hungry if you attempt these steps.
resource-hungry if you avoid the following common pitfalls.
1. [Carelessly including modules](#1-carelessly-including-modules)
2. [Loading and running code too soon](#2-loading-and-running-code-too-soon)

View File

@@ -13,7 +13,13 @@ the GPU service and the network service.
See Chromium's [Sandbox design document][sandbox] for more information.
Starting from Electron 20, the sandbox is enabled for renderer processes without any
further configuration. If you want to disable the sandbox for a process, see the
further configuration.
Sandboxing is tied to Node.js integration. _Enabling Node.js integration_ for a
renderer process by setting `nodeIntegration: true` _disables the sandbox_ for the
process.
If you want to disable the sandbox for a process, see the
[Disabling the sandbox for a single process](#disabling-the-sandbox-for-a-single-process)
section.
@@ -98,7 +104,8 @@ app.whenReady().then(() => {
```
Sandboxing is also disabled whenever Node.js integration is enabled in the renderer.
This can be done through the BrowserWindow constructor with the `nodeIntegration: true` flag.
This can be done through the BrowserWindow constructor with the `nodeIntegration: true` flag
or by providing the respective HTML boolean attribute for a `webview`.
```js title='main.js'
app.whenReady().then(() => {
@@ -111,6 +118,10 @@ app.whenReady().then(() => {
})
```
```html title='index.html (Renderer Process)'
<webview nodeIntegration src="page.html"></webview>
```
### Enabling the sandbox globally
If you want to force sandboxing for all renderers, you can also use the

View File

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
You should at least follow these steps to improve the security of your application:
1. [Only load secure content](#1-only-load-secure-content)
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
4. [Enable process sandboxing](#4-enable-process-sandboxing)
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -118,13 +118,6 @@ You should at least follow these steps to improve the security of your applicati
19. [Check which fuses you can change](#19-check-which-fuses-you-can-change)
20. [Do not expose Electron APIs to untrusted web content](#20-do-not-expose-electron-apis-to-untrusted-web-content)
To automate the detection of misconfigurations and insecure patterns, it is
possible to use
[Electronegativity](https://github.com/doyensec/electronegativity). For
additional details on potential weaknesses and implementation bugs when
developing applications using Electron, please refer to this
[guide for developers and auditors](https://doyensec.com/resources/us-17-Carettoni-Electronegativity-A-Study-Of-Electron-Security-wp.pdf).
### 1. Only load secure content
Any resources not included with your application should be loaded using a
@@ -244,6 +237,10 @@ to enable this behavior.
Even when `nodeIntegration: false` is used, to truly enforce strong isolation
and prevent the use of Node primitives `contextIsolation` **must** also be used.
Beware that _disabling context isolation_ for a renderer process by setting
`nodeIntegration: true` _also disables process sandboxing_ for that process.
See section below.
:::info
For more information on what `contextIsolation` is and how to enable it please
see our dedicated [Context Isolation](context-isolation.md) document.
@@ -251,6 +248,16 @@ see our dedicated [Context Isolation](context-isolation.md) document.
### 4. Enable process sandboxing
:::info
This recommendation is the default behavior in Electron since 20.0.0.
Additionally, process sandboxing can be enforced for all renderer processes
application wide: [Enabling the sandbox globally](sandbox.md#enabling-the-sandbox-globally)
_Disabling context isolation_ (see above) _also disables process sandboxing_,
regardless of the default, `sandbox: false` or globally enabled sandboxing!
:::
[Sandboxing](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/design/sandbox.md)
is a Chromium feature that uses the operating system to
significantly limit what renderer processes have access to. You should enable
@@ -285,7 +292,7 @@ const { session } = require('electron')
const { URL } = require('node:url')
session
.fromPartition('some-partition')
.defaultSession
.setPermissionRequestHandler((webContents, permission, callback) => {
const parsedUrl = new URL(webContents.getURL())
@@ -302,6 +309,8 @@ session
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
### 6. Do not disable `webSecurity`
:::info
@@ -392,6 +401,8 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
#### CSP meta tag
CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
@@ -804,10 +815,10 @@ that your application might have the rights for.
#### How?
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
flipping these fuses easy. Check out the README of that module for more details on usage and
potential error cases, and refer to
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
### 20. Do not expose Electron APIs to untrusted web content

View File

@@ -55,14 +55,27 @@ There are a few rules to follow for the purposes of this tutorial:
- _author_, _license_, and _description_ can be any value, but will be necessary for
[packaging][packaging] later on.
:::caution Install dependencies with a regular `node_modules` folder
Electron's packaging toolchain requires the `node_modules` folder to be physically on disk in the
way that npm installs Node dependencies. By default, [Yarn Berry](https://yarnpkg.com/) and
[pnpm](http://pnpm.io/) both use alternative installation strategies.
Therefore, you must set [`nodeLinker: node-modules`](https://yarnpkg.com/configuration/yarnrc#nodeLinker)
in Yarn or [`nodeLinker: hoisted`](https://pnpm.io/settings#nodelinker) in pnpm if you are using
those package managers.
:::
Then, install Electron into your app's **devDependencies**, which is the list of external
development-only package dependencies not required in production.
:::info Why is Electron a devDependency?
:::info Why is Electron a dev dependency?
This may seem counter-intuitive since your production code is running Electron APIs.
However, packaged apps will come bundled with the Electron binary, eliminating the need to specify
it as a production dependency.
This may seem counter-intuitive since your production code is running Electron APIs. Under the hood,
Electron's JavaScript API binds to a binary that contains its implementations. The packaging step for
Electron handles the bundling of this binary, eliminating the need to specify it as a production
dependency.
:::
@@ -70,6 +83,17 @@ it as a production dependency.
npm install electron --save-dev
```
:::warning
In order to correctly install Electron, you need to ensure that its `postinstall` lifecycle
script is able to run. This means avoiding the `--ignore-scripts` flag on npm and allowlisting
`electron` to run build scripts on other package managers.
This is likely to change in a future version of Electron. See
[electron/rfcs#22](https://github.com/electron/rfcs/pull/22) for more details.
:::
Your package.json file should look something like this after initializing your package
and installing Electron. You should also now have a `node_modules` folder containing
the Electron executable, as well as a `package-lock.json` lockfile that specifies

View File

@@ -52,6 +52,7 @@ auto_filenames = {
"docs/api/service-workers.md",
"docs/api/session.md",
"docs/api/share-menu.md",
"docs/api/shared-texture.md",
"docs/api/shell.md",
"docs/api/structures",
"docs/api/system-preferences.md",
@@ -145,6 +146,12 @@ auto_filenames = {
"docs/api/structures/shared-dictionary-info.md",
"docs/api/structures/shared-dictionary-usage-info.md",
"docs/api/structures/shared-texture-handle.md",
"docs/api/structures/shared-texture-import-texture-info.md",
"docs/api/structures/shared-texture-imported-subtle.md",
"docs/api/structures/shared-texture-imported.md",
"docs/api/structures/shared-texture-subtle.md",
"docs/api/structures/shared-texture-sync-token.md",
"docs/api/structures/shared-texture-transfer.md",
"docs/api/structures/shared-worker-info.md",
"docs/api/structures/sharing-item.md",
"docs/api/structures/shortcut-details.md",
@@ -176,6 +183,7 @@ auto_filenames = {
"lib/renderer/api/context-bridge.ts",
"lib/renderer/api/crash-reporter.ts",
"lib/renderer/api/ipc-renderer.ts",
"lib/renderer/api/shared-texture.ts",
"lib/renderer/api/web-frame.ts",
"lib/renderer/api/web-utils.ts",
"lib/renderer/common-init.ts",
@@ -257,6 +265,7 @@ auto_filenames = {
"lib/browser/api/service-worker-main.ts",
"lib/browser/api/session.ts",
"lib/browser/api/share-menu.ts",
"lib/browser/api/shared-texture.ts",
"lib/browser/api/system-preferences.ts",
"lib/browser/api/touch-bar.ts",
"lib/browser/api/tray.ts",
@@ -312,6 +321,7 @@ auto_filenames = {
"lib/renderer/api/exports/electron.ts",
"lib/renderer/api/ipc-renderer.ts",
"lib/renderer/api/module-list.ts",
"lib/renderer/api/shared-texture.ts",
"lib/renderer/api/web-frame.ts",
"lib/renderer/api/web-utils.ts",
"lib/renderer/common-init.ts",
@@ -352,6 +362,7 @@ auto_filenames = {
"lib/renderer/api/exports/electron.ts",
"lib/renderer/api/ipc-renderer.ts",
"lib/renderer/api/module-list.ts",
"lib/renderer/api/shared-texture.ts",
"lib/renderer/api/web-frame.ts",
"lib/renderer/api/web-utils.ts",
"lib/renderer/ipc-renderer-bindings.ts",

View File

@@ -194,6 +194,8 @@ filenames = {
"shell/common/api/electron_api_clipboard_mac.mm",
"shell/common/api/electron_api_native_image_mac.mm",
"shell/common/asar/archive_mac.mm",
"shell/common/asar/integrity_digest.h",
"shell/common/asar/integrity_digest.mm",
"shell/common/application_info_mac.mm",
"shell/common/language_util_mac.mm",
"shell/common/mac/main_application_bundle.h",
@@ -456,7 +458,6 @@ filenames = {
"shell/browser/net/system_network_context_manager.h",
"shell/browser/net/url_loader_network_observer.cc",
"shell/browser/net/url_loader_network_observer.h",
"shell/browser/net/web_request_api_interface.h",
"shell/browser/network_hints_handler_impl.cc",
"shell/browser/network_hints_handler_impl.h",
"shell/browser/notifications/notification.cc",
@@ -564,6 +565,7 @@ filenames = {
"shell/common/api/electron_api_native_image.cc",
"shell/common/api/electron_api_native_image.h",
"shell/common/api/electron_api_net.cc",
"shell/common/api/electron_api_shared_texture.cc",
"shell/common/api/electron_api_shell.cc",
"shell/common/api/electron_api_testing.cc",
"shell/common/api/electron_api_url_loader.cc",
@@ -580,6 +582,7 @@ filenames = {
"shell/common/asar/asar_util.h",
"shell/common/asar/scoped_temporary_file.cc",
"shell/common/asar/scoped_temporary_file.h",
"shell/common/callback_util.h",
"shell/common/color_util.cc",
"shell/common/color_util.h",
"shell/common/crash_keys.cc",
@@ -629,8 +632,6 @@ filenames = {
"shell/common/gin_converters/usb_device_info_converter.h",
"shell/common/gin_converters/value_converter.cc",
"shell/common/gin_converters/value_converter.h",
"shell/common/gin_helper/arguments.cc",
"shell/common/gin_helper/arguments.h",
"shell/common/gin_helper/callback.cc",
"shell/common/gin_helper/callback.h",
"shell/common/gin_helper/cleaned_up_at_exit.cc",

View File

@@ -7,21 +7,17 @@ hunspell_dictionaries = [
"//third_party/hunspell_dictionaries/da-DK-3-0.bdic",
"//third_party/hunspell_dictionaries/de-DE-3-0.bdic",
"//third_party/hunspell_dictionaries/el-GR-3-0.bdic",
"//third_party/hunspell_dictionaries/en-AU-10-0.bdic",
"//third_party/hunspell_dictionaries/en-AU-10-1.bdic",
"//third_party/hunspell_dictionaries/en-CA-10-0.bdic",
"//third_party/hunspell_dictionaries/en-CA-10-1.bdic",
"//third_party/hunspell_dictionaries/en-GB-10-0.bdic",
"//third_party/hunspell_dictionaries/en-GB-10-1.bdic",
"//third_party/hunspell_dictionaries/en-GB-oxendict-10-0.bdic",
"//third_party/hunspell_dictionaries/en-GB-oxendict-10-1.bdic",
"//third_party/hunspell_dictionaries/en-US-10-0.bdic",
"//third_party/hunspell_dictionaries/en-US-10-1.bdic",
"//third_party/hunspell_dictionaries/es-ES-3-0.bdic",
"//third_party/hunspell_dictionaries/et-EE-3-0.bdic",
"//third_party/hunspell_dictionaries/fa-IR-9-0.bdic",
"//third_party/hunspell_dictionaries/fo-FO-3-0.bdic",
"//third_party/hunspell_dictionaries/fr-FR-3-0.bdic",
"//third_party/hunspell_dictionaries/gl-1-0.bdic",
"//third_party/hunspell_dictionaries/he-IL-3-0.bdic",
"//third_party/hunspell_dictionaries/hi-IN-3-0.bdic",
"//third_party/hunspell_dictionaries/hr-HR-3-0.bdic",
@@ -59,6 +55,7 @@ hunspell_dictionaries = [
hunspell_licenses = [
"//third_party/hunspell_dictionaries/COPYING",
"//third_party/hunspell_dictionaries/COPYING.Apache",
"//third_party/hunspell_dictionaries/COPYING.GPL3",
"//third_party/hunspell_dictionaries/COPYING.LESSER",
"//third_party/hunspell_dictionaries/COPYING.LGPL",
"//third_party/hunspell_dictionaries/COPYING.MIT",

View File

@@ -217,6 +217,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
"//third_party/libc++/src/include/__atomic/contention_t.h",
"//third_party/libc++/src/include/__atomic/fence.h",
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
"//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -840,7 +841,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cmath",
"//third_party/libc++/src/include/__cxx03/codecvt",
"//third_party/libc++/src/include/__cxx03/complex",
"//third_party/libc++/src/include/__cxx03/complex.h",
"//third_party/libc++/src/include/__cxx03/condition_variable",
"//third_party/libc++/src/include/__cxx03/csetjmp",
"//third_party/libc++/src/include/__cxx03/csignal",
@@ -853,25 +853,20 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cstring",
"//third_party/libc++/src/include/__cxx03/ctgmath",
"//third_party/libc++/src/include/__cxx03/ctime",
"//third_party/libc++/src/include/__cxx03/ctype.h",
"//third_party/libc++/src/include/__cxx03/cuchar",
"//third_party/libc++/src/include/__cxx03/cwchar",
"//third_party/libc++/src/include/__cxx03/cwctype",
"//third_party/libc++/src/include/__cxx03/deque",
"//third_party/libc++/src/include/__cxx03/errno.h",
"//third_party/libc++/src/include/__cxx03/exception",
"//third_party/libc++/src/include/__cxx03/experimental/__config",
"//third_party/libc++/src/include/__cxx03/experimental/utility",
"//third_party/libc++/src/include/__cxx03/ext/__hash",
"//third_party/libc++/src/include/__cxx03/ext/hash_map",
"//third_party/libc++/src/include/__cxx03/ext/hash_set",
"//third_party/libc++/src/include/__cxx03/fenv.h",
"//third_party/libc++/src/include/__cxx03/float.h",
"//third_party/libc++/src/include/__cxx03/forward_list",
"//third_party/libc++/src/include/__cxx03/fstream",
"//third_party/libc++/src/include/__cxx03/functional",
"//third_party/libc++/src/include/__cxx03/future",
"//third_party/libc++/src/include/__cxx03/inttypes.h",
"//third_party/libc++/src/include/__cxx03/iomanip",
"//third_party/libc++/src/include/__cxx03/ios",
"//third_party/libc++/src/include/__cxx03/iosfwd",
@@ -898,11 +893,8 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/sstream",
"//third_party/libc++/src/include/__cxx03/stack",
"//third_party/libc++/src/include/__cxx03/stdatomic.h",
"//third_party/libc++/src/include/__cxx03/stdbool.h",
"//third_party/libc++/src/include/__cxx03/stddef.h",
"//third_party/libc++/src/include/__cxx03/stdexcept",
"//third_party/libc++/src/include/__cxx03/stdint.h",
"//third_party/libc++/src/include/__cxx03/stdio.h",
"//third_party/libc++/src/include/__cxx03/stdlib.h",
"//third_party/libc++/src/include/__cxx03/streambuf",
"//third_party/libc++/src/include/__cxx03/string",
@@ -910,7 +902,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/string_view",
"//third_party/libc++/src/include/__cxx03/strstream",
"//third_party/libc++/src/include/__cxx03/system_error",
"//third_party/libc++/src/include/__cxx03/tgmath.h",
"//third_party/libc++/src/include/__cxx03/thread",
"//third_party/libc++/src/include/__cxx03/type_traits",
"//third_party/libc++/src/include/__cxx03/typeindex",
@@ -923,7 +914,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/vector",
"//third_party/libc++/src/include/__cxx03/version",
"//third_party/libc++/src/include/__cxx03/wchar.h",
"//third_party/libc++/src/include/__cxx03/wctype.h",
"//third_party/libc++/src/include/__debug_utils/randomize_range.h",
"//third_party/libc++/src/include/__debug_utils/sanitizers.h",
"//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
@@ -1115,6 +1105,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__locale_dir/support/freebsd.h",
"//third_party/libc++/src/include/__locale_dir/support/fuchsia.h",
"//third_party/libc++/src/include/__locale_dir/support/linux.h",
"//third_party/libc++/src/include/__locale_dir/support/netbsd.h",
"//third_party/libc++/src/include/__locale_dir/support/no_locale/characters.h",
"//third_party/libc++/src/include/__locale_dir/support/no_locale/strtonum.h",
"//third_party/libc++/src/include/__locale_dir/support/windows.h",
@@ -1365,11 +1356,9 @@ libcxx_headers = [
"//third_party/libc++/src/include/__tree",
"//third_party/libc++/src/include/__tuple/find_index.h",
"//third_party/libc++/src/include/__tuple/ignore.h",
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
"//third_party/libc++/src/include/__tuple/tuple_element.h",
"//third_party/libc++/src/include/__tuple/tuple_like.h",
"//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
"//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
"//third_party/libc++/src/include/__tuple/tuple_size.h",
"//third_party/libc++/src/include/__tuple/tuple_types.h",
@@ -1426,6 +1415,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
"//third_party/libc++/src/include/__type_traits/is_function.h",
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
"//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1464,10 +1454,12 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
"//third_party/libc++/src/include/__type_traits/is_void.h",
"//third_party/libc++/src/include/__type_traits/is_volatile.h",
"//third_party/libc++/src/include/__type_traits/is_within_lifetime.h",
"//third_party/libc++/src/include/__type_traits/lazy.h",
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
"//third_party/libc++/src/include/__type_traits/make_signed.h",
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
"//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1499,6 +1491,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/cmp.h",
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
"//third_party/libc++/src/include/__utility/declval.h",
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/element_count.h",
"//third_party/libc++/src/include/__utility/empty.h",
"//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1509,6 +1502,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/integer_sequence.h",
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
"//third_party/libc++/src/include/__utility/is_valid_range.h",
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/move.h",
"//third_party/libc++/src/include/__utility/no_destroy.h",
"//third_party/libc++/src/include/__utility/pair.h",

View File

@@ -25,13 +25,32 @@ Menu.prototype._isCommandIdChecked = function (id) {
};
Menu.prototype._isCommandIdEnabled = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].enabled : false;
const item = this.commandsMap[id];
if (!item) return false;
const focusedWindow = BaseWindow.getFocusedWindow();
if (item.role === 'minimize' && focusedWindow) {
return focusedWindow.isMinimizable();
}
if (item.role === 'togglefullscreen' && focusedWindow) {
return focusedWindow.isFullScreenable();
}
if (item.role === 'close' && focusedWindow) {
return focusedWindow.isClosable();
}
return item.enabled;
};
Menu.prototype._shouldCommandIdWorkWhenHidden = function (id) {
return this.commandsMap[id] ? !!this.commandsMap[id].acceleratorWorksWhenHidden : false;
return this.commandsMap[id]?.acceleratorWorksWhenHidden ?? false;
};
Menu.prototype._isCommandIdVisible = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].visible : false;
return this.commandsMap[id]?.visible ?? false;
};
Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator) {
@@ -42,12 +61,12 @@ Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator
};
Menu.prototype._shouldRegisterAcceleratorForCommandId = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].registerAccelerator : false;
return this.commandsMap[id]?.registerAccelerator ?? false;
};
if (process.platform === 'darwin') {
Menu.prototype._getSharingItemForCommandId = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].sharingItem : null;
return this.commandsMap[id]?.sharingItem ?? null;
};
}

View File

@@ -31,6 +31,7 @@ export const browserModuleList: ElectronInternal.ModuleEntry[] = [
{ name: 'screen', loader: () => require('./screen') },
{ name: 'ServiceWorkerMain', loader: () => require('./service-worker-main') },
{ name: 'session', loader: () => require('./session') },
{ name: 'sharedTexture', loader: () => require('./shared-texture') },
{ name: 'ShareMenu', loader: () => require('./share-menu') },
{ name: 'systemPreferences', loader: () => require('./system-preferences') },
{ name: 'TouchBar', loader: () => require('./touch-bar') },

View File

@@ -119,7 +119,10 @@ export function fetchWithSession (input: RequestInfo, init: (RequestInit & {bypa
p.reject(err);
});
if (!req.body?.pipeTo(Writable.toWeb(r as unknown as Writable)).then(() => r.end())) { r.end(); }
// pipeTo expects a WritableStream<Uint8Array>. Node.js' Writable.toWeb returns WritableStream<any>,
// which causes a TS structural mismatch.
const writable = Writable.toWeb(r as unknown as Writable) as unknown as WritableStream<Uint8Array>;
if (!req.body?.pipeTo(writable).then(() => r.end())) { r.end(); }
return p.promise;
}

View File

@@ -4,6 +4,8 @@ import { createReadStream } from 'fs';
import { Readable } from 'stream';
import { ReadableStream } from 'stream/web';
import type { ReadableStreamDefaultReader } from 'stream/web';
// Global protocol APIs.
const { registerSchemesAsPrivileged, getStandardSchemes, Protocol } = process._linkedBinding('electron_browser_protocol');
@@ -12,7 +14,7 @@ const ERR_UNEXPECTED = -9;
const isBuiltInScheme = (scheme: string) => ['http', 'https', 'file'].includes(scheme);
function makeStreamFromPipe (pipe: any): ReadableStream {
function makeStreamFromPipe (pipe: any): ReadableStream<Uint8Array> {
const buf = new Uint8Array(1024 * 1024 /* 1 MB */);
return new ReadableStream({
async pull (controller) {
@@ -38,21 +40,26 @@ function makeStreamFromFileInfo ({
filePath: string;
offset?: number;
length?: number;
}): ReadableStream {
}): ReadableStream<Uint8Array> {
// Node's Readable.toWeb produces a WHATWG ReadableStream whose chunks are Uint8Array.
return Readable.toWeb(createReadStream(filePath, {
start: offset,
end: length >= 0 ? offset + length : undefined
}));
})) as ReadableStream<Uint8Array>;
}
function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): RequestInit['body'] {
if (!uploadData) return null;
// Optimization: skip creating a stream if the request is just a single buffer.
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') return uploadData[0].bytes;
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') {
return uploadData[0].bytes as any;
}
const chunks = [...uploadData] as any[]; // TODO: types are wrong
let current: ReadableStreamDefaultReader | null = null;
return new ReadableStream({
const chunks = [...uploadData] as any[]; // TODO: refine ProtocolRequest types
// Use Node's web stream types explicitly to avoid DOM lib vs Node lib structural mismatches.
// Generic <Uint8Array> ensures reader.read() returns value?: Uint8Array consistent with enqueue.
let current: ReadableStreamDefaultReader<Uint8Array> | null = null;
return new ReadableStream<Uint8Array>({
async pull (controller) {
if (current) {
const { done, value } = await current.read();
@@ -67,7 +74,7 @@ function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): Reque
if (!chunks.length) { return controller.close(); }
const chunk = chunks.shift()!;
if (chunk.type === 'rawData') {
controller.enqueue(chunk.bytes);
controller.enqueue(chunk.bytes as Uint8Array);
} else if (chunk.type === 'file') {
current = makeStreamFromFileInfo(chunk).getReader();
return this.pull!(controller);

Some files were not shown because too many files have changed in this diff Show More