Compare commits

...

85 Commits

Author SHA1 Message Date
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
399 changed files with 7096 additions and 3071 deletions

View File

@@ -44,14 +44,6 @@ runs:
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Setup Siso for fork pull requests
if: ${{ github.event.pull_request.head.repo.full_name != github.repository }}
shell: bash
run: |
# Use Local Execution, Remote Caching (LERC). Checks the remote cache for action
# matches and uses existing results if a match is found. If not, execution of the
# action is performed locally.
echo "RBE_exec_strategy=local" >> $GITHUB_ENV
- name: Build Electron ${{ inputs.step-suffix }}
shell: bash
run: |
@@ -68,14 +60,28 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
if [ "$TARGET_PLATFORM" = "win" ]; then
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
else
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
fi
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -83,11 +89,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -97,7 +102,6 @@ runs:
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
e build --target electron:electron_mksnapshot_zip
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -131,7 +135,6 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
@@ -141,11 +144,6 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -165,17 +163,11 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -188,18 +180,6 @@ runs:
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip
e build --target electron:libcxxabi_headers_zip
e build --target electron:libcxx_objects_zip
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"

View File

@@ -172,7 +172,6 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

View File

@@ -17,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -60,10 +62,9 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=fb34fbad068586d9a6e2bb4e4950bdcf9aaee862
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -9,11 +9,11 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
- name: Setting Up Dig Site

View File

@@ -16,11 +16,11 @@ jobs:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444 # v5.0.0
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
@@ -73,6 +73,7 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -19,7 +19,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -41,7 +41,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -64,7 +64,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -54,7 +54,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -111,7 +111,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -141,7 +141,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -171,7 +171,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -189,7 +189,7 @@ jobs:
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
@@ -225,7 +225,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
@@ -244,7 +244,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64

View File

@@ -37,7 +37,7 @@ jobs:
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}

View File

@@ -31,7 +31,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -32,7 +32,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -47,7 +47,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -62,7 +62,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -77,7 +77,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -92,7 +92,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -23,7 +23,7 @@ jobs:
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +39,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -23,7 +23,7 @@ jobs:
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -66,6 +66,7 @@ concurrency:
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
@@ -84,12 +85,13 @@ jobs:
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -113,7 +115,7 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
cache: yarn
@@ -157,7 +159,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -44,7 +44,7 @@ jobs:
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +111,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -68,9 +68,10 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
- name: Add TCC permissions on macOS
@@ -110,11 +111,6 @@ jobs:
configure_sys_tccdb "$values"
fi
done
# Ref: https://github.com/getsentry/sentry-cocoa/blob/main/scripts/ci-enable-permissions.sh
if [ "$OSTYPE" = "darwin24" ]; then
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
fi
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
@@ -122,11 +118,17 @@ jobs:
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
@@ -176,22 +178,18 @@ jobs:
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
Expand-Archive -Force chromedriver.zip -DestinationPath ./
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
@@ -227,7 +225,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .

View File

@@ -46,7 +46,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -100,7 +100,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -19,7 +19,10 @@ jobs:
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@f1f6e5f6af878fb37288ce1c627459e94dbf7d01 # v3.29.5
uses: github/codeql-action/upload-sarif@16140ae1a102900babc80a33c44059580f687047 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -16,7 +16,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,7 +27,7 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
@@ -39,7 +39,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -36,7 +36,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

2
.nvmrc
View File

@@ -1 +1 @@
20
22

View File

@@ -586,6 +586,11 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
@@ -1619,6 +1624,29 @@ group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"

6
DEPS
View File

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'141.0.7390.7',
'143.0.7485.0',
'node_version':
'v22.19.0',
'v22.20.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':

View File

@@ -39,7 +39,7 @@ Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -19,15 +19,15 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false
dawn_enable_vulkan_validation_layers = false
# Removes dxc dll's that are only used experimentally.
# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
dawn_use_built_dxc = false
# These are disabled because they cause the zip manifest to differ between
# testing and release builds.
# See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.
@@ -72,3 +72,6 @@ enterprise_cloud_content_analysis = false
# We don't use anything from here, and it causes target collisions
enable_linux_installer = false
# Disable "Save to Drive" feature in PDF viewer
enable_pdf_save_to_drive = false

View File

@@ -421,6 +421,7 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.
@@ -1397,7 +1398,75 @@ details. Disabled by default.
This API must be called after the `ready` event is emitted.
> [!NOTE]
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
Notes:
* The array may be empty if no accessibility modes are active.
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
prefer this method for granular diagnostics or telemetry.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
// Change some app UI to better work with Screen Readers.
}
})
```
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
* `features` string[] - An array of the accessibility features to enable.
Possible values are:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
To disable all supported features, pass an empty array `[]`.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
// Enable a subset of features:
app.setAccessibilitySupportFeatures([
'screenReader',
'pdfPrinting',
'webContents'
])
// Other logic
// Some time later, disable all features:
app.setAccessibilitySupportFeatures([])
})
```
### `app.showAboutPanel()`

View File

@@ -1262,15 +1262,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1284,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -1442,15 +1442,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1463,11 +1464,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_
@@ -1570,11 +1574,18 @@ events.
Prevents the window contents from being captured by other apps.
On macOS it sets the NSWindow's [`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc) to [`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
On Windows it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
On Windows, it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
For Windows 10 version 2004 and up the window will be removed from capture entirely,
older Windows versions behave as if `WDA_MONITOR` is applied capturing a black window.
On macOS, it sets the `NSWindow`'s
[`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc)
to
[`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
Unfortunately, due to an intentional change in macOS, newer Mac applications that use
`ScreenCaptureKit` will capture your window despite `win.setContentProtection(true)`.
See [here](https://github.com/electron/electron/issues/48258#issuecomment-3269893618).
#### `win.isContentProtected()` _macOS_ _Windows_
Returns `boolean` - whether or not content protection is currently enabled.

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
On Linux, there is also a `selection` clipboard. To manipulate it
you need to pass `selection` to each method:

View File

@@ -193,6 +193,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The following is an example of setting up Electron to automatically submit
crash reports to a remote server:

View File

@@ -186,14 +186,3 @@ the one downloaded by `npm install`. Usage:
```sh
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
## Set By Electron
Electron sets some variables in your environment at runtime.
### `ORIGINAL_XDG_CURRENT_DESKTOP`
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
to affect other logic within Chromium so if you want access to the _original_ value
you should look up this environment variable instead.

View File

@@ -20,6 +20,12 @@ changes:
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `ipcRenderer` module is an [EventEmitter][event-emitter]. It provides a few
methods so you can send synchronous and asynchronous messages from the render
process (web page) to the main process. You can also receive replies from the

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `nativeImage` module provides a unified interface for manipulating
system images. These can be handy if you want to provide multiple scaled
versions of the same icon or take advantage of macOS [template images][template-image].

View File

@@ -2,7 +2,10 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.

View File

@@ -8,6 +8,7 @@
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` Integer - The exit code of the process, unless `reason` is
`launch-failed`, in which case `exitCode` will be a platform-specific
launch failure error code.

View File

@@ -87,6 +87,11 @@
paint event. Defaults to `false`. See the
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
more details.
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
the specified `preload` script in a separate JavaScript context. Defaults
to `true`. The context that the `preload` script runs in will only have

View File

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
The `systemPreferences` object emits the following events:
### Event: 'accent-color-changed' _Windows_
### Event: 'accent-color-changed' _Windows_ _Linux_
Returns:
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
or global value of a `key` previously set with `setUserDefault`.
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
### `systemPreferences.getAccentColor()`
Returns `string` - The users current system wide accent color preference in RGBA
hexadecimal form.

View File

@@ -4,6 +4,12 @@
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
`webFrame` export of the Electron module is an instance of the `WebFrame`
class representing the current frame. Sub-frames can be retrieved by
certain properties and methods (e.g. `webFrame.firstChild`).
@@ -139,7 +145,7 @@ by its key, which is returned from `webFrame.insertCSS(css)`.
Inserts `text` to the focused element.
### `webFrame.executeJavaScript(code[, userGesture, callback])`
### `webFrame.executeJavaScript(code[, userGesture][, callback])`
* `code` string
* `userGesture` boolean (optional) - Default is `false`.
@@ -160,7 +166,7 @@ In the browser window some HTML APIs like `requestFullScreen` can only be
invoked by a gesture from the user. Setting `userGesture` to `true` will remove
this limitation.
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture, callback])`
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture][, callback])`
* `worldId` Integer - The ID of the world to run the javascript
in, `0` is the default main world (where content runs), `999` is the

View File

@@ -4,6 +4,12 @@
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
## Methods
The `webUtils` module has the following methods:
@@ -17,11 +23,27 @@ Returns `string` - The file system path that this `File` object points to. In th
This method superseded the previous augmentation to the `File` object with the `path` property. An example is included below.
```js @ts-nocheck
// Before
const oldPath = document.querySelector('input').files[0].path
// After
const { webUtils } = require('electron')
const newPath = webUtils.getPathForFile(document.querySelector('input').files[0])
// Before (renderer)
const oldPath = document.querySelector('input[type=file]').files[0].path
```
```js @ts-nocheck
// After
// Renderer:
const file = document.querySelector('input[type=file]').files[0]
electronApi.doSomethingWithFile(file)
// Preload script:
const { contextBridge, webUtils } = require('electron')
contextBridge.exposeInMainWorld('electronApi', {
doSomethingWithFile (file) {
const path = webUtils.getPathForFile(file)
// Do something with the path, e.g., send it over IPC to the main process.
// It's best not to expose the full file path to the web content if possible.
}
})
```

View File

@@ -39,8 +39,8 @@ consider using `webContents.setWindowOpenHandler` to customize the
BrowserWindow creation.
A subset of [`WebPreferences`](structures/web-preferences.md) can be set directly,
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `preload`,
`javascript`, `contextIsolation`, and `webviewTag`.
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `javascript`,
`contextIsolation`, and `webviewTag`.
For example:

View File

@@ -47,9 +47,15 @@ See [here](https://www.electronjs.org/docs/latest/api/structures/offscreen-share
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
The default value of the `--ozone-platform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
Electron now defaults to running as a native Wayland app when launched in a Wayland session (when `XDG_SESSION_TYPE=wayland`).
Users can force XWayland by passing `--ozone-platform=x11`.
### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overriden and now reflects the actual desktop environment.
### Removed: macOS 11 support

View File

@@ -12,19 +12,28 @@ network problems. The best resolution is to try switching networks, or
wait a bit and try installing again.
You can also attempt to download Electron directly from
[electron/electron/releases](https://github.com/electron/electron/releases)
[GitHub Releases](https://github.com/electron/electron/releases)
if installing via `npm` is failing.
## When will Electron upgrade to latest Chrome?
If you need to install Electron through a custom mirror or proxy, see
the [Advanced Installation](./tutorial/installation.md) documentation for more details.
The Chrome version of Electron is usually bumped within one or two weeks after
a new stable Chrome version gets released. This estimate is not guaranteed and
depends on the amount of work involved with upgrading.
## How are Electron binaries downloaded?
Only the stable channel of Chrome is used. If an important fix is in beta or dev
channel, we will back-port it.
When you run `npm install electron`, the Electron binary for the corresponding version is downloaded
into your project's `node_modules` folder via npm's `postinstall` lifecycle script.
For more information, please see the [security introduction](tutorial/security.md).
This logic is handled by the [`@electron/get`](https://github.com/electron/get) utility package
under the hood.
## When will Electron upgrade to latest Chromium?
Every new major version of Electron releases with a Chromium major version upgrade. By releasing every
8 weeks, Electron is able to pull in every other major Chromium release on the very same day that it
releases upstream. Security fixes will be backported to stable release channels ahead of time.
See the [Electron Releases](./tutorial/electron-timelines.md) documentation for more details or
[releases.electronjs.org](https://releases.electronjs.org) to see our Release Status dashboard.
## When will Electron upgrade to latest Node.js?

View File

@@ -12,6 +12,15 @@ The ASAR format was created primarily to improve performance on Windows when
reading large quantities of small files (e.g. when loading your app's JavaScript
dependency tree from `node_modules`).
### ASAR integrity
ASAR integrity is an security feature that validates the contents of your app's
ASAR archives at runtime. When enabled, your Electron app will verify the
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
hashes, the app will forcefully terminate.
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
### code signing
Code signing is a process where an app developer digitally signs their code to

View File

@@ -5,7 +5,7 @@ slug: asar-integrity
hide_title: false
---
ASAR integrity is an experimental feature that validates the contents of your app's
ASAR integrity is a security feature that validates the contents of your app's
[ASAR archives](./asar-archives.md) at runtime.
## Version support
@@ -64,13 +64,10 @@ flipFuses(
)
```
:::tip Fuses in Electron Forge
With Electron Forge, you can configure your app's fuses with
[@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
in your Forge configuration file.
:::
> [!TIP]
> With Electron Forge, you can configure your app's fuses with
> [@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
> in your Forge configuration file.
## Providing the header hash
@@ -80,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
### Using Electron tooling
Electron Forge and Electron Packager do this setup automatically for you with no additional
configuration. The minimum required versions for ASAR integrity are:
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
* `@electron/packager@18.3.1`
* `@electron/forge@7.4.0`
@@ -109,7 +106,7 @@ Valid `algorithm` values are currently `SHA256` only. The `hash` is a hash of th
The `@electron/asar` package exposes a `getRawHeader` method whose result can then be hashed to generate this value
(e.g. using the [`node:crypto`](https://nodejs.org/api/crypto.html) module).
### Windows
#### Windows
When packaging for Windows, you must populate a valid [resource](https://learn.microsoft.com/en-us/windows/win32/menurc/resources)
entry of type `Integrity` and name `ElectronAsar`. The value of this resource should be a JSON encoded dictionary
@@ -125,9 +122,6 @@ in the form included below:
]
```
:::info
For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
in the Electron Packager code.
:::
> [!NOTE]
> For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
> in the Electron Packager code.

View File

@@ -233,10 +233,10 @@ can find [its documentation here](https://www.electron.build/code-signing).
[Azure Trusted Signing][] is Microsoft's modern cloud-based alternative to EV certificates.
It is the cheapest option for code signing on Windows, and it gets rid of SmartScreen warnings.
As of May 2025, Azure Trusted Signing is [available][trusted-signing-availability] to US and
Canada-based organizations with 3+ years of verifiable business history. Microsoft is looking
to make the program more widely available. If you're reading this at a later point, it could
make sense to check if the eligibility criteria have changed.
As of October 2025, Azure Trusted Signing is available to US and Canada-based organizations
with 3+ years of verifiable business history and to individual developers in the US and Canada.
Microsoft is looking to make the program more widely available. If you're reading this at a
later point, it could make sense to check if the eligibility criteria have changed.
#### Using Electron Forge
@@ -267,6 +267,5 @@ See the [Windows Store Guide][].
[maker-squirrel]: https://www.electronforge.io/config/makers/squirrel.windows
[maker-msi]: https://www.electronforge.io/config/makers/wix-msi
[azure trusted signing]: https://azure.microsoft.com/en-us/products/trusted-signing
[trusted-signing-availability]: https://techcommunity.microsoft.com/blog/microsoft-security-blog/trusted-signing-public-preview-update/4399713
[forge-trusted-signing]: https://www.electronforge.io/guides/code-signing/code-signing-windows#using-azure-trusted-signing
[builder-trusted-signing]: https://www.electron.build/code-signing-win#using-azure-trusted-signing-beta

View File

@@ -32,7 +32,7 @@ This table gives a general overview of where ESM is supported and which ESM load
| Main | Node.js | N/A | <ul><li> [You must use `await` generously before the app's `ready` event](#you-must-use-await-generously-before-the-apps-ready-event) </li></ul> |
| Renderer (Sandboxed) | Chromium | Unsupported | <ul><li> [Sandboxed preload scripts can't use ESM imports](#sandboxed-preload-scripts-cant-use-esm-imports) </li></ul> |
| Renderer (Unsandboxed & Context Isolated) | Chromium | Node.js | <ul><li> [Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content) </li> <li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li><li>[ESM preload scripts must be context isolated to use dynamic Node.js ESM imports](#esm-preload-scripts-must-be-context-isolated-to-use-dynamic-nodejs-esm-imports)</li></ul> |
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
## Main process

View File

@@ -4,11 +4,24 @@
## What are fuses?
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
From a security perspective, it makes sense to disable certain unused Electron features
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
subset of "living off the land" attacks.
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
We also don't want Electron consumers forking to achieve this goal, as building from source and
maintaining a fork is a massive technical challenge and costs a lot of time and money.
## Current Fuses
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
Because they are flipped at package time before you code sign your app, the OS becomes responsible
for ensuring those bits aren't flipped back via OS-level code signing validation
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
on Windows).
## Current fuses
### `runAsNode`
@@ -16,7 +29,11 @@ Fuses are the solution to this problem, at a high level they are "magic bits" in
**@electron/fuses:** `FuseV1Options.RunAsNode`
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
as expected, as it depends on this environment variable to function. Instead, we recommend that you
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
standalone Node.js process (e.g. a SQLite server process).
### `cookieEncryption`
@@ -24,7 +41,12 @@ The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variab
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
### `nodeOptions`
@@ -32,7 +54,11 @@ The cookieEncryption fuse toggles whether the cookie store on disk is encrypted
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
Most apps can safely disable this fuse.
### `nodeCliInspect`
@@ -40,7 +66,9 @@ The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
inspector. Most apps can safely disable this fuse.
### `embeddedAsarIntegrityValidation`
@@ -48,9 +76,12 @@ The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. f
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
Most apps can safely enable this fuse.
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
### `onlyLoadAppFromAsar`
@@ -58,7 +89,15 @@ For more information on how to use asar integrity validation please read the [As
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
By default, Electron will search for this code in the following order:
1. `app.asar`
1. `app`
1. `default_app.asar`
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
it is impossible to load non-validated code.
### `loadBrowserProcessSpecificV8Snapshot`
@@ -66,11 +105,17 @@ The onlyLoadAppFromAsar fuse changes the search system that Electron uses to loc
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
initialized heaps and then load them back in to avoid the cost of initializing the heap.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
Other processes will use the V8 snapshot file that they normally do.
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
Using separate snapshots for renderer processes and the main process can improve security, especially
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
### `grantFileProtocolExtraPrivileges`
@@ -78,19 +123,25 @@ Using separate snapshots for renderer processes and the main process can improve
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
are given privileges beyond what they would receive in a traditional web browser. This behavior was
core to Electron apps in original versions of Electron, but is no longer required as apps should be
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
If you aren't serving pages from `file://`, you should disable this fuse.
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
* `file://` protocol pages can use `fetch` to load other assets over `file://`
* `file://` protocol pages can use service workers
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
* `file://` protocol pages have universal access granted to child frames also running on `file://`
protocols regardless of sandbox settings
## How do I flip the fuses?
## How do I flip fuses?
### The easy way
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
```js @ts-nocheck
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -106,29 +157,37 @@ flipFuses(
)
```
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
app using the `@electron/fuses` CLI.
```bash
npx @electron/fuses read --app /Applications/Foo.app
```
>[!NOTE]
> If you are using Electron Forge to distribute your application, you can flip fuses using
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
> which comes pre-installed with all templates.
### The hard way
#### Quick Glossary
> [!IMPORTANT]
> Glossary:
>
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
> * **Fuse Schema**: The format/allowed values for the fuse wire
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
* **Fuse Schema**: The format / allowed values for the fuse wire
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
sequence of bytes that represent the state of the fuses you want.
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
```text
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
```
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -136,6 +195,6 @@ Somewhere in the Electron binary there will be a sequence of bytes that look lik
* "1" (0x31) indicates the fuse is enabled
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

View File

@@ -26,12 +26,12 @@ any dependencies in your app will not be installed.
## Customization
If you want to change the architecture that is downloaded (e.g., `ia32` on an
`x64` machine), you can use the `--arch` flag with npm install or set the
If you want to change the architecture that is downloaded (e.g., `x64` on an
`arm64` machine), you can use the `--arch` flag with npm install or set the
`npm_config_arch` environment variable:
```shell
npm install --arch=ia32 electron
npm install --arch=x64 electron
```
In addition to changing the architecture, you can also specify the platform
@@ -60,7 +60,7 @@ where `$VERSION` is the exact version of Electron).
If you are unable to access GitHub or you need to provide a custom build, you
can do so by either providing a mirror or an existing cache directory.
#### Mirror
### Mirror
You can use environment variables to override the base URL, the path at which to
look for Electron binaries, and the binary filename. The URL used by `@electron/get`
@@ -95,7 +95,7 @@ Electron release you may have to set `electron_use_remote_checksums=1` directly,
or configure it in a `.npmrc` file, to force Electron to use the remote `SHASUMS256.txt`
file to verify the checksum instead of the embedded checksums.
#### Cache
### Cache
Alternatively, you can override the local cache. `@electron/get` will cache
downloaded binaries in a local directory to not stress your network. You can use
@@ -120,7 +120,7 @@ The cache contains the version's official zip file as well as a checksum, and is
│ └── electron-v15.3.1-darwin-x64.zip
```
## Skip binary download
## Postinstall script
Under the hood, Electron's JavaScript API binds to a binary that contains its
implementations. Because this binary is crucial to the function of any Electron app,

View File

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
You should at least follow these steps to improve the security of your application:
1. [Only load secure content](#1-only-load-secure-content)
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
4. [Enable process sandboxing](#4-enable-process-sandboxing)
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -804,10 +804,10 @@ that your application might have the rights for.
#### How?
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
flipping these fuses easy. Check out the README of that module for more details on usage and
potential error cases, and refer to
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
### 20. Do not expose Electron APIs to untrusted web content

View File

@@ -55,14 +55,27 @@ There are a few rules to follow for the purposes of this tutorial:
- _author_, _license_, and _description_ can be any value, but will be necessary for
[packaging][packaging] later on.
:::caution Install dependencies with a regular `node_modules` folder
Electron's packaging toolchain requires the `node_modules` folder to be physically on disk in the
way that npm installs Node dependencies. By default, [Yarn Berry](https://yarnpkg.com/) and
[pnpm](http://pnpm.io/) both use alternative installation strategies.
Therefore, you must set [`nodeLinker: node-modules`](https://yarnpkg.com/configuration/yarnrc#nodeLinker)
in Yarn or [`nodeLinker: hoisted`](https://pnpm.io/settings#nodelinker) in pnpm if you are using
those package managers.
:::
Then, install Electron into your app's **devDependencies**, which is the list of external
development-only package dependencies not required in production.
:::info Why is Electron a devDependency?
:::info Why is Electron a dev dependency?
This may seem counter-intuitive since your production code is running Electron APIs.
However, packaged apps will come bundled with the Electron binary, eliminating the need to specify
it as a production dependency.
This may seem counter-intuitive since your production code is running Electron APIs. Under the hood,
Electron's JavaScript API binds to a binary that contains its implementations. The packaging step for
Electron handles the bundling of this binary, eliminating the need to specify it as a production
dependency.
:::
@@ -70,6 +83,17 @@ it as a production dependency.
npm install electron --save-dev
```
:::warning
In order to correctly install Electron, you need to ensure that its `postinstall` lifecycle
script is able to run. This means avoiding the `--ignore-scripts` flag on npm and allowlisting
`electron` to run build scripts on other package managers.
This is likely to change in a future version of Electron. See
[electron/rfcs#22](https://github.com/electron/rfcs/pull/22) for more details.
:::
Your package.json file should look something like this after initializing your package
and installing Electron. You should also now have a `node_modules` folder containing
the Electron executable, as well as a `package-lock.json` lockfile that specifies

View File

@@ -629,8 +629,6 @@ filenames = {
"shell/common/gin_converters/usb_device_info_converter.h",
"shell/common/gin_converters/value_converter.cc",
"shell/common/gin_converters/value_converter.h",
"shell/common/gin_helper/arguments.cc",
"shell/common/gin_helper/arguments.h",
"shell/common/gin_helper/callback.cc",
"shell/common/gin_helper/callback.h",
"shell/common/gin_helper/cleaned_up_at_exit.cc",

View File

@@ -217,6 +217,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
"//third_party/libc++/src/include/__atomic/contention_t.h",
"//third_party/libc++/src/include/__atomic/fence.h",
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
"//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -1365,7 +1366,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__tree",
"//third_party/libc++/src/include/__tuple/find_index.h",
"//third_party/libc++/src/include/__tuple/ignore.h",
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
"//third_party/libc++/src/include/__tuple/tuple_element.h",
"//third_party/libc++/src/include/__tuple/tuple_like.h",
@@ -1426,6 +1426,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
"//third_party/libc++/src/include/__type_traits/is_function.h",
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
"//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1468,6 +1469,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
"//third_party/libc++/src/include/__type_traits/make_signed.h",
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
"//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1499,6 +1501,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/cmp.h",
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
"//third_party/libc++/src/include/__utility/declval.h",
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/element_count.h",
"//third_party/libc++/src/include/__utility/empty.h",
"//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1509,6 +1512,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/integer_sequence.h",
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
"//third_party/libc++/src/include/__utility/is_valid_range.h",
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/move.h",
"//third_party/libc++/src/include/__utility/no_destroy.h",
"//third_party/libc++/src/include/__utility/pair.h",

View File

@@ -162,27 +162,6 @@ require('@electron/internal/browser/api/web-contents-view');
// Set main startup script of the app.
const mainStartupScript = packageJson.main || 'index.js';
const KNOWN_XDG_DESKTOP_VALUES = new Set(['Pantheon', 'Unity:Unity7', 'pop:GNOME']);
function currentPlatformSupportsAppIndicator () {
if (process.platform !== 'linux') return false;
const currentDesktop = process.env.XDG_CURRENT_DESKTOP;
if (!currentDesktop) return false;
if (KNOWN_XDG_DESKTOP_VALUES.has(currentDesktop)) return true;
// ubuntu based or derived session (default ubuntu one, communitheme…) supports
// indicator too.
if (/ubuntu/ig.test(currentDesktop)) return true;
return false;
}
// Workaround for electron/electron#5050 and electron/electron#9046
process.env.ORIGINAL_XDG_CURRENT_DESKTOP = process.env.XDG_CURRENT_DESKTOP;
if (currentPlatformSupportsAppIndicator()) {
process.env.XDG_CURRENT_DESKTOP = 'Unity';
}
// Quit when all windows are closed and no other one is listening to this.
app.on('window-all-closed', () => {
if (app.listenerCount('window-all-closed') === 1) {

View File

@@ -5,7 +5,9 @@ const proc = require('child_process');
const electron = require('./');
const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
let childClosed = false;
child.on('close', function (code, signal) {
childClosed = true;
if (code === null) {
console.error(electron, 'exited with signal', signal);
process.exit(1);
@@ -15,7 +17,7 @@ child.on('close', function (code, signal) {
const handleTerminationSignal = function (signal) {
process.on(signal, function signalHandler () {
if (!child.killed) {
if (!childClosed) {
child.kill(signal);
}
});
@@ -23,3 +25,4 @@ const handleTerminationSignal = function (signal) {
handleTerminationSignal('SIGINT');
handleTerminationSignal('SIGTERM');
handleTerminationSignal('SIGUSR2');

View File

@@ -10,7 +10,7 @@
"@electron/fiddle-core": "^1.3.4",
"@electron/github-app-auth": "^2.2.1",
"@electron/lint-roller": "^3.1.2",
"@electron/typescript-definitions": "^9.1.2",
"@electron/typescript-definitions": "^9.1.5",
"@octokit/rest": "^20.1.2",
"@primer/octicons": "^10.0.0",
"@types/minimist": "^1.2.5",
@@ -20,6 +20,7 @@
"@types/temp": "^0.9.4",
"@typescript-eslint/eslint-plugin": "^8.32.1",
"@typescript-eslint/parser": "^8.7.0",
"@xmldom/xmldom": "^0.8.11",
"buffer": "^6.0.3",
"chalk": "^4.1.0",
"check-for-leaks": "^1.2.1",

View File

@@ -22,7 +22,7 @@ index 345c94f6e26e88aac77b9feb92bd8d6665234981..8ef2ab8987da63f321d1dbb79f2eded8
// hash function when given a signature OID. To avoid unintended lax parsing
// of hash OIDs, this is no longer supported for lookup by OID or NID.
diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
--- a/crypto/fipsmodule/digest/digests.cc.inc
+++ b/crypto/fipsmodule/digest/digests.cc.inc
@@ -18,6 +18,7 @@

View File

@@ -20,10 +20,10 @@ index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a0212
case ssl_open_record_error:
diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
index 24c0d496f9d655f0f32634430e9c31d5592be939..b62418ba31927c5c4e2b424b993e40c63c868201 100644
index bbe428f20af5e67cf1335c7f1e42516638234af2..507f85f983bdc4a8c654dd10caf38a42634f5026 100644
--- a/ssl/ssl_lib.cc
+++ b/ssl/ssl_lib.cc
@@ -1207,7 +1207,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
}
if (ret_code == 0) {
@@ -32,7 +32,7 @@ index 24c0d496f9d655f0f32634430e9c31d5592be939..b62418ba31927c5c4e2b424b993e40c6
return SSL_ERROR_ZERO_RETURN;
}
// An EOF was observed which violates the protocol, and the underlying
@@ -2568,13 +2568,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
return CRYPTO_get_ex_data(&ctx->ex_data, idx);
}

View File

@@ -110,7 +110,6 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
refactor_expose_file_system_access_blocklist.patch
feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
fix_font_face_resolution_when_renderer_is_blocked.patch
feat_enable_passing_exit_code_on_service_process_crash.patch
chore_remove_reference_to_chrome_browser_themes.patch
feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
@@ -132,7 +131,6 @@ chore_grandfather_in_electron_views_and_delegates.patch
refactor_patch_electron_permissiontypes_into_blink.patch
revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
build_set_mac_sdk_minimum_to_10.patch
fix_add_macos_memory_query_fallback_to_avoid_crash.patch
fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
feat_add_support_for_embedder_snapshot_validation.patch
@@ -140,3 +138,8 @@ chore_restore_some_deprecated_wrapper_utility_in_gin.patch
chore_add_electron_objects_to_wrappablepointertag.patch
chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
revert_partial_remove_unused_prehandlemouseevent.patch
allow_electron_to_depend_on_components_os_crypt_sync.patch
expose_referrerscriptinfo_hostdefinedoptionsindex.patch
chore_disable_protocol_handler_dcheck.patch
fix_check_for_file_existence_before_setting_mtime.patch
revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

View File

@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
}
diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
--- a/ui/base/accelerators/accelerator.h
+++ b/ui/base/accelerators/accelerator.h
@@ -18,6 +18,7 @@
#include <vector>
#include "base/component_export.h"
+#include "third_party/abseil-cpp/absl/types/optional.h"
@@ -21,6 +21,7 @@
#include "base/time/time.h"
#include "build/blink_buildflags.h"
#include "build/build_config.h"
@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
return interrupted_by_mouse_event_;
+#include "third_party/abseil-cpp/absl/types/optional.h"
#include "ui/events/event_constants.h"
#include "ui/events/keycodes/keyboard_codes.h"
@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
<< 18); // masked to 6 bits
}
+ absl::optional<char16_t> shifted_char;

View File

@@ -10,7 +10,7 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
This should be upstreamed.
diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
index 558575cf06b10b59e114a9f53b90f01d8ecf63c4..0204ce5351a5190a20317f0cef6d3e8421541cac 100644
index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
--- a/content/gpu/gpu_main.cc
+++ b/content/gpu/gpu_main.cc
@@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {

View File

@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
context, which can cause some preload scripts to trip.
diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
index 284da783658bec333be748941784d43b13f6f244..18714ce8fc27c8d56c5deac27ba335078c452d0a 100644
index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
--- a/content/public/renderer/render_frame_observer.h
+++ b/content/public/renderer/render_frame_observer.h
@@ -139,6 +139,8 @@ class CONTENT_EXPORT RenderFrameObserver {
@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
virtual void DidHandleOnloadEvents() {}
virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
int32_t world_id) {}
@@ -23,10 +23,10 @@ index 284da783658bec333be748941784d43b13f6f244..18714ce8fc27c8d56c5deac27ba33507
int32_t world_id) {}
virtual void DidClearWindowObject() {}
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
index bc2ec7491d7072be77307d7b8af06e5397e2bdfb..addef4de8a95f47964a895e1d1cc4763f565a028 100644
index 792ecdf43c810d19641251d3f5eeddccc4c621e9..99d368046177dd92c8b36743f461d348bbf19a2e 100644
--- a/content/renderer/render_frame_impl.cc
+++ b/content/renderer/render_frame_impl.cc
@@ -4679,6 +4679,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
@@ -4723,6 +4723,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
observer.DidCreateScriptContext(context, world_id);
}
@@ -40,10 +40,10 @@ index bc2ec7491d7072be77307d7b8af06e5397e2bdfb..addef4de8a95f47964a895e1d1cc4763
int world_id) {
for (auto& observer : observers_)
diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
index 2950a6f600aab24226ef59acabddc74c9b67cac8..f0f4335aa815ea50dbf9b720b41e4eb31f27fb90 100644
index ce1d8807d624b35fa63ef83e3a95c7cba8f1f22f..61d4ef338cc4c0e99c144d6d95bbe0adba9d3556 100644
--- a/content/renderer/render_frame_impl.h
+++ b/content/renderer/render_frame_impl.h
@@ -602,6 +602,8 @@ class CONTENT_EXPORT RenderFrameImpl
@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
void DidObserveLayoutShift(double score, bool after_input_or_scroll) override;
void DidCreateScriptContext(v8::Local<v8::Context> context,
int world_id) override;
@@ -53,10 +53,10 @@ index 2950a6f600aab24226ef59acabddc74c9b67cac8..f0f4335aa815ea50dbf9b720b41e4eb3
int world_id) override;
void DidChangeScrollOffset() override;
diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
index 101e727b3a97bc764315eb694dc3975f9a408f9c..52e8828d8fffaba8ab05436cb4d727595f18238a 100644
index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
--- a/third_party/blink/public/web/web_local_frame_client.h
+++ b/third_party/blink/public/web/web_local_frame_client.h
@@ -661,6 +661,9 @@ class BLINK_EXPORT WebLocalFrameClient {
@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
virtual void DidCreateScriptContext(v8::Local<v8::Context>,
int32_t world_id) {}
@@ -123,10 +123,10 @@ index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e584
int32_t world_id) override;
diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
--- a/third_party/blink/renderer/core/loader/empty_clients.h
+++ b/third_party/blink/renderer/core/loader/empty_clients.h
@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
void DidCreateScriptContext(v8::Local<v8::Context>,
int32_t world_id) override {}

View File

@@ -7,10 +7,10 @@ Ensure that licenses for the dependencies introduced by Electron
are included in `LICENSES.chromium.html`
diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
index f5bfe41e67b5f9a34db16377528e7fae58f642ab..58d0af6a561a9d309a5a49894786ea382149c034 100755
--- a/tools/licenses/licenses.py
+++ b/tools/licenses/licenses.py
@@ -337,6 +337,31 @@ SPECIAL_CASES = {
@@ -342,6 +342,31 @@ SPECIAL_CASES = {
"License": "Apache 2.0",
"License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
},

View File

@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
--- a/ui/base/clipboard/scoped_clipboard_writer.cc
+++ b/ui/base/clipboard/scoped_clipboard_writer.cc
@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
}
}
@@ -29,10 +29,10 @@ index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464e
objects_.clear();
raw_objects_.clear();
diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
--- a/ui/base/clipboard/scoped_clipboard_writer.h
+++ b/ui/base/clipboard/scoped_clipboard_writer.h
@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
// This is only used to write custom format data.
void WriteData(std::u16string_view format, mojo_base::BigBuffer data);

View File

@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
WindowList.
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b235308986a8c 100644
index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da2967073016 100644
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
@@ -48,6 +48,7 @@
@@ -62,7 +62,7 @@ index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b2353
data.Set(kBrowsersField, std::move(browser_list));
#if BUILDFLAG(IS_WIN)
@@ -845,7 +846,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
@@ -844,7 +845,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
const std::string value = CheckJSValue(data.FindString(kValueField));
if (string_name == kApiTypeField) {
@@ -72,7 +72,7 @@ index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b2353
pref->SetString(prefs::kShownAccessibilityApiType, value);
}
}
@@ -899,7 +901,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
@@ -898,7 +900,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
AXPropertyFilter::ALLOW_EMPTY);
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
@@ -82,7 +82,7 @@ index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b2353
ui::AXApiType::Type api_type =
ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
std::string accessibility_contents =
@@ -926,6 +929,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
@@ -925,6 +928,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
AXPropertyFilter::ALLOW_EMPTY);
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
@@ -90,7 +90,7 @@ index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b2353
for (Browser* browser : *BrowserList::GetInstance()) {
if (browser->session_id().id() == session_id) {
base::Value::Dict result = BuildTargetDescriptor(browser);
@@ -938,6 +942,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
@@ -937,6 +941,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
return;
}
}
@@ -98,7 +98,7 @@ index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b2353
#endif // !BUILDFLAG(IS_ANDROID)
// No browser with the specified |session_id| was found.
base::Value::Dict result;
@@ -981,11 +986,13 @@ void AccessibilityUIMessageHandler::StopRecording(
@@ -980,11 +985,13 @@ void AccessibilityUIMessageHandler::StopRecording(
}
ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
@@ -115,7 +115,7 @@ index 7f8d93e3637188280cc6e10c5c47a2cdbc0cc38f..7ccd2a61b45b3f864c1d8caefd3b2353
// Check to see if it is in the supported types list.
if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
supported_types.end()) {
@@ -1055,10 +1062,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
@@ -1054,10 +1061,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
// static
void AccessibilityUIMessageHandler::RegisterProfilePrefs(
user_prefs::PrefRegistrySyncable* registry) {

View File

@@ -6,11 +6,11 @@ Subject: allow disabling blink scheduler throttling per RenderView
This allows us to disable throttling for hidden windows.
diff --git a/content/browser/renderer_host/navigation_controller_impl_unittest.cc b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
index 1d002528ba2b90d9c361c77ab00aeb1ccd000177..77f3b011f9c3710ac93ad20a92eafea0d35bb9a7 100644
index 74b39146bbb8151a66ecb4f138f769fffc2525b2..a54948fa36c85c5c5dd04b9836951b1ce1279038 100644
--- a/content/browser/renderer_host/navigation_controller_impl_unittest.cc
+++ b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
@@ -168,6 +168,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
(const std::optional<uint64_t> canvas_noise_token),
@@ -173,6 +173,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
(bool supports_draggable_regions),
(override));
+ MOCK_METHOD(
@@ -23,10 +23,10 @@ index 1d002528ba2b90d9c361c77ab00aeb1ccd000177..77f3b011f9c3710ac93ad20a92eafea0
return receiver_.BindNewEndpointAndPassDedicatedRemote();
}
diff --git a/content/browser/renderer_host/render_view_host_impl.cc b/content/browser/renderer_host/render_view_host_impl.cc
index ac7638da0c0b360d21b88e4e458d3687949884fa..45d2fe002330cb4aa7c81defaa5004d5e62e369a 100644
index 270750b9180a8ddab4f3cd2508fd398e07bf6377..20b2ae081a3710443ec919f1487dfbfe8f15de11 100644
--- a/content/browser/renderer_host/render_view_host_impl.cc
+++ b/content/browser/renderer_host/render_view_host_impl.cc
@@ -786,6 +786,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
@@ -785,6 +785,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
GetWidget()->GetAssociatedFrameWidget()->SetBackgroundOpaque(opaque);
}
@@ -51,25 +51,25 @@ index 7944fe64e0da112fc670358b75506bb199bb5e4a..0e3c16c6af2a078943e9f39808134ab2
void SendRendererPreferencesToRenderer(
const blink::RendererPreferences& preferences);
diff --git a/content/browser/renderer_host/render_widget_host_view_aura.cc b/content/browser/renderer_host/render_widget_host_view_aura.cc
index e98d74fecf4275ef8e7c6d23e5ea5ec3af80b926..0927d69b56d064327f0659d8ffe6ceff98064947 100644
index d97cbb4fd8e12bcbff19bf8cc8378997110c60c0..1041d25d5ef78abdcf7b85fe8457ec2a20e2a759 100644
--- a/content/browser/renderer_host/render_widget_host_view_aura.cc
+++ b/content/browser/renderer_host/render_widget_host_view_aura.cc
@@ -579,8 +579,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
@@ -632,8 +632,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
// OnShowWithPageVisibility will not call NotifyHostAndDelegateOnWasShown,
// which updates `visibility_`, unless the host is hidden. Make sure no update
// is needed.
- CHECK(host_->is_hidden() || visibility_ == Visibility::VISIBLE);
- CHECK(host_->IsHidden() || visibility_ == Visibility::VISIBLE);
- OnShowWithPageVisibility(page_visibility);
+ if (host_->is_hidden() || visibility_ == Visibility::VISIBLE)
+ if (host_->IsHidden() || visibility_ == Visibility::VISIBLE)
+ OnShowWithPageVisibility(page_visibility);
}
void RenderWidgetHostViewAura::EnsurePlatformVisibility(
diff --git a/content/public/browser/render_view_host.h b/content/public/browser/render_view_host.h
index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb19389b72203b 100644
index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060f0a640b1 100644
--- a/content/public/browser/render_view_host.h
+++ b/content/public/browser/render_view_host.h
@@ -75,6 +75,9 @@ class CONTENT_EXPORT RenderViewHost {
@@ -73,6 +73,9 @@ class CONTENT_EXPORT RenderViewHost {
virtual void WriteIntoTrace(
perfetto::TracedProto<TraceProto> context) const = 0;
@@ -80,34 +80,34 @@ index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb1938
// This interface should only be implemented inside content.
friend class RenderViewHostImpl;
diff --git a/content/test/test_page_broadcast.h b/content/test/test_page_broadcast.h
index 0dc1cd52dec74ede2117eb244e423d7f3ad322ea..352c64b3aec50546451a0033114e3a35dcf32136 100644
index 8762811ec25069ddd0c57e3ffb50d158532a39b1..f5cdae891cc3b98371ae18dbc119b5e7f379f2bf 100644
--- a/content/test/test_page_broadcast.h
+++ b/content/test/test_page_broadcast.h
@@ -53,6 +53,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
const blink::ColorProviderColorMaps& color_provider_colors) override;
@@ -54,6 +54,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
void UpdateCanvasNoiseToken(
std::optional<uint64_t> canvas_noise_token) override;
std::optional<blink::NoiseToken> canvas_noise_token) override;
void SetSupportsDraggableRegions(bool supports_draggable_regions) override;
+ void SetSchedulerThrottling(bool allowed) override {}
mojo::AssociatedReceiver<blink::mojom::PageBroadcast> receiver_;
};
diff --git a/third_party/blink/public/mojom/page/page.mojom b/third_party/blink/public/mojom/page/page.mojom
index bcf8559d759e73e4f3f00710d263fe24cc801828..556f990868b862452156cec2354a90ae75352251 100644
index fb846303b126c0bbaa252b8b6c5b9b2971100c62..e6dcf94dcde8515e9cf73656d6c1659492aac4b4 100644
--- a/third_party/blink/public/mojom/page/page.mojom
+++ b/third_party/blink/public/mojom/page/page.mojom
@@ -180,4 +180,7 @@ interface PageBroadcast {
// the noise token at ReadyToCommit time and update blink::WebViews that
// were made at request time.
UpdateCanvasNoiseToken(uint64? canvas_noise_token);
@@ -186,4 +186,7 @@ interface PageBroadcast {
// Indicates that the page's main frame should collect draggable regions set
// using the app-region CSS property.
SetSupportsDraggableRegions(bool supports_draggable_regions);
+
+ // Whether to enable the Renderer scheduler background throttling.
+ SetSchedulerThrottling(bool allowed);
};
diff --git a/third_party/blink/public/web/web_view.h b/third_party/blink/public/web/web_view.h
index b3553c0783a7b00e055f82ef0b72bd866284473d..c91e49807ec0b56d867504831118269116024626 100644
index 11a31c9ed26b5abde0ea812eae6b219340ed711c..a72cf76b820cb86b9495ea147efbdcf53b8a9845 100644
--- a/third_party/blink/public/web/web_view.h
+++ b/third_party/blink/public/web/web_view.h
@@ -365,6 +365,7 @@ class BLINK_EXPORT WebView {
@@ -366,6 +366,7 @@ class BLINK_EXPORT WebView {
// Scheduling -----------------------------------------------------------
virtual PageScheduler* Scheduler() const = 0;
@@ -116,10 +116,10 @@ index b3553c0783a7b00e055f82ef0b72bd866284473d..c91e49807ec0b56d8675048311182691
// Visibility -----------------------------------------------------------
diff --git a/third_party/blink/renderer/core/exported/web_view_impl.cc b/third_party/blink/renderer/core/exported/web_view_impl.cc
index 714b713cd466ac289b3d172ac484ddfd2b46190b..be43ac07eb6563dcb72374dfc4f3bd34913e98c3 100644
index 071ede882b2503e22ff97967a7f9cbfd96d048bd..baf06a06756ac7cdcd7f7aef15f812d5d64c04d3 100644
--- a/third_party/blink/renderer/core/exported/web_view_impl.cc
+++ b/third_party/blink/renderer/core/exported/web_view_impl.cc
@@ -2500,6 +2500,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
@@ -2512,6 +2512,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
TRACE_EVENT2("navigation", "WebViewImpl::SetPageLifecycleStateInternal",
"old_state", old_state, "new_state", new_state);
@@ -130,7 +130,7 @@ index 714b713cd466ac289b3d172ac484ddfd2b46190b..be43ac07eb6563dcb72374dfc4f3bd34
bool storing_in_bfcache = new_state->is_in_back_forward_cache &&
!old_state->is_in_back_forward_cache;
bool restoring_from_bfcache = !new_state->is_in_back_forward_cache &&
@@ -4009,10 +4013,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
@@ -4029,10 +4033,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
return GetPage()->GetPageScheduler();
}
@@ -155,10 +155,10 @@ index 714b713cd466ac289b3d172ac484ddfd2b46190b..be43ac07eb6563dcb72374dfc4f3bd34
// Do not throttle if the page should be painting.
bool is_visible =
diff --git a/third_party/blink/renderer/core/exported/web_view_impl.h b/third_party/blink/renderer/core/exported/web_view_impl.h
index 883269126ff93c26765ab62013035c6193f8adbb..f821da879a6b6b04d33ef60037a053f3a5c0851d 100644
index 9b9dd237525793b149f1e79d26e9e8043131c363..ec1d8054289b1ae6eb5a579fc82b90a92fe438ff 100644
--- a/third_party/blink/renderer/core/exported/web_view_impl.h
+++ b/third_party/blink/renderer/core/exported/web_view_impl.h
@@ -450,6 +450,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
@@ -452,6 +452,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
LocalDOMWindow* PagePopupWindow() const;
PageScheduler* Scheduler() const override;
@@ -166,7 +166,7 @@ index 883269126ff93c26765ab62013035c6193f8adbb..f821da879a6b6b04d33ef60037a053f3
void SetVisibilityState(mojom::blink::PageVisibilityState visibility_state,
bool is_initial_state) override;
mojom::blink::PageVisibilityState GetVisibilityState() override;
@@ -943,6 +944,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
@@ -945,6 +946,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
// If true, we send IPC messages when |preferred_size_| changes.
bool send_preferred_size_changes_ = false;

View File

@@ -0,0 +1,23 @@
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
From: John Kleinschmidt <jkleinsc@electronjs.org>
Date: Mon, 15 Sep 2025 15:52:55 -0400
Subject: Allow electron to depend on components/os_crypt/sync.
This is necessary after
https://chromium-review.googlesource.com/c/chromium/src/+/6944749
landed. That CL notes that "new code should use os_crypt async",
so we can remove this patch once we migrate our code to use
os_crypt async.
diff --git a/components/os_crypt/sync/BUILD.gn b/components/os_crypt/sync/BUILD.gn
index 43d25c4826c00af26fad9b4ed3c3bf0fee091fd4..bc1c9d9fe49c54cb635b1ea75bd5bc23ba5e4df2 100644
--- a/components/os_crypt/sync/BUILD.gn
+++ b/components/os_crypt/sync/BUILD.gn
@@ -10,6 +10,7 @@ import("//components/os_crypt/sync/features.gni")
component("sync") {
# New code should use os_crypt async.
visibility = [
+ "//electron:*",
"//chrome/browser",
"//chrome/browser/ui",
"//chrome/test:test_support",

View File

@@ -8,7 +8,7 @@ WebPreferences of in-process child windows, rather than relying on
process-level command line switches, as before.
diff --git a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
index e66a1b104fbcb6ac81b745a28588a994533745ff..08abd32cebf89d434bf60b4fd420430e88540adc 100644
index dd803e6537c9c7eb1d6e5b36c4268ce2c2314622..c84364663dbb0bcbc51048f1d41bfb6f962dfea4 100644
--- a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
+++ b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
@@ -148,6 +148,19 @@ bool StructTraits<blink::mojom::WebPreferencesDataView,
@@ -32,7 +32,7 @@ index e66a1b104fbcb6ac81b745a28588a994533745ff..08abd32cebf89d434bf60b4fd420430e
out->accelerated_video_decode_enabled =
data.accelerated_video_decode_enabled();
diff --git a/third_party/blink/public/common/web_preferences/web_preferences.h b/third_party/blink/public/common/web_preferences/web_preferences.h
index 39eefd4970a93bef42487d51e9c0bdfd76a001a0..a76da90ca59e07ad57ae85ee765b90875b82819c 100644
index 2a2ccea94b2a1af9ed54b884e1c0cdf67c4a6c32..24c3c81c5170291974cef00f201d69a9ce93ef0f 100644
--- a/third_party/blink/public/common/web_preferences/web_preferences.h
+++ b/third_party/blink/public/common/web_preferences/web_preferences.h
@@ -9,6 +9,7 @@
@@ -43,7 +43,7 @@ index 39eefd4970a93bef42487d51e9c0bdfd76a001a0..a76da90ca59e07ad57ae85ee765b9087
#include "build/build_config.h"
#include "net/nqe/effective_connection_type.h"
#include "third_party/blink/public/common/common_export.h"
@@ -462,6 +463,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
@@ -463,6 +464,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
bool increment_local_surface_id_for_mainframe_same_doc_navigation = true;
#endif // BUILDFLAG(IS_ANDROID)
@@ -64,7 +64,7 @@ index 39eefd4970a93bef42487d51e9c0bdfd76a001a0..a76da90ca59e07ad57ae85ee765b9087
// chrome, except for the cases where it would require lots of extra work for
// the embedder to use the same default value.
diff --git a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
index 36e04a5f887fd9102b3d74a4230132ecee780c1b..8e53242f1be83920ca64c95c31aa674e04d2bb81 100644
index ccba9b7353c87d2e2bced7770920c976865c0d65..4d93ef8c1976cf533c32bc9c17dbf6b81f2b59c6 100644
--- a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
+++ b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
@@ -8,6 +8,7 @@
@@ -129,7 +129,7 @@ index 36e04a5f887fd9102b3d74a4230132ecee780c1b..8e53242f1be83920ca64c95c31aa674e
return r.cookie_enabled;
}
diff --git a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
index dd6185b0eacf942d902505ac23bf88059bf2786a..f3f1c71f241db0a90144909971412009e5510b6e 100644
index a8bae4875ba2a8dd3d2574f55d6c229fc8025aa0..b5162c90cc3036ce97ceae590ef905033e10b399 100644
--- a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
+++ b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
@@ -8,9 +8,11 @@ import "third_party/blink/public/mojom/css/preferred_color_scheme.mojom";

View File

@@ -49,10 +49,10 @@ index cdb5b9246087b5678cf6a0f2713f6238dafc13de..7efbe7524c5ddd3785fff0e2d8901f93
// its owning reference back to our owning LocalFrame.
client_->Detached(type);
diff --git a/third_party/blink/renderer/core/frame/local_frame.cc b/third_party/blink/renderer/core/frame/local_frame.cc
index 7d0f966131a4e91efd4652e23dec8287e98b82a9..75975a8d48b05ba25b169b93b62bb7d34eb3f5b7 100644
index 9338d883b1441e1ddd4b39a87f56cd62d6c0eff7..e7f9b2ebfd5a04290b8d2d8a75141534e35bc4c6 100644
--- a/third_party/blink/renderer/core/frame/local_frame.cc
+++ b/third_party/blink/renderer/core/frame/local_frame.cc
@@ -751,10 +751,6 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
@@ -747,10 +747,6 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
}
DCHECK(!view_ || !view_->IsAttached());
@@ -63,7 +63,7 @@ index 7d0f966131a4e91efd4652e23dec8287e98b82a9..75975a8d48b05ba25b169b93b62bb7d3
if (!Client())
return false;
@@ -808,6 +804,11 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
@@ -804,6 +800,11 @@ bool LocalFrame::DetachImpl(FrameDetachType type) {
DCHECK(!view_->IsAttached());
Client()->WillBeDetached();

View File

@@ -8,10 +8,10 @@ categories in use are known / declared. This patch is required for us
to introduce a new Electron category for Electron-specific tracing.
diff --git a/base/trace_event/builtin_categories.h b/base/trace_event/builtin_categories.h
index 28d3c301465335cc664dad51e41133cd04fa8a62..290363dfa65a3207e5ade788825d470122a4afc8 100644
index 0781468366f8684b0e245bd6df85c1f48b5a915a..5d4ea347e2cba761870462ff1e623792416dbf4c 100644
--- a/base/trace_event/builtin_categories.h
+++ b/base/trace_event/builtin_categories.h
@@ -126,6 +126,7 @@ PERFETTO_DEFINE_CATEGORIES_IN_NAMESPACE_WITH_ATTRS(
@@ -128,6 +128,7 @@ PERFETTO_DEFINE_CATEGORIES_IN_NAMESPACE_WITH_ATTRS(
perfetto::Category("drm"),
perfetto::Category("drmcursor"),
perfetto::Category("dwrite"),

View File

@@ -10,10 +10,10 @@ Needed for:
2) //electron/shell/common:web_contents_utility
diff --git a/content/public/common/BUILD.gn b/content/public/common/BUILD.gn
index 981abc2963aaaa8f4cf283cdc0807907500b65eb..4be2f078f0c9890d0bcca635a82711386abae077 100644
index b6511498e08e6d0a280b89175fcfdb61c7e40df4..e214d7ea5e7108baf9f9910d6b44deff587914c2 100644
--- a/content/public/common/BUILD.gn
+++ b/content/public/common/BUILD.gn
@@ -382,6 +382,8 @@ mojom("interfaces") {
@@ -370,6 +370,8 @@ mojom("interfaces") {
"//content/common/*",
"//extensions/common:mojom",
"//extensions/common:mojom_blink",

View File

@@ -11,15 +11,15 @@ This patch can (and should) be removed when we can prevent those symbols
from being stripped in the release build.
diff --git a/build/config/compiler/compiler.gni b/build/config/compiler/compiler.gni
index 0611cd47ef35d3b137a3278896a9174ae2fc3c31..a076c0f461b50fea86679a148b857739f7ec2c3d 100644
index 2cf6def300d9d92d476ca4ca792347a49bafc26a..8e54f1d3e50a2c56b0cf35a8e56f97f6622401d5 100644
--- a/build/config/compiler/compiler.gni
+++ b/build/config/compiler/compiler.gni
@@ -88,7 +88,7 @@ declare_args() {
# have the same LLVM revisions as us, making bitcode useless to them.
@@ -85,7 +85,7 @@ declare_args() {
# Chrome's clang. crbug.com/1033839
use_thin_lto =
is_cfi || (is_clang && is_official_build && chrome_pgo_phase != 1 &&
- (is_linux || is_win || is_mac ||
+ (is_linux || is_win ||
(is_ios && use_lld && !is_cronet_build) ||
- (is_linux || is_win || is_mac || (is_ios && use_lld) ||
+ (is_linux || is_win || (is_ios && use_lld) ||
(is_android && target_os != "chromeos") ||
(is_chromeos && is_chromeos_device)))

View File

@@ -11,10 +11,10 @@ if we ever align our .pak file generation with Chrome we can remove this
patch.
diff --git a/chrome/BUILD.gn b/chrome/BUILD.gn
index e648bb4ed2ff72441faa8773e449e0b6174f5af5..fd2c1d3ac575d10de7d5c09e4418d17217a43b77 100644
index e7ee2d88b136be97e0668874a309085554041a5a..1ed28fa85bf906bea9628da146627067b105d94f 100644
--- a/chrome/BUILD.gn
+++ b/chrome/BUILD.gn
@@ -195,11 +195,16 @@ if (!is_android && !is_mac) {
@@ -196,11 +196,16 @@ if (!is_android && !is_mac) {
"common/crash_keys.h",
]
@@ -33,7 +33,7 @@ index e648bb4ed2ff72441faa8773e449e0b6174f5af5..fd2c1d3ac575d10de7d5c09e4418d172
"//base",
"//build:branding_buildflags",
diff --git a/chrome/browser/BUILD.gn b/chrome/browser/BUILD.gn
index f2f0b13a9b96b906d39cfad4236a7e72b9439e06..7a2dc270b8c19f4418074ad23dd793d15223b33a 100644
index 03767f1fa536107112eee7106323238caeeedf2c..0df5df319e4d84daed9d9017691950579fce7ae3 100644
--- a/chrome/browser/BUILD.gn
+++ b/chrome/browser/BUILD.gn
@@ -4811,7 +4811,7 @@ static_library("browser") {
@@ -46,10 +46,10 @@ index f2f0b13a9b96b906d39cfad4236a7e72b9439e06..7a2dc270b8c19f4418074ad23dd793d1
# than here in :chrome_dll.
deps += [ "//chrome:packed_resources_integrity_header" ]
diff --git a/chrome/test/BUILD.gn b/chrome/test/BUILD.gn
index c60cdd5bf0b3327b5495238c9296b99413c7c226..433a20d22a4df2355d6d407963047491bf3f3b2b 100644
index 932793506ca9259d6c4f67f6e2bbbd654b2c7be3..eff32d19f785d871e9ec9a63fe52151ee485dc1e 100644
--- a/chrome/test/BUILD.gn
+++ b/chrome/test/BUILD.gn
@@ -7515,9 +7515,12 @@ test("unit_tests") {
@@ -7563,9 +7563,12 @@ test("unit_tests") {
"//chrome/notification_helper",
]
@@ -63,7 +63,7 @@ index c60cdd5bf0b3327b5495238c9296b99413c7c226..433a20d22a4df2355d6d407963047491
"//chrome//services/util_win:unit_tests",
"//chrome/app:chrome_dll_resources",
"//chrome/app:win_unit_tests",
@@ -8447,6 +8450,10 @@ test("unit_tests") {
@@ -8499,6 +8502,10 @@ test("unit_tests") {
"../browser/performance_manager/policies/background_tab_loading_policy_unittest.cc",
]
@@ -74,7 +74,7 @@ index c60cdd5bf0b3327b5495238c9296b99413c7c226..433a20d22a4df2355d6d407963047491
sources += [
# The importer code is not used on Android.
"../common/importer/firefox_importer_utils_unittest.cc",
@@ -8503,7 +8510,6 @@ test("unit_tests") {
@@ -8555,7 +8562,6 @@ test("unit_tests") {
# TODO(crbug.com/417513088): Maybe merge with the non-android `deps` declaration above?
deps += [
"../browser/screen_ai:screen_ai_install_state",

View File

@@ -7,7 +7,7 @@ These are variables we add to the root BUILDCONFIG so that they're available
everywhere, without having to import("//electron/.../flags.gni").
diff --git a/build/config/BUILDCONFIG.gn b/build/config/BUILDCONFIG.gn
index 24a1d143954ae05ae0b79b0994b76ef9218fb848..5c9b2ed8ba48a1056560ca1cd1d5b976aee4815c 100644
index 29b0bbeae4dd412876fdaa15688bd248c93216b4..1a1b2fa45cf6e565359ae84256e6dbe5246322c5 100644
--- a/build/config/BUILDCONFIG.gn
+++ b/build/config/BUILDCONFIG.gn
@@ -123,6 +123,9 @@ if (current_os == "") {

View File

@@ -7,10 +7,10 @@ Build libc++ as static library to compile and pass
nan tests
diff --git a/buildtools/third_party/libc++/BUILD.gn b/buildtools/third_party/libc++/BUILD.gn
index 7dcefd2bceb209c6e74445259fac00e3e2280ff7..3a233d2e9dafc2093ead8f9c9104d06fe6176252 100644
index f1ac049db7df5637c94893009287b53c6127158f..ebf028bdb2934ca2f9f2ab7b7c3e6d3daa544d37 100644
--- a/buildtools/third_party/libc++/BUILD.gn
+++ b/buildtools/third_party/libc++/BUILD.gn
@@ -841,6 +841,7 @@ target(libcxx_target_type, "libc++") {
@@ -481,6 +481,7 @@ target(libcxx_target_type, "libc++") {
# need to explicitly depend on libc++.
visibility = [
"//build/config:common_deps",

View File

@@ -20,10 +20,10 @@ index 17103061c4752e6fcac07413dbf574e0c6fd6d39..848be71fa6dc81a64b7274b31d461f9d
/win-cross/
reproxy.cfg
diff --git a/buildtools/reclient_cfgs/configure_reclient_cfgs.py b/buildtools/reclient_cfgs/configure_reclient_cfgs.py
index 128bda296c91eac5f0c2fcfeed0c553deb5514dd..f1e33d36810dba80a42608655beb27c6e197a888 100755
index 8779d4609c9eed155c414a1c97d3598906857b22..731ac034f85c8c5ebee6d29a0395f6e828b41ab0 100755
--- a/buildtools/reclient_cfgs/configure_reclient_cfgs.py
+++ b/buildtools/reclient_cfgs/configure_reclient_cfgs.py
@@ -344,4 +344,13 @@ def main():
@@ -334,4 +334,13 @@ def main():
if __name__ == "__main__":

View File

@@ -1,26 +0,0 @@
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
From: Keeley Hammond <khammond@slack-corp.com>
Date: Tue, 1 Jul 2025 15:40:02 -0700
Subject: build: Set MacOS SDK minimum back to 10
This commit reverts 6493969: Update mac_sdk_min to
match minimum required SDK version |
https://chromium-review.googlesource.com/c/chromium/src/+/6493969
This patch is purely to unblock nightlies while
we merge an upstream fix and allocate additional space
on the Mac runners. If this patch is still in main
anytime after July 30, 2025, find @VerteDinde and yell
at her.
diff --git a/build/config/mac/mac_sdk_overrides.gni b/build/config/mac/mac_sdk_overrides.gni
index 8f8ac1c218ce15fa5c1aecbbcd0b93281f6c52f2..15ddfd5cffbaba0704b3217e1ae4f2825f399d96 100644
--- a/build/config/mac/mac_sdk_overrides.gni
+++ b/build/config/mac/mac_sdk_overrides.gni
@@ -7,5 +7,5 @@
declare_args() {
# Minimum supported version of the Mac SDK.
- mac_sdk_min = "15"
+ mac_sdk_min = "10.15"
}

View File

@@ -9,10 +9,10 @@ potentially prevent a window from being created.
TODO(loc): this patch is currently broken.
diff --git a/content/browser/renderer_host/render_frame_host_impl.cc b/content/browser/renderer_host/render_frame_host_impl.cc
index 666ed8890f60cd0477b814b4b44571002eca9bff..73f730ff05a22938a834921d4842bf1f9faaca67 100644
index 55ba21754555cccb095707d30fcefeaf15ea13c6..e76cccefbbf77fcfb886c41d501bcff4fd27be2f 100644
--- a/content/browser/renderer_host/render_frame_host_impl.cc
+++ b/content/browser/renderer_host/render_frame_host_impl.cc
@@ -9823,6 +9823,7 @@ void RenderFrameHostImpl::CreateNewWindow(
@@ -9861,6 +9861,7 @@ void RenderFrameHostImpl::CreateNewWindow(
last_committed_origin_, params->window_container_type,
params->target_url, params->referrer.To<Referrer>(),
params->frame_name, params->disposition, *params->features,
@@ -21,10 +21,10 @@ index 666ed8890f60cd0477b814b4b44571002eca9bff..73f730ff05a22938a834921d4842bf1f
&no_javascript_access);
diff --git a/content/browser/web_contents/web_contents_impl.cc b/content/browser/web_contents/web_contents_impl.cc
index 3677a957465f59ab80ac059bfcb5afdf98513b48..7a6760e0efdf6972eb497407b68202c5bfffd006 100644
index 49d18f7595e463cc98c888a942f837757a27a596..a7ea73a46936ab4f82880121767376383864959b 100644
--- a/content/browser/web_contents/web_contents_impl.cc
+++ b/content/browser/web_contents/web_contents_impl.cc
@@ -5298,6 +5298,10 @@ FrameTree* WebContentsImpl::CreateNewWindow(
@@ -5350,6 +5350,10 @@ FrameTree* WebContentsImpl::CreateNewWindow(
create_params.initially_hidden = renderer_started_hidden;
create_params.initial_popup_url = params.target_url;
@@ -35,7 +35,7 @@ index 3677a957465f59ab80ac059bfcb5afdf98513b48..7a6760e0efdf6972eb497407b68202c5
// Even though all codepaths leading here are in response to a renderer
// trying to open a new window, if the new window ends up in a different
// browsing instance, then the RenderViewHost, RenderWidgetHost,
@@ -5353,6 +5357,12 @@ FrameTree* WebContentsImpl::CreateNewWindow(
@@ -5404,6 +5408,12 @@ FrameTree* WebContentsImpl::CreateNewWindow(
// Sets the newly created WebContents WindowOpenDisposition.
new_contents_impl->original_window_open_disposition_ = params.disposition;
@@ -48,7 +48,7 @@ index 3677a957465f59ab80ac059bfcb5afdf98513b48..7a6760e0efdf6972eb497407b68202c5
// If the new frame has a name, make sure any SiteInstances that can find
// this named frame have proxies for it. Must be called after
// SetSessionStorageNamespace, since this calls CreateRenderView, which uses
@@ -5394,12 +5404,6 @@ FrameTree* WebContentsImpl::CreateNewWindow(
@@ -5445,12 +5455,6 @@ FrameTree* WebContentsImpl::CreateNewWindow(
AddWebContentsDestructionObserver(new_contents_impl);
}
@@ -62,10 +62,10 @@ index 3677a957465f59ab80ac059bfcb5afdf98513b48..7a6760e0efdf6972eb497407b68202c5
new_contents_impl, opener, params.target_url,
params.referrer.To<Referrer>(), params.disposition,
diff --git a/content/common/frame.mojom b/content/common/frame.mojom
index 90cc84198b7f23c6a07ab503f60a577fdfba5baa..722b27b8adaf86624058ace5f9b5871ff0ede627 100644
index 15a83f61ed4e31ba34cbc19995cd9d68b1599f1d..9cf9fefad46a6c2ead4085adc76e0c07369f641a 100644
--- a/content/common/frame.mojom
+++ b/content/common/frame.mojom
@@ -661,6 +661,10 @@ struct CreateNewWindowParams {
@@ -662,6 +662,10 @@ struct CreateNewWindowParams {
pending_associated_remote<blink.mojom.Widget> widget;
pending_associated_receiver<blink.mojom.FrameWidgetHost> frame_widget_host;
pending_associated_remote<blink.mojom.FrameWidget> frame_widget;
@@ -77,10 +77,10 @@ index 90cc84198b7f23c6a07ab503f60a577fdfba5baa..722b27b8adaf86624058ace5f9b5871f
// Operation result when the renderer asks the browser to create a new window.
diff --git a/content/public/browser/content_browser_client.cc b/content/public/browser/content_browser_client.cc
index 750edc0c6767ab6a59d010b4f3f02770e50450b0..60e7eebb4f40df18e3fa28f57b7bbb20733477e7 100644
index 7b813d46382672421e569f68204f6f127bab7dce..64ad3e62245ad9b1fd0b8e0487b6d14d34a6d5f3 100644
--- a/content/public/browser/content_browser_client.cc
+++ b/content/public/browser/content_browser_client.cc
@@ -884,6 +884,8 @@ bool ContentBrowserClient::CanCreateWindow(
@@ -881,6 +881,8 @@ bool ContentBrowserClient::CanCreateWindow(
const std::string& frame_name,
WindowOpenDisposition disposition,
const blink::mojom::WindowFeatures& features,
@@ -90,10 +90,10 @@ index 750edc0c6767ab6a59d010b4f3f02770e50450b0..60e7eebb4f40df18e3fa28f57b7bbb20
bool opener_suppressed,
bool* no_javascript_access) {
diff --git a/content/public/browser/content_browser_client.h b/content/public/browser/content_browser_client.h
index eb7b1fdf7c3b3373201db40f03fc498c4ee08d25..f27b387da5ff4e4f20d28d80043151ad2f2e9d51 100644
index 3f0599ae229b9785146fcd29528d183f2d04a8e7..ef9073ffcf8a5fa51fa028667cf3328cfae6f994 100644
--- a/content/public/browser/content_browser_client.h
+++ b/content/public/browser/content_browser_client.h
@@ -201,6 +201,7 @@ class NetworkService;
@@ -196,6 +196,7 @@ class NetworkService;
class TrustedURLLoaderHeaderClient;
} // namespace mojom
struct ResourceRequest;
@@ -101,7 +101,7 @@ index eb7b1fdf7c3b3373201db40f03fc498c4ee08d25..f27b387da5ff4e4f20d28d80043151ad
} // namespace network
namespace sandbox {
@@ -1449,6 +1450,8 @@ class CONTENT_EXPORT ContentBrowserClient {
@@ -1454,6 +1455,8 @@ class CONTENT_EXPORT ContentBrowserClient {
const std::string& frame_name,
WindowOpenDisposition disposition,
const blink::mojom::WindowFeatures& features,
@@ -111,10 +111,10 @@ index eb7b1fdf7c3b3373201db40f03fc498c4ee08d25..f27b387da5ff4e4f20d28d80043151ad
bool opener_suppressed,
bool* no_javascript_access);
diff --git a/content/public/browser/web_contents_delegate.cc b/content/public/browser/web_contents_delegate.cc
index a8c0f1c63847f814b6e71fe24ae9aed24b26ba19..80d004eb9060e33af9e60b31a862a7dcecb254e8 100644
index edee20df7f5bb087df9c134c7892f4befe2f14b9..df972f1ce594f2d4651202b650ff2d41fe19ecd0 100644
--- a/content/public/browser/web_contents_delegate.cc
+++ b/content/public/browser/web_contents_delegate.cc
@@ -33,6 +33,17 @@ namespace content {
@@ -34,6 +34,17 @@ namespace content {
WebContentsDelegate::WebContentsDelegate() = default;
@@ -133,7 +133,7 @@ index a8c0f1c63847f814b6e71fe24ae9aed24b26ba19..80d004eb9060e33af9e60b31a862a7dc
WebContents* source,
const OpenURLParams& params,
diff --git a/content/public/browser/web_contents_delegate.h b/content/public/browser/web_contents_delegate.h
index 1af915fcc91ae29bb9a6e2fc51f788178365ee4c..6a43f8c30857bfb32867e63d570ad26459af9ae8 100644
index caf97e0c94edfa1106b465e793190c82f646ebdb..38b61d04446736bcc44a412f633c01ed9aca5399 100644
--- a/content/public/browser/web_contents_delegate.h
+++ b/content/public/browser/web_contents_delegate.h
@@ -18,6 +18,7 @@
@@ -152,7 +152,7 @@ index 1af915fcc91ae29bb9a6e2fc51f788178365ee4c..6a43f8c30857bfb32867e63d570ad264
#include "content/public/common/window_container_type.mojom-forward.h"
#include "third_party/blink/public/common/input/web_mouse_event.h"
#include "third_party/blink/public/common/mediastream/media_stream_request.h"
@@ -381,6 +383,16 @@ class CONTENT_EXPORT WebContentsDelegate {
@@ -388,6 +390,16 @@ class CONTENT_EXPORT WebContentsDelegate {
const StoragePartitionConfig& partition_config,
SessionStorageNamespace* session_storage_namespace);
@@ -170,10 +170,10 @@ index 1af915fcc91ae29bb9a6e2fc51f788178365ee4c..6a43f8c30857bfb32867e63d570ad264
// typically happens when popups are created.
virtual void WebContentsCreated(WebContents* source_contents,
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
index a8d472bb78f3a9478b70cf3d98c35affec7caf39..bc2ec7491d7072be77307d7b8af06e5397e2bdfb 100644
index 66714ce46183169853952879cca77069ad248017..792ecdf43c810d19641251d3f5eeddccc4c621e9 100644
--- a/content/renderer/render_frame_impl.cc
+++ b/content/renderer/render_frame_impl.cc
@@ -6772,6 +6772,10 @@ WebView* RenderFrameImpl::CreateNewWindow(
@@ -6815,6 +6815,10 @@ WebView* RenderFrameImpl::CreateNewWindow(
request.HasUserGesture(), GetWebFrame()->IsAdFrame(),
GetWebFrame()->IsAdScriptInStack());
@@ -185,10 +185,10 @@ index a8d472bb78f3a9478b70cf3d98c35affec7caf39..bc2ec7491d7072be77307d7b8af06e53
// moved on send.
bool is_background_tab =
diff --git a/content/web_test/browser/web_test_content_browser_client.cc b/content/web_test/browser/web_test_content_browser_client.cc
index 66a10226b043a490295e518230c20bba0ed71d6c..14b78014d93ce459789fd497dfcfb71e2cc769bd 100644
index 576fd50ec4c27c6c2da9674e68f65fd0a21d1d68..b44304f128fb97523c9c9046b5edece8c09c5c0f 100644
--- a/content/web_test/browser/web_test_content_browser_client.cc
+++ b/content/web_test/browser/web_test_content_browser_client.cc
@@ -537,6 +537,8 @@ bool WebTestContentBrowserClient::CanCreateWindow(
@@ -538,6 +538,8 @@ bool WebTestContentBrowserClient::CanCreateWindow(
const std::string& frame_name,
WindowOpenDisposition disposition,
const blink::mojom::WindowFeatures& features,
@@ -232,10 +232,10 @@ index 82e9d3dfb5f7da76d89fe15ae61d379fa46e177d..fd035512099a54dff6cc951a2226c23a
} // namespace blink
diff --git a/third_party/blink/renderer/core/frame/local_dom_window.cc b/third_party/blink/renderer/core/frame/local_dom_window.cc
index 68ab3d483fe60671de50ec8952a0f71f103e4ad3..7ea5e45c08d7af439cf3eec041391ed7902ec865 100644
index 29a3e6f8640c8c574803dde123639d52e089e421..15f9762af0726b52657982e2005d8a40a011a848 100644
--- a/third_party/blink/renderer/core/frame/local_dom_window.cc
+++ b/third_party/blink/renderer/core/frame/local_dom_window.cc
@@ -2333,6 +2333,8 @@ DOMWindow* LocalDOMWindow::open(v8::Isolate* isolate,
@@ -2347,6 +2347,8 @@ DOMWindow* LocalDOMWindow::open(v8::Isolate* isolate,
WebWindowFeatures window_features =
GetWindowFeaturesFromString(features, entered_window);

View File

@@ -6,10 +6,10 @@ Subject: chore: add electron deps to gitignores
Makes things like "git status" quicker when developing electron locally
diff --git a/.gitignore b/.gitignore
index 5eb6e4d1815a7a56c7fff1d6f095e6c7e8127b84..808d897ba80abb9cced32a02cb7026305afe0dd2 100644
index 22985d0edf211adc576c14ddb0fb21192a636d99..210132f7864c04ac7ffab70875b1c8905bd00e62 100644
--- a/.gitignore
+++ b/.gitignore
@@ -226,6 +226,7 @@ vs-chromium-project.txt
@@ -228,6 +228,7 @@ vs-chromium-project.txt
/data
/delegate_execute
/device/serial/device_serial_mojo.xml
@@ -18,10 +18,10 @@ index 5eb6e4d1815a7a56c7fff1d6f095e6c7e8127b84..808d897ba80abb9cced32a02cb702630
/google_apis/gcm/gcm.xml
/googleurl
diff --git a/third_party/.gitignore b/third_party/.gitignore
index a750ba32fa50d4367682bf11b88e6a8a4700dc46..c3188f418a6368b35adfdcb2cd96de1614826d39 100644
index 6be9e9e6feeedd0d1f566758e8da75870bc1d9c7..a0bacf9e5c4809d76093c449065d7f4f5bb47b02 100644
--- a/third_party/.gitignore
+++ b/third_party/.gitignore
@@ -46,7 +46,9 @@
@@ -45,7 +45,9 @@
/directxsdk
/dragonbox/src
/edk2

View File

@@ -8,20 +8,21 @@ electron objects that extend gin::Wrappable and gets
allocated on the cpp heap
diff --git a/gin/public/wrappable_pointer_tags.h b/gin/public/wrappable_pointer_tags.h
index 80ec409efe1635390887d1324be661643818abff..2e20b63d1fca56efb43c18d0fa04b1e2b4cf339a 100644
index 82fc9e311ec84b19a15818a501b3a29329eff004..1199be7426139cdc77cee2e620eb8427092c74dd 100644
--- a/gin/public/wrappable_pointer_tags.h
+++ b/gin/public/wrappable_pointer_tags.h
@@ -66,7 +66,12 @@ enum WrappablePointerTag : uint16_t {
kTextInputControllerBindings, // content::TextInputControllerBindings
kWebAXObjectProxy, // content::WebAXObjectProxy
kWrappedExceptionHandler, // extensions::WrappedExceptionHandler
@@ -74,7 +74,13 @@ enum WrappablePointerTag : uint16_t {
kTextInputControllerBindings, // content::TextInputControllerBindings
kWebAXObjectProxy, // content::WebAXObjectProxy
kWrappedExceptionHandler, // extensions::WrappedExceptionHandler
- kLastPointerTag = kWrappedExceptionHandler,
+ kElectronApp, // electron::api::App
+ kElectronDebugger, // electron::api::Debugger
+ kElectronEvent, // gin_helper::internal::Event
+ kElectronMenu, // electron::api::Menu
+ kElectronNetLog, // electron::api::NetLog
+ kElectronSession, // electron::api::Session
+ kLastPointerTag = kElectronEvent,
+ kLastPointerTag = kElectronSession,
};
static_assert(kLastPointerTag <

View File

@@ -0,0 +1,29 @@
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
From: Samuel Maddock <smaddock@slack-corp.com>
Date: Thu, 9 Oct 2025 22:07:38 -0400
Subject: chore: disable protocol handler dcheck
https://chromium-review.googlesource.com/c/chromium/src/+/6727594
The above CL introduces a new extensions API to register custom protocol
handlers. A DCHECK causes Electron to crash until we provide our own
registry. This patch disables the check until we support this.
diff --git a/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc b/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc
index 902cf488c7d84923365c4197a70b06e61e3af038..dce80684853f89a68a2d21997102f48feb3df8f8 100644
--- a/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc
+++ b/extensions/browser/api/protocol_handlers/protocol_handlers_manager.cc
@@ -129,7 +129,12 @@ void ProtocolHandlersManager::ProtocolHandlersSanityCheck() {
auto* ph_registry =
ExtensionsBrowserClient::Get()->GetProtocolHandlerRegistry(
browser_context_);
- DCHECK(ph_registry);
+
+ // TODO(samuelmaddock): Add support for extensions protocol handler. For now,
+ // let's ignore this.
+ if (!ph_registry)
+ return;
+
for (const auto& handler : ph_registry->GetExtensionProtocolHandlers()) {
DCHECK(handler.extension_id());
if (!enabled_ids.contains(*handler.extension_id())) {

View File

@@ -20,10 +20,10 @@ index 79d59c3f4d3d2d5ff39bd65ded489183247656a8..20b49742578ccf363738ee032228f30a
int64_t service_worker_version_id,
const GURL& service_worker_scope,
diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
index 18714ce8fc27c8d56c5deac27ba335078c452d0a..263405c605a0477b7a39bc274d7ee03be0b9cac5 100644
index bbfac47a74f989482343c222b78f187b70297e4e..3677ca3345fbc775d139684a12fe36241827a729 100644
--- a/content/public/renderer/render_frame_observer.h
+++ b/content/public/renderer/render_frame_observer.h
@@ -141,7 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
@@ -143,7 +143,8 @@ class CONTENT_EXPORT RenderFrameObserver {
int32_t world_id) {}
virtual void DidInstallConditionalFeatures(v8::Local<v8::Context> context,
int32_t world_id) {}
@@ -34,10 +34,10 @@ index 18714ce8fc27c8d56c5deac27ba335078c452d0a..263405c605a0477b7a39bc274d7ee03b
virtual void DidClearWindowObject() {}
virtual void DidChangeScrollOffset() {}
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
index addef4de8a95f47964a895e1d1cc4763f565a028..8bef2220b9a416011cebf4da672c15d117a34efa 100644
index 99d368046177dd92c8b36743f461d348bbf19a2e..b0a1859d22063cf6d5a73b5ccd5ea6fb86f9a6b9 100644
--- a/content/renderer/render_frame_impl.cc
+++ b/content/renderer/render_frame_impl.cc
@@ -4685,10 +4685,11 @@ void RenderFrameImpl::DidInstallConditionalFeatures(
@@ -4729,10 +4729,11 @@ void RenderFrameImpl::DidInstallConditionalFeatures(
observer.DidInstallConditionalFeatures(context, world_id);
}
@@ -52,10 +52,10 @@ index addef4de8a95f47964a895e1d1cc4763f565a028..8bef2220b9a416011cebf4da672c15d1
void RenderFrameImpl::DidChangeScrollOffset() {
diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
index f0f4335aa815ea50dbf9b720b41e4eb31f27fb90..319f222565e4ef25206cc44d33ec5e291b8ea089 100644
index 61d4ef338cc4c0e99c144d6d95bbe0adba9d3556..ce7ba31d2a2ebab213be4b123f6af93c99b74149 100644
--- a/content/renderer/render_frame_impl.h
+++ b/content/renderer/render_frame_impl.h
@@ -604,7 +604,8 @@ class CONTENT_EXPORT RenderFrameImpl
@@ -605,7 +605,8 @@ class CONTENT_EXPORT RenderFrameImpl
int world_id) override;
void DidInstallConditionalFeatures(v8::Local<v8::Context> context,
int world_id) override;
@@ -66,10 +66,10 @@ index f0f4335aa815ea50dbf9b720b41e4eb31f27fb90..319f222565e4ef25206cc44d33ec5e29
void DidChangeScrollOffset() override;
blink::WebMediaStreamDeviceObserver* MediaStreamDeviceObserver() override;
diff --git a/content/renderer/service_worker/service_worker_context_client.cc b/content/renderer/service_worker/service_worker_context_client.cc
index 37691ecee7a72b2ec47ff575239f628116cf136b..c67e3faf7440514e203e5b15a68fc34525a045a2 100644
index bf221ce102ea9ca25655f14a7cd90c625799d4b0..c4d81b211016616f6cbbdfcfae6620d4931ce775 100644
--- a/content/renderer/service_worker/service_worker_context_client.cc
+++ b/content/renderer/service_worker/service_worker_context_client.cc
@@ -318,6 +318,7 @@ void ServiceWorkerContextClient::WorkerContextStarted(
@@ -322,6 +322,7 @@ void ServiceWorkerContextClient::WorkerContextStarted(
}
void ServiceWorkerContextClient::WillEvaluateScript(
@@ -77,7 +77,7 @@ index 37691ecee7a72b2ec47ff575239f628116cf136b..c67e3faf7440514e203e5b15a68fc345
v8::Local<v8::Context> v8_context) {
DCHECK(worker_task_runner_->RunsTasksInCurrentSequence());
start_timing_->script_evaluation_start_time = base::TimeTicks::Now();
@@ -336,8 +337,8 @@ void ServiceWorkerContextClient::WillEvaluateScript(
@@ -340,8 +341,8 @@ void ServiceWorkerContextClient::WillEvaluateScript(
DCHECK(proxy_);
GetContentClient()->renderer()->WillEvaluateServiceWorkerOnWorkerThread(
@@ -89,10 +89,10 @@ index 37691ecee7a72b2ec47ff575239f628116cf136b..c67e3faf7440514e203e5b15a68fc345
void ServiceWorkerContextClient::DidEvaluateScript(bool success) {
diff --git a/content/renderer/service_worker/service_worker_context_client.h b/content/renderer/service_worker/service_worker_context_client.h
index 1f5e24bc38d6ced52e4773236522e9520efc6f6d..a22ca5968fce5e6a0c436ec9b40f0e2f7c1482cf 100644
index 2f3ba35491d17aa76f9baf8ba1cd53680a923654..477c6ac5a77c69cc4f062366c52adff3a36bdc76 100644
--- a/content/renderer/service_worker/service_worker_context_client.h
+++ b/content/renderer/service_worker/service_worker_context_client.h
@@ -165,7 +165,8 @@ class ServiceWorkerContextClient
@@ -168,7 +168,8 @@ class ServiceWorkerContextClient
void WorkerContextStarted(
blink::WebServiceWorkerContextProxy* proxy,
scoped_refptr<base::SequencedTaskRunner> worker_task_runner) override;
@@ -103,10 +103,10 @@ index 1f5e24bc38d6ced52e4773236522e9520efc6f6d..a22ca5968fce5e6a0c436ec9b40f0e2f
void WillInitializeWorkerContext() override;
void WillDestroyWorkerContext(v8::Local<v8::Context> context) override;
diff --git a/extensions/renderer/dispatcher.cc b/extensions/renderer/dispatcher.cc
index 37fc43bfc6804c2abb0cf107e2575c72cfca9023..9f3c88be38b9c8960a38649c7f3bf71dff182383 100644
index 7b5398b4199ce6df9e1c9624771a5444d7f07eb3..77f896aa6a53bf7d277b963fba54d623eed8068b 100644
--- a/extensions/renderer/dispatcher.cc
+++ b/extensions/renderer/dispatcher.cc
@@ -612,6 +612,7 @@ void Dispatcher::DidInitializeServiceWorkerContextOnWorkerThread(
@@ -615,6 +615,7 @@ void Dispatcher::DidInitializeServiceWorkerContextOnWorkerThread(
void Dispatcher::WillEvaluateServiceWorkerOnWorkerThread(
blink::WebServiceWorkerContextProxy* context_proxy,
@@ -167,10 +167,10 @@ index f96781a047056876b030581b539be0507acc3a1c..cd9be80be2500a001b1895c81ee597dd
// Called when initial script evaluation finished for the main script.
// |success| is true if the evaluation completed with no uncaught exception.
diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
index 52e8828d8fffaba8ab05436cb4d727595f18238a..6743653f5018c06d3e173aaacdca7275c6ec703f 100644
index 4520c9edccf63bdb9e35bf3a99a8ddb39170da24..dd2c5bd50075c345262b05952ecf3f2aa300b6ff 100644
--- a/third_party/blink/public/web/web_local_frame_client.h
+++ b/third_party/blink/public/web/web_local_frame_client.h
@@ -665,7 +665,8 @@ class BLINK_EXPORT WebLocalFrameClient {
@@ -671,7 +671,8 @@ class BLINK_EXPORT WebLocalFrameClient {
int32_t world_id) {}
// WebKit is about to release its reference to a v8 context for a frame.
@@ -245,10 +245,10 @@ index 16066fe34ee0335a0dabe00b6890e5844349c0b5..cc84479f65bdbe56cb4b38bfcef0d752
// Returns true if we should allow register V8 extensions to be added.
diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
index d8f3b11c98fd58baa9995762a29847b9fd760c84..5a9c9356a2098dfa9d28a5d30b19b492463216c8 100644
index d46f3b764f653c990e57fb2c67121c8fd6b1b115..fe30a119d9befbde7c461637cf670a4b861efe05 100644
--- a/third_party/blink/renderer/core/loader/empty_clients.h
+++ b/third_party/blink/renderer/core/loader/empty_clients.h
@@ -422,7 +422,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
@@ -426,7 +426,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
int32_t world_id) override {}
void DidInstallConditionalFeatures(v8::Local<v8::Context>,
int32_t world_id) override {}
@@ -259,10 +259,10 @@ index d8f3b11c98fd58baa9995762a29847b9fd760c84..5a9c9356a2098dfa9d28a5d30b19b492
bool AllowScriptExtensions() override { return false; }
diff --git a/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc b/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc
index eff817cda59a7b6e746813d5c42911d80547b5bd..217c4f76d62dd4910e89d4cb4cff4206fc84cfb1 100644
index 17860c80651c526e03fd06e4b644c3332b241be7..741a8587e95789038168eb500d3995724e11b47d 100644
--- a/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc
+++ b/third_party/blink/renderer/modules/service_worker/service_worker_global_scope_proxy.cc
@@ -180,6 +180,7 @@ void ServiceWorkerGlobalScopeProxy::WillEvaluateScript() {
@@ -181,6 +181,7 @@ void ServiceWorkerGlobalScopeProxy::WillEvaluateScript() {
ScriptState::Scope scope(
WorkerGlobalScope()->ScriptController()->GetScriptState());
Client().WillEvaluateScript(

View File

@@ -10,10 +10,10 @@ Subject: chore: "grandfather in" Electron Views and Delegates
6448510: Lock further access to View::set_owned_by_client(). | https://chromium-review.googlesource.com/c/chromium/src/+/6448510
diff --git a/ui/views/view.h b/ui/views/view.h
index ee028fccef7dcc9c3522d09e503d2ac49ffd329a..a56c2f87ee21a2bba2cb65acd426cb192124fa85 100644
index 4fada89e37b9c63f7690fbbdd2ef4ecf86b5d756..73dd5aa59d8d1bb05aaed080e27426cc58da2d61 100644
--- a/ui/views/view.h
+++ b/ui/views/view.h
@@ -80,6 +80,19 @@ class ArcNotificationContentView;
@@ -81,6 +81,19 @@ class ArcNotificationContentView;
class WideFrameView;
} // namespace ash
@@ -33,7 +33,7 @@ index ee028fccef7dcc9c3522d09e503d2ac49ffd329a..a56c2f87ee21a2bba2cb65acd426cb19
namespace exo {
class ShellSurfaceBase;
}
@@ -324,6 +337,14 @@ class VIEWS_EXPORT View : public ui::LayerDelegate,
@@ -325,6 +338,14 @@ class VIEWS_EXPORT View : public ui::LayerDelegate,
public:
class OwnedByClientPassKey {
private:
@@ -49,7 +49,7 @@ index ee028fccef7dcc9c3522d09e503d2ac49ffd329a..a56c2f87ee21a2bba2cb65acd426cb19
// These existing cases are "grandfathered in", but there shouldn't be more.
// See comments atop class.
diff --git a/ui/views/widget/widget_delegate.h b/ui/views/widget/widget_delegate.h
index ff9c5abfdb02d9798b1491e2bbc296f2c7c74398..47d8a897d58b0d3829734105e81b887684dd009b 100644
index 1f9c24adbdbe5d2bbd72099d234569c9fdbf863d..b437dd07f15f99cfaa35874f69fd4f19a1b343ba 100644
--- a/ui/views/widget/widget_delegate.h
+++ b/ui/views/widget/widget_delegate.h
@@ -168,6 +168,12 @@ namespace crostini {
@@ -81,7 +81,7 @@ index ff9c5abfdb02d9798b1491e2bbc296f2c7c74398..47d8a897d58b0d3829734105e81b8876
// DO NOT ADD TO THIS LIST!
// These existing cases are "grandfathered in", but there shouldn't be more.
// See comments atop `RegisterDeleteDelegateCallback()`.
@@ -921,6 +929,7 @@ class VIEWS_EXPORT WidgetDelegateView : public WidgetDelegate, public View {
@@ -920,6 +928,7 @@ class VIEWS_EXPORT WidgetDelegateView : public WidgetDelegate, public View {
View* GetContentsView() override;
private:

View File

@@ -7,7 +7,7 @@ This patch comes after Chromium removed the ScopedAllowIO API in favor
of explicitly adding ScopedAllowBlocking calls as friends.
diff --git a/base/threading/thread_restrictions.h b/base/threading/thread_restrictions.h
index 5625973d8cb18de3c77fbf001e02fdf2827f60fb..5d50a77051a9d2d906ec547796469d980eb42a35 100644
index f10a4040b9460baf1b962f53b3dd54d01f49cdc7..ab2858e7a0fd7fcbc0c03b1a8c086ec4ce90c515 100644
--- a/base/threading/thread_restrictions.h
+++ b/base/threading/thread_restrictions.h
@@ -133,6 +133,7 @@ class KeyStorageLinux;
@@ -36,7 +36,7 @@ index 5625973d8cb18de3c77fbf001e02fdf2827f60fb..5d50a77051a9d2d906ec547796469d98
friend class ::ProfileImpl;
friend class ::ScopedAllowBlockingForProfile;
friend class ::StartupTabProviderImpl;
@@ -615,6 +620,7 @@ class BASE_EXPORT ScopedAllowBlocking {
@@ -616,6 +621,7 @@ class BASE_EXPORT ScopedAllowBlocking {
friend class cronet::CronetPrefsManager;
friend class crypto::ScopedAllowBlockingForNSS; // http://crbug.com/59847
friend class drive::FakeDriveService;

View File

@@ -34,10 +34,10 @@ index 2dc44d4787d5198cff7be2cf98ad5acf2d3a9a0b..27a0335aac2bd4239616cf71f5d015c9
class ScrollEvent;
diff --git a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc
index 7dd0e38866576389d59aecdd5a9ecc712996a597..4c626e026e5b19db737533607957d0ff2fbeae28 100644
index 5dd2b9b0897131897596e88e74701293c69e012d..89287b68398e9121959e7750644d37072e8e489b 100644
--- a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc
+++ b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.cc
@@ -1367,6 +1367,10 @@ HBRUSH DesktopWindowTreeHostWin::GetBackgroundPaintBrush() {
@@ -1382,6 +1382,10 @@ HBRUSH DesktopWindowTreeHostWin::GetBackgroundPaintBrush() {
return background_paint_brush_;
}
@@ -49,10 +49,10 @@ index 7dd0e38866576389d59aecdd5a9ecc712996a597..4c626e026e5b19db737533607957d0ff
DesktopWindowTreeHostWin::GetSingletonDesktopNativeCursorManager() {
return new DesktopNativeCursorManagerWin();
diff --git a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h
index dcda976f4c3cc0ba6bcf015d5bf7435df009ae30..13cfa18bf406f244ec361a1230ccce440ad9785a 100644
index 8b34b44095ba7884947d5e83da847783126b3e62..1e30bce5ca5bf47726fd846f2f26705d52a8ce57 100644
--- a/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h
+++ b/ui/views/widget/desktop_aura/desktop_window_tree_host_win.h
@@ -273,6 +273,7 @@ class VIEWS_EXPORT DesktopWindowTreeHostWin
@@ -274,6 +274,7 @@ class VIEWS_EXPORT DesktopWindowTreeHostWin
void HandleWindowScaleFactorChanged(float window_scale_factor) override;
void HandleHeadlessWindowBoundsChanged(const gfx::Rect& bounds) override;
HBRUSH GetBackgroundPaintBrush() override;
@@ -61,10 +61,10 @@ index dcda976f4c3cc0ba6bcf015d5bf7435df009ae30..13cfa18bf406f244ec361a1230ccce44
Widget* GetWidget();
const Widget* GetWidget() const;
diff --git a/ui/views/win/hwnd_message_handler.cc b/ui/views/win/hwnd_message_handler.cc
index 76893d462786eaff21838614a8251b97bec92a79..72474adfb09f85118b4f752a22d121ab2b4c588a 100644
index 10480326f56bcfebd6f9851d5cef401ee56f010c..0265177961817083e32e8357117e7ae158ba6ef3 100644
--- a/ui/views/win/hwnd_message_handler.cc
+++ b/ui/views/win/hwnd_message_handler.cc
@@ -3239,15 +3239,19 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
@@ -3240,15 +3240,19 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
}
// We must let Windows handle the caption buttons if it's drawing them, or
// they won't work.
@@ -86,7 +86,7 @@ index 76893d462786eaff21838614a8251b97bec92a79..72474adfb09f85118b4f752a22d121ab
return 0;
}
}
@@ -3270,6 +3274,7 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
@@ -3271,6 +3275,7 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
// handle alt-space, or in the frame itself.
is_right_mouse_pressed_on_caption_ = false;
ReleaseCapture();
@@ -94,7 +94,7 @@ index 76893d462786eaff21838614a8251b97bec92a79..72474adfb09f85118b4f752a22d121ab
// |point| is in window coordinates, but WM_NCHITTEST and TrackPopupMenu()
// expect screen coordinates.
POINT screen_point = CR_POINT_INITIALIZER_FROM_LPARAM(l_param);
@@ -3277,7 +3282,17 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
@@ -3278,7 +3283,17 @@ LRESULT HWNDMessageHandler::HandleMouseEventInternal(UINT message,
w_param = static_cast<WPARAM>(SendMessage(
hwnd(), WM_NCHITTEST, 0, MAKELPARAM(screen_point.x, screen_point.y)));
if (w_param == HTCAPTION || w_param == HTSYSMENU) {
@@ -114,10 +114,10 @@ index 76893d462786eaff21838614a8251b97bec92a79..72474adfb09f85118b4f752a22d121ab
}
} else if (message == WM_NCLBUTTONDOWN &&
diff --git a/ui/views/win/hwnd_message_handler_delegate.h b/ui/views/win/hwnd_message_handler_delegate.h
index 15e8cde9508170addec55290c859c91224bb2c33..a34948b9a42f030c71e453f1c534215fc2e671fa 100644
index 20cfb50af8d5131ca87d1fafce6f2ab43771f67b..eee40a56bebe52187a35daacfc788bf2f1f27e29 100644
--- a/ui/views/win/hwnd_message_handler_delegate.h
+++ b/ui/views/win/hwnd_message_handler_delegate.h
@@ -256,6 +256,10 @@ class VIEWS_EXPORT HWNDMessageHandlerDelegate {
@@ -260,6 +260,10 @@ class VIEWS_EXPORT HWNDMessageHandlerDelegate {
// if the default should be used.
virtual HBRUSH GetBackgroundPaintBrush() = 0;

View File

@@ -14,10 +14,10 @@ track down the source of this problem & figure out if we can fix it
by changing something in Electron.
diff --git a/content/browser/web_contents/web_contents_impl.cc b/content/browser/web_contents/web_contents_impl.cc
index 2fd9e3ce15869b284ff8716c02ce8dc6392b2a7b..7bda1bd1d7c34e369c27e4ec283888fe4d50458d 100644
index 2636b49a902570bf3b92675db7792893fcc949f9..b489867c2567739ac200cd1e4c4863b3a0aa8235 100644
--- a/content/browser/web_contents/web_contents_impl.cc
+++ b/content/browser/web_contents/web_contents_impl.cc
@@ -5269,7 +5269,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
@@ -5321,7 +5321,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
: IsGuest();
// While some guest types do not have a guest SiteInstance, the ones that
// don't all override WebContents creation above.

View File

@@ -14,10 +14,10 @@ This change patches it out to prevent the DCHECK.
It can be removed once/if we see a better solution to the problem.
diff --git a/content/browser/site_instance_impl.cc b/content/browser/site_instance_impl.cc
index 354a5870ef5b07a5903a1b40fcbb00462bf4a64b..bf3af2152ff7ca54412442b275ec7eedd60110ba 100644
index ff8cd27f46f49ff3b445becf7cb0c628af147899..8702ca4da61aa296c957a9c50b26e921c5e5b19f 100644
--- a/content/browser/site_instance_impl.cc
+++ b/content/browser/site_instance_impl.cc
@@ -225,7 +225,7 @@ scoped_refptr<SiteInstanceImpl> SiteInstanceImpl::CreateForGuest(
@@ -227,7 +227,7 @@ scoped_refptr<SiteInstanceImpl> SiteInstanceImpl::CreateForGuest(
BrowserContext* browser_context,
const StoragePartitionConfig& partition_config) {
DCHECK(browser_context);

View File

@@ -7,7 +7,7 @@ Electron does not support Profiles, so we need to patch it out of any
code that we use.
diff --git a/chrome/browser/pdf/chrome_pdf_stream_delegate.cc b/chrome/browser/pdf/chrome_pdf_stream_delegate.cc
index c390a83277f564f1a67a7dcffa36b9d77a35bc0b..b13273a4b194ad5e8ca2d1639ebca831f9607b1e 100644
index bd19708922b3d9224cc3a05f515c455ce4fb1e69..7198d9f9b22c8725c7ecdf6931ff36859ffaf506 100644
--- a/chrome/browser/pdf/chrome_pdf_stream_delegate.cc
+++ b/chrome/browser/pdf/chrome_pdf_stream_delegate.cc
@@ -45,6 +45,7 @@ namespace {
@@ -27,10 +27,10 @@ index c390a83277f564f1a67a7dcffa36b9d77a35bc0b..b13273a4b194ad5e8ca2d1639ebca831
// When the enterprise policy is not set, use finch/feature flag choice.
return base::FeatureList::IsEnabled(
diff --git a/chrome/browser/pdf/pdf_extension_util.cc b/chrome/browser/pdf/pdf_extension_util.cc
index 32e9d7e81ee8008b7e8fd491ec16afc01b5ff35e..51213f193cc5977f9f30dd39548eaf012a4857fa 100644
index 328abdd79d287225d0e6ec6becc455e169d6e5d0..10e5e702a43dbb70e13d00b48000e0b4cc974e7a 100644
--- a/chrome/browser/pdf/pdf_extension_util.cc
+++ b/chrome/browser/pdf/pdf_extension_util.cc
@@ -234,10 +234,13 @@ bool IsPrintingEnabled(content::BrowserContext* context) {
@@ -248,10 +248,13 @@ bool IsPrintingEnabled(content::BrowserContext* context) {
#if BUILDFLAG(ENABLE_PDF_INK2)
bool IsPdfAnnotationsEnabledByPolicy(content::BrowserContext* context) {
@@ -84,7 +84,7 @@ index bc0bad82ebcdceadc505e912ff27202b452fefab..6b77c57fccc4619a1df3b4ed661d2bdd
ProfileSelection ProfileSelections::GetProfileSelection(
diff --git a/chrome/browser/spellchecker/spellcheck_service.cc b/chrome/browser/spellchecker/spellcheck_service.cc
index 4c52386f9ddf13f1453903cda3954b6c596028f2..8fbb2025d157e58c90c701f9e3478f6c99b88aa1 100644
index eba2400655be58628ad1dbf37692a963cc031bf8..02da80b42f936f347c9043f4499d9a324bdf43d2 100644
--- a/chrome/browser/spellchecker/spellcheck_service.cc
+++ b/chrome/browser/spellchecker/spellcheck_service.cc
@@ -21,8 +21,10 @@

View File

@@ -7,10 +7,10 @@ Pending upstream patch, this gives us fuller access to the window.open params
so that we will be able to decide whether to cancel it or not.
diff --git a/chrome/browser/media/offscreen_tab.cc b/chrome/browser/media/offscreen_tab.cc
index 7a9effeec99682ef063ebe71f209e6ed9fc4cad4..71ef44be47a8665ee36449a38333ddf9cff33ad4 100644
index 047f1258f951f763df2ca0ba355b19d19337826b..9fc7114312212fbe38ddec740b4aebbcd72cb0f8 100644
--- a/chrome/browser/media/offscreen_tab.cc
+++ b/chrome/browser/media/offscreen_tab.cc
@@ -287,8 +287,7 @@ bool OffscreenTab::IsWebContentsCreationOverridden(
@@ -285,8 +285,7 @@ bool OffscreenTab::IsWebContentsCreationOverridden(
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -35,7 +35,7 @@ index 231e3595f218aeebe28d0b13ce6182e7a4d6f4e1..609bd205d1cd0404cab3471765bef8b0
content::RenderFrameHost* requesting_frame,
const blink::mojom::FullscreenOptions& options) final;
diff --git a/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc b/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc
index a17c406b59530a8f57f6cb48905a697dd208a41f..0e22e90c1d570eb4c86ac1f24c5a6e9159be8ea1 100644
index 7f99bf8c0c79de2cb8a812a7bfe8b4255697444a..d39aee929900cca756a6293b782a44228725f6fc 100644
--- a/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc
+++ b/chrome/browser/ui/ash/keyboard/chrome_keyboard_web_contents.cc
@@ -80,8 +80,7 @@ class ChromeKeyboardContentsDelegate : public content::WebContentsDelegate,
@@ -49,7 +49,7 @@ index a17c406b59530a8f57f6cb48905a697dd208a41f..0e22e90c1d570eb4c86ac1f24c5a6e91
}
diff --git a/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc b/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc
index 08c84ca91f7e477e4e8d6370513d90d2fb9801f1..41e04444274f40fdedbf8d97bfd149f2ac682e53 100644
index e4e42249c476ccae58f0ba42e7dbae299f1e36bd..670c30ed4b7f1a07eb4b8abaa95e5a8a9d94bd8d 100644
--- a/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc
+++ b/chrome/browser/ui/ash/web_view/ash_web_view_impl.cc
@@ -121,10 +121,9 @@ bool AshWebViewImpl::IsWebContentsCreationOverridden(
@@ -66,7 +66,7 @@ index 08c84ca91f7e477e4e8d6370513d90d2fb9801f1..41e04444274f40fdedbf8d97bfd149f2
/*from_user_gesture=*/true);
return true;
diff --git a/chrome/browser/ui/ash/web_view/ash_web_view_impl.h b/chrome/browser/ui/ash/web_view/ash_web_view_impl.h
index b6582b4013d9682d32bd524b4053b443a4df00f8..afcbce72e0f247b4d5a637b27c9f25d913cfa14b 100644
index 39fa45f0a0f9076bd7ac0be6f455dd540a276512..3d0381d463eed73470b28085830f2a23751659a7 100644
--- a/chrome/browser/ui/ash/web_view/ash_web_view_impl.h
+++ b/chrome/browser/ui/ash/web_view/ash_web_view_impl.h
@@ -60,8 +60,7 @@ class AshWebViewImpl : public ash::AshWebView,
@@ -80,20 +80,20 @@ index b6582b4013d9682d32bd524b4053b443a4df00f8..afcbce72e0f247b4d5a637b27c9f25d9
content::WebContents* source,
const content::OpenURLParams& params,
diff --git a/chrome/browser/ui/browser.cc b/chrome/browser/ui/browser.cc
index 00cea7307c68c3d8ae93f5ed6df33cef9065fe7b..c2a3892b0ade29d59b06753fdc84f44dc0890f39 100644
index 78a55026a56c5c2846c7cf13a6080456f8022ddc..f507a45212491b46954e1e30f8fc8c525aff0b25 100644
--- a/chrome/browser/ui/browser.cc
+++ b/chrome/browser/ui/browser.cc
@@ -2359,7 +2359,8 @@ bool Browser::IsWebContentsCreationOverridden(
@@ -2378,7 +2378,8 @@ bool Browser::IsWebContentsCreationOverridden(
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
const std::string& frame_name,
- const GURL& target_url) {
+ const GURL& target_url,
+ const content::mojom::CreateNewWindowParams& params) {
if (actor::IsActorOperatingOnWebContents(
profile(), content::WebContents::FromRenderFrameHost(opener))) {
// If an ExecutionEngine is acting on the opener, prevent it from creating
@@ -2371,7 +2372,7 @@ bool Browser::IsWebContentsCreationOverridden(
if (HasActorTask(profile(), opener)) {
// If an ExecutionEngine is acting on the opener, prevent it from creating a
// new WebContents. We'll instead force the navigation to happen in the same
@@ -2391,7 +2392,7 @@ bool Browser::IsWebContentsCreationOverridden(
return (window_container_type ==
content::mojom::WindowContainerType::BACKGROUND &&
ShouldCreateBackgroundContents(source_site_instance, opener_url,
@@ -103,10 +103,10 @@ index 00cea7307c68c3d8ae93f5ed6df33cef9065fe7b..c2a3892b0ade29d59b06753fdc84f44d
WebContents* Browser::CreateCustomWebContents(
diff --git a/chrome/browser/ui/browser.h b/chrome/browser/ui/browser.h
index 636b265a6813b01a44930ae73655523b739cafd2..23dad43a14673966af3002263b03bb0cfb91e8f6 100644
index 12b5a5ca3603b815182621f81827635667528ca0..0bfd322dd59de0247a7e8bd09b462b943e206f3c 100644
--- a/chrome/browser/ui/browser.h
+++ b/chrome/browser/ui/browser.h
@@ -946,8 +946,7 @@ class Browser : public TabStripModelObserver,
@@ -943,8 +943,7 @@ class Browser : public TabStripModelObserver,
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -145,10 +145,10 @@ index 3fc06be01f20e8cd314d95d73a3f58c2f0742fe9..c07910ae59a185442f37ea6e7b96fdf3
// The profile used for the presentation.
raw_ptr<Profile, DanglingUntriaged> otr_profile_;
diff --git a/chrome/browser/ui/views/hats/hats_next_web_dialog.cc b/chrome/browser/ui/views/hats/hats_next_web_dialog.cc
index 08b9f7ad8544011ee1cbb9bc9857ea06e2fa2c0b..69f666bdc05662bc40e133022b5364cbbbbbdb39 100644
index 3bbd4e568ba99245622a96f0801d2b6cd203025f..1e0b7d16b33daed980961dd49c667a3b254c186f 100644
--- a/chrome/browser/ui/views/hats/hats_next_web_dialog.cc
+++ b/chrome/browser/ui/views/hats/hats_next_web_dialog.cc
@@ -103,8 +103,7 @@ class HatsNextWebDialog::HatsWebView : public views::WebView {
@@ -104,8 +104,7 @@ class HatsNextWebDialog::HatsWebView : public views::WebView {
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -159,10 +159,10 @@ index 08b9f7ad8544011ee1cbb9bc9857ea06e2fa2c0b..69f666bdc05662bc40e133022b5364cb
}
content::WebContents* CreateCustomWebContents(
diff --git a/components/embedder_support/android/delegate/web_contents_delegate_android.cc b/components/embedder_support/android/delegate/web_contents_delegate_android.cc
index a560d65e113ba4fad4c56d9a2a19df1772079d07..4f621733276141248169b7f5ecc5b6f09140f774 100644
index 279f7501a197380dd63c8fe7827854b16d46e5f7..2b80f1970a067e91794a81fcc19e5be64b6b2944 100644
--- a/components/embedder_support/android/delegate/web_contents_delegate_android.cc
+++ b/components/embedder_support/android/delegate/web_contents_delegate_android.cc
@@ -204,14 +204,13 @@ bool WebContentsDelegateAndroid::IsWebContentsCreationOverridden(
@@ -205,14 +205,13 @@ bool WebContentsDelegateAndroid::IsWebContentsCreationOverridden(
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -180,10 +180,10 @@ index a560d65e113ba4fad4c56d9a2a19df1772079d07..4f621733276141248169b7f5ecc5b6f0
java_gurl);
}
diff --git a/components/embedder_support/android/delegate/web_contents_delegate_android.h b/components/embedder_support/android/delegate/web_contents_delegate_android.h
index a13f342976cb57b091ebfc95538f9ef91bb9e6fa..40506e913c0506e38cd141a46468a7669d6c2093 100644
index 261d38394a9ff6f81848b94d6b183b2062c37ba9..0c6a26599bb8fef6f9ee6180fc0a98760d857b19 100644
--- a/components/embedder_support/android/delegate/web_contents_delegate_android.h
+++ b/components/embedder_support/android/delegate/web_contents_delegate_android.h
@@ -84,8 +84,7 @@ class WebContentsDelegateAndroid : public content::WebContentsDelegate {
@@ -78,8 +78,7 @@ class WebContentsDelegateAndroid : public content::WebContentsDelegate {
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -222,10 +222,10 @@ index b969f1d97b7e3396119b579cfbe61e19ff7d2dd4..b8d6169652da28266a514938b45b39c5
content::WebContents* AddNewContents(
content::WebContents* source,
diff --git a/content/browser/web_contents/web_contents_impl.cc b/content/browser/web_contents/web_contents_impl.cc
index 4e2e910c62534106209758a0e5aeb329cfbaa529..b7967a4ab1c9d2c7b2a49a610af10190bcd6e0f0 100644
index 6efc40408fb64d4e4c4e6671b606912edc013a41..35fe43c6ac99666d070036f7d862529ad364a359 100644
--- a/content/browser/web_contents/web_contents_impl.cc
+++ b/content/browser/web_contents/web_contents_impl.cc
@@ -5232,8 +5232,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
@@ -5284,8 +5284,7 @@ FrameTree* WebContentsImpl::CreateNewWindow(
if (delegate_ &&
delegate_->IsWebContentsCreationOverridden(
opener, source_site_instance, params.window_container_type,
@@ -236,10 +236,10 @@ index 4e2e910c62534106209758a0e5aeb329cfbaa529..b7967a4ab1c9d2c7b2a49a610af10190
static_cast<WebContentsImpl*>(delegate_->CreateCustomWebContents(
opener, source_site_instance, is_new_browsing_instance,
diff --git a/content/public/browser/web_contents_delegate.cc b/content/public/browser/web_contents_delegate.cc
index 80d004eb9060e33af9e60b31a862a7dcecb254e8..ea179bdf3e702fb1d5be55affe3958f77901cd08 100644
index df972f1ce594f2d4651202b650ff2d41fe19ecd0..a92305042eef86fbabeae6fe02b48668a349be99 100644
--- a/content/public/browser/web_contents_delegate.cc
+++ b/content/public/browser/web_contents_delegate.cc
@@ -155,8 +155,7 @@ bool WebContentsDelegate::IsWebContentsCreationOverridden(
@@ -160,8 +160,7 @@ bool WebContentsDelegate::IsWebContentsCreationOverridden(
SiteInstance* source_site_instance,
mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -250,10 +250,10 @@ index 80d004eb9060e33af9e60b31a862a7dcecb254e8..ea179bdf3e702fb1d5be55affe3958f7
}
diff --git a/content/public/browser/web_contents_delegate.h b/content/public/browser/web_contents_delegate.h
index 6a43f8c30857bfb32867e63d570ad26459af9ae8..97def739ec2418286b76c0039c61b501293c8f5d 100644
index 38b61d04446736bcc44a412f633c01ed9aca5399..3c982afb1af048618506a36ca3532b15720d8869 100644
--- a/content/public/browser/web_contents_delegate.h
+++ b/content/public/browser/web_contents_delegate.h
@@ -361,8 +361,7 @@ class CONTENT_EXPORT WebContentsDelegate {
@@ -368,8 +368,7 @@ class CONTENT_EXPORT WebContentsDelegate {
SiteInstance* source_site_instance,
mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -264,7 +264,7 @@ index 6a43f8c30857bfb32867e63d570ad26459af9ae8..97def739ec2418286b76c0039c61b501
// Allow delegate to creates a custom WebContents when
// WebContents::CreateNewWindow() is called. This function is only called
diff --git a/extensions/browser/guest_view/app_view/app_view_guest.cc b/extensions/browser/guest_view/app_view/app_view_guest.cc
index 3b1fe9ef59fbcd3684348fb518ce67210a639dc1..dc38462f8e29066bec4970cc820b8d6077106b85 100644
index af80323215e2cb6ff7bdb802f8da4bdbe0067f71..187816751bde435e9c622921c457873d4b3172cd 100644
--- a/extensions/browser/guest_view/app_view/app_view_guest.cc
+++ b/extensions/browser/guest_view/app_view/app_view_guest.cc
@@ -153,8 +153,7 @@ bool AppViewGuest::IsWebContentsCreationOverridden(
@@ -300,7 +300,7 @@ index 7695578f626f2a0c7fefae2bc1d5c35e5ac154f2..78958bff12ce41ae5ad77f43279a4b35
content::RenderFrameHost* opener,
content::SiteInstance* source_site_instance,
diff --git a/extensions/browser/guest_view/extension_options/extension_options_guest.cc b/extensions/browser/guest_view/extension_options/extension_options_guest.cc
index 5bd9d59a961a03f3cd3a806bc1af58c3eaee2b58..40d7ae8d6248163524a8c1350b625e107a8ae64a 100644
index 0ab40dfd23d1071212c4d30d01fa8e7755458d4a..f032127a94c52beb3f509d6ea84c7e55f21084e2 100644
--- a/extensions/browser/guest_view/extension_options/extension_options_guest.cc
+++ b/extensions/browser/guest_view/extension_options/extension_options_guest.cc
@@ -263,8 +263,7 @@ bool ExtensionOptionsGuest::IsWebContentsCreationOverridden(
@@ -328,7 +328,7 @@ index 56d86e3d1179df2d5f34eb6216989aef2687f49f..236f3ccf8354b156737e03929ee538f9
content::RenderFrameHost* opener,
content::SiteInstance* source_site_instance,
diff --git a/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc b/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc
index 3e689ad6bdb51ccd7419eb87e4ba2cdbf2f1a8e9..c219b456721a43d9dfdf69612909a2d4f82cd33d 100644
index 23705fa50cf79865b68d8352f6ec72444ca5233e..efa5e78ed92464a6d47319f7b2087555d683bd8c 100644
--- a/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc
+++ b/extensions/browser/guest_view/mime_handler_view/mime_handler_view_guest.cc
@@ -424,8 +424,7 @@ bool MimeHandlerViewGuest::IsWebContentsCreationOverridden(
@@ -356,10 +356,10 @@ index 7eeffdfbda9611806c6f260f0c68f6d84689cb7e..5d8f6d132068d7fabaa52bc61354c71a
content::RenderFrameHost* opener,
content::SiteInstance* source_site_instance,
diff --git a/fuchsia_web/webengine/browser/frame_impl.cc b/fuchsia_web/webengine/browser/frame_impl.cc
index fdc6afbf9048fa254d6f361b36765cf95d5eb521..16d297a3f6bde6bc4c038b79a057700aec68b689 100644
index 44fdb7377fc4d09137d0718de0f960b0d190c99f..46bde9f83510116f8723d400d5947f9cc6ba3ab5 100644
--- a/fuchsia_web/webengine/browser/frame_impl.cc
+++ b/fuchsia_web/webengine/browser/frame_impl.cc
@@ -584,8 +584,7 @@ bool FrameImpl::IsWebContentsCreationOverridden(
@@ -585,8 +585,7 @@ bool FrameImpl::IsWebContentsCreationOverridden(
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -384,7 +384,7 @@ index 756d4192271d6a65cfe8e1511737c565b543cb1f..5688f6f745056565c3c01947f741c4d1
int opener_render_process_id,
int opener_render_frame_id,
diff --git a/headless/lib/browser/headless_web_contents_impl.cc b/headless/lib/browser/headless_web_contents_impl.cc
index 1d95f5b521d7ab586fcecda6d6f822b432480367..b534327a8bd5b2c31522339b30caf123734c5cc3 100644
index 617d6cbd13ad3ce5eb9626bb54162e4afdfd24bd..85281656a467262076c081eb974e35590c573dab 100644
--- a/headless/lib/browser/headless_web_contents_impl.cc
+++ b/headless/lib/browser/headless_web_contents_impl.cc
@@ -208,8 +208,7 @@ class HeadlessWebContentsImpl::Delegate : public content::WebContentsDelegate {
@@ -398,10 +398,10 @@ index 1d95f5b521d7ab586fcecda6d6f822b432480367..b534327a8bd5b2c31522339b30caf123
->options()
->block_new_web_contents();
diff --git a/ui/views/controls/webview/web_dialog_view.cc b/ui/views/controls/webview/web_dialog_view.cc
index 3a6d0c589ee634b68e929c17ee912a6b1c19b4f6..b13d80623d1fd0d0798cec33cb92f73ed5947ffa 100644
index f56882565de72fa9ab660b4a8d86f08c7392becd..439586a03288822bab8f5f21d0c38b678ed52fb6 100644
--- a/ui/views/controls/webview/web_dialog_view.cc
+++ b/ui/views/controls/webview/web_dialog_view.cc
@@ -490,8 +490,7 @@ bool WebDialogView::IsWebContentsCreationOverridden(
@@ -489,8 +489,7 @@ bool WebDialogView::IsWebContentsCreationOverridden(
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,
@@ -412,10 +412,10 @@ index 3a6d0c589ee634b68e929c17ee912a6b1c19b4f6..b13d80623d1fd0d0798cec33cb92f73e
return delegate_->HandleShouldOverrideWebContentsCreation();
}
diff --git a/ui/views/controls/webview/web_dialog_view.h b/ui/views/controls/webview/web_dialog_view.h
index 0fa7e807d22f6f04b84f2d949fbdf892b94996bf..b0490ae36c9999a766bbf346e35807740f4f9af6 100644
index 720611a58300a0252d5dd66e1e7c98282dc82646..eb0abf978651266fe7e4d6a8e9af30024fceb7d1 100644
--- a/ui/views/controls/webview/web_dialog_view.h
+++ b/ui/views/controls/webview/web_dialog_view.h
@@ -168,8 +168,7 @@ class WEBVIEW_EXPORT WebDialogView : public ClientView,
@@ -167,8 +167,7 @@ class WEBVIEW_EXPORT WebDialogView : public ClientView,
content::SiteInstance* source_site_instance,
content::mojom::WindowContainerType window_container_type,
const GURL& opener_url,

View File

@@ -9,7 +9,7 @@ Electron when a session is non persistent we do not initialize the
ExtensionSystem, so this check is not relevant for Electron.
diff --git a/extensions/browser/script_injection_tracker.cc b/extensions/browser/script_injection_tracker.cc
index 09e5575f67c0a7484663d0ecbee5963be622cb8f..b206eca9426491921e6cacfad3fb764d474e7945 100644
index 8331e06da9055fddd647dbe54051584b101286b0..6a9ddc0060dc272cd4511fc96f358005ad0ee043 100644
--- a/extensions/browser/script_injection_tracker.cc
+++ b/extensions/browser/script_injection_tracker.cc
@@ -177,7 +177,6 @@ std::vector<const UserScript*> GetLoadedDynamicScripts(

View File

@@ -11,10 +11,10 @@ not need this dependency.
refs https://chromium-review.googlesource.com/c/chromium/src/+/5573603
diff --git a/chrome/browser/ui/color/BUILD.gn b/chrome/browser/ui/color/BUILD.gn
index fffee1ca3d0ab493c616e18ecdc0a4fb6525f974..11816e864deb4244c4a2d87ccd89c0a5f632a024 100644
index db1a2f393af2b561cb7d13861bc37f81ab3227c8..d371808e1e59e2dbb2da8790a2212cc001caa772 100644
--- a/chrome/browser/ui/color/BUILD.gn
+++ b/chrome/browser/ui/color/BUILD.gn
@@ -85,9 +85,6 @@ source_set("mixers") {
@@ -87,9 +87,6 @@ source_set("mixers") {
]
}
@@ -23,4 +23,4 @@ index fffee1ca3d0ab493c616e18ecdc0a4fb6525f974..11816e864deb4244c4a2d87ccd89c0a5
- }
}
if (!is_ios && !is_android) {
if (!is_android) {

View File

@@ -9,10 +9,10 @@ Patch can be removed once cppgc migration is complete
https://github.com/electron/electron/issues/47922
diff --git a/gin/function_template.h b/gin/function_template.h
index 84ab9585240a49048774811718f7ebd6f988e485..f062163cdd81def12fae7e507d18a9133dd0804d 100644
index c80020b2bda2af39b38295dad3c6208cb8294b88..873015289db9709c00c32080e5387d9cdfea1f69 100644
--- a/gin/function_template.h
+++ b/gin/function_template.h
@@ -77,6 +77,7 @@ class GIN_EXPORT CallbackHolderBase {
@@ -79,6 +79,7 @@ class GIN_EXPORT CallbackHolderBase {
CallbackHolderBase* holder);
~DisposeObserver() override;
void OnBeforeDispose(v8::Isolate* isolate) override;
@@ -21,7 +21,7 @@ index 84ab9585240a49048774811718f7ebd6f988e485..f062163cdd81def12fae7e507d18a913
private:
diff --git a/gin/isolate_holder.cc b/gin/isolate_holder.cc
index 083d59f78c542f4900e1b210a0935276516b894b..e32658e386853e2142c325a60ec385635256b758 100644
index 1943413560f23c212d98fa1b368204c6e062bab2..bf0053833c782c9bc0187bb093a7ffd81ca9d754 100644
--- a/gin/isolate_holder.cc
+++ b/gin/isolate_holder.cc
@@ -225,6 +225,7 @@ void IsolateHolder::WillCreateMicrotasksRunner() {

View File

@@ -39,10 +39,10 @@ index e87c180342b967756efeb701c73207fcee8754f1..42e37564e585987d367921568f0f1d2b
NOTREACHED();
}
diff --git a/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc b/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc
index b6985bd63a34c55154fcfae601add6ce6c451704..fb44cc65b1a15c8b69410a2a2cb925a0326bb438 100644
index ce768e551dd96678c04035503a481d375f5887bd..0cec5e73e4ae4441262461ba3c8446cdd8dc04a0 100644
--- a/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc
+++ b/ui/base/accelerators/global_accelerator_listener/global_accelerator_listener_ozone.cc
@@ -147,7 +147,8 @@ bool GlobalAcceleratorListenerOzone::StartListeningForAccelerator(
@@ -153,7 +153,8 @@ bool GlobalAcceleratorListenerOzone::StartListeningForAccelerator(
const bool registered =
platform_global_shortcut_listener_->RegisterAccelerator(
accelerator.key_code(), accelerator.IsAltDown(),
@@ -52,7 +52,7 @@ index b6985bd63a34c55154fcfae601add6ce6c451704..fb44cc65b1a15c8b69410a2a2cb925a0
if (registered) {
registered_hot_keys_.insert(accelerator);
}
@@ -162,14 +163,15 @@ void GlobalAcceleratorListenerOzone::StopListeningForAccelerator(
@@ -168,14 +169,15 @@ void GlobalAcceleratorListenerOzone::StopListeningForAccelerator(
platform_global_shortcut_listener_->UnregisterAccelerator(
accelerator.key_code(), accelerator.IsAltDown(), accelerator.IsCtrlDown(),
@@ -70,7 +70,7 @@ index b6985bd63a34c55154fcfae601add6ce6c451704..fb44cc65b1a15c8b69410a2a2cb925a0
int modifiers = 0;
if (is_alt_down) {
modifiers |= ui::EF_ALT_DOWN;
@@ -180,6 +182,9 @@ void GlobalAcceleratorListenerOzone::OnKeyPressed(ui::KeyboardCode key_code,
@@ -186,6 +188,9 @@ void GlobalAcceleratorListenerOzone::OnKeyPressed(ui::KeyboardCode key_code,
if (is_shift_down) {
modifiers |= ui::EF_SHIFT_DOWN;
}

View File

@@ -63,10 +63,10 @@ index 7c890b331be4aaaf20c7efe8a4bcc2f6e9012b7a..c573524d05c07ec67d35046bc8548cc1
// Used by WebView to sample crashes without generating the unwanted dumps. If
// the returned value is less than 100, crash dumping will be sampled to that
diff --git a/components/crash/core/app/crashpad_linux.cc b/components/crash/core/app/crashpad_linux.cc
index 5d9b3bd5386ecbdb74cc470dbe65308c3afa0a61..dc29a4bedc0533e27affb26367cfcc2c3f9544f3 100644
index d4d3555891b19d61676465c856055fb04e0168bc..3228888f5449df723f4385a0f2c9b456caa472f0 100644
--- a/components/crash/core/app/crashpad_linux.cc
+++ b/components/crash/core/app/crashpad_linux.cc
@@ -218,6 +218,7 @@ bool PlatformCrashpadInitialization(
@@ -219,6 +219,7 @@ bool PlatformCrashpadInitialization(
// where crash_reporter provides it's own values for lsb-release.
annotations["lsb-release"] = base::GetLinuxDistro();
#endif
@@ -74,7 +74,7 @@ index 5d9b3bd5386ecbdb74cc470dbe65308c3afa0a61..dc29a4bedc0533e27affb26367cfcc2c
std::vector<std::string> arguments;
if (crash_reporter_client->ShouldMonitorCrashHandlerExpensively()) {
@@ -239,6 +240,13 @@ bool PlatformCrashpadInitialization(
@@ -240,6 +241,13 @@ bool PlatformCrashpadInitialization(
}
#endif
@@ -86,10 +86,10 @@ index 5d9b3bd5386ecbdb74cc470dbe65308c3afa0a61..dc29a4bedc0533e27affb26367cfcc2c
+ }
+
CHECK(client.StartHandler(handler_path, *database_path, metrics_path, url,
annotations, arguments, false, false));
} else {
annotations, arguments, false, false,
attachments));
diff --git a/components/crash/core/app/crashpad_mac.mm b/components/crash/core/app/crashpad_mac.mm
index 42fe73aefe44f218d6a5e8cb1550ff48859c4b70..a1235f0c7ad44ae9c9fdc805af5b9dc5669f5aad 100644
index 3b131e1fc804a55c80b3b2704686270211fcf9fb..f14ab66f240a236bd90ff4240089a0036ce7d460 100644
--- a/components/crash/core/app/crashpad_mac.mm
+++ b/components/crash/core/app/crashpad_mac.mm
@@ -86,6 +86,8 @@
@@ -101,7 +101,7 @@ index 42fe73aefe44f218d6a5e8cb1550ff48859c4b70..a1235f0c7ad44ae9c9fdc805af5b9dc5
return annotations;
}
@@ -156,6 +158,13 @@ bool PlatformCrashpadInitialization(
@@ -159,6 +161,13 @@ bool PlatformCrashpadInitialization(
std::vector<std::string> arguments;
@@ -116,10 +116,10 @@ index 42fe73aefe44f218d6a5e8cb1550ff48859c4b70..a1235f0c7ad44ae9c9fdc805af5b9dc5
arguments.push_back("--monitor-self");
}
diff --git a/components/crash/core/app/crashpad_win.cc b/components/crash/core/app/crashpad_win.cc
index 5b811cbbc51544cbff7c2e99c3a7ced824990002..f2376d74fbd2c8196184035fc0fb24a0a8ebfe0e 100644
index a7af39181e259b4c793fa9a39cb95e4f86ac47d1..6101018813315074a1e06bea318ecf3f91188415 100644
--- a/components/crash/core/app/crashpad_win.cc
+++ b/components/crash/core/app/crashpad_win.cc
@@ -93,6 +93,7 @@ bool PlatformCrashpadInitialization(
@@ -94,6 +94,7 @@ bool PlatformCrashpadInitialization(
std::map<std::string, std::string> process_annotations;
GetPlatformCrashpadAnnotations(&process_annotations);
@@ -127,7 +127,7 @@ index 5b811cbbc51544cbff7c2e99c3a7ced824990002..f2376d74fbd2c8196184035fc0fb24a0
std::string url = crash_reporter_client->GetUploadUrl();
@@ -133,6 +134,13 @@ bool PlatformCrashpadInitialization(
@@ -134,6 +135,13 @@ bool PlatformCrashpadInitialization(
std::vector<std::string> arguments(start_arguments);

View File

@@ -7,10 +7,10 @@ By default, chromium sets up one v8 snapshot to be used in all v8 contexts. This
to have a dedicated browser process v8 snapshot defined by the file `browser_v8_context_snapshot.bin`.
diff --git a/content/app/content_main_runner_impl.cc b/content/app/content_main_runner_impl.cc
index 46c7c57b5ff40b0e40d66bbeb8ec3f2b7f86cea0..46d144563983dee5a793948d9fd11852fb311088 100644
index 9240e8485a8dc895eb455b1418fc7559e52a5dd5..e9444e765ac8ac595b799be7feeb6a483c6acf9f 100644
--- a/content/app/content_main_runner_impl.cc
+++ b/content/app/content_main_runner_impl.cc
@@ -272,8 +272,13 @@ void AsanProcessInfoCB(const char*, bool*) {
@@ -273,8 +273,13 @@ void AsanProcessInfoCB(const char*, bool*) {
}
#endif // defined(ADDRESS_SANITIZER)
@@ -25,7 +25,7 @@ index 46c7c57b5ff40b0e40d66bbeb8ec3f2b7f86cea0..46d144563983dee5a793948d9fd11852
#if BUILDFLAG(IS_POSIX) && !BUILDFLAG(IS_MAC)
base::FileDescriptorStore& file_descriptor_store =
base::FileDescriptorStore::GetInstance();
@@ -302,11 +307,12 @@ bool ShouldLoadV8Snapshot(const base::CommandLine& command_line,
@@ -303,11 +308,12 @@ bool ShouldLoadV8Snapshot(const base::CommandLine& command_line,
#endif // V8_USE_EXTERNAL_STARTUP_DATA
@@ -40,7 +40,7 @@ index 46c7c57b5ff40b0e40d66bbeb8ec3f2b7f86cea0..46d144563983dee5a793948d9fd11852
#endif // V8_USE_EXTERNAL_STARTUP_DATA
}
@@ -950,7 +956,7 @@ int ContentMainRunnerImpl::Initialize(ContentMainParams params) {
@@ -951,7 +957,7 @@ int ContentMainRunnerImpl::Initialize(ContentMainParams params) {
return TerminateForFatalInitializationError();
#endif // BUILDFLAG(IS_ANDROID) && (ICU_UTIL_DATA_IMPL == ICU_UTIL_DATA_FILE)
@@ -50,7 +50,7 @@ index 46c7c57b5ff40b0e40d66bbeb8ec3f2b7f86cea0..46d144563983dee5a793948d9fd11852
blink::TrialTokenValidator::SetOriginTrialPolicyGetter(
base::BindRepeating([]() -> blink::OriginTrialPolicy* {
diff --git a/content/public/app/content_main_delegate.cc b/content/public/app/content_main_delegate.cc
index 8b02f553e2fc29da88c3e14c05a7ee82210eab51..14f2e66d5ecda6e860724a3ab946eaaffba33d6d 100644
index fee2fab8ab33a3829f055b0408e9e763443016cc..678c636c9ca08f8113dc67aafaf9761f33a7f0e5 100644
--- a/content/public/app/content_main_delegate.cc
+++ b/content/public/app/content_main_delegate.cc
@@ -5,6 +5,7 @@
@@ -73,7 +73,7 @@ index 8b02f553e2fc29da88c3e14c05a7ee82210eab51..14f2e66d5ecda6e860724a3ab946eaaf
return new ContentClient();
}
diff --git a/content/public/app/content_main_delegate.h b/content/public/app/content_main_delegate.h
index db611d99a6c0f18f39967b38791822fda7d175b5..cc150475de655d5ef20a107ae3ef80c08af8c7fb 100644
index 8151396412bf6981f3424526386ad6257b8c895d..ac5041c1666ac968251768f604f92434d92e374d 100644
--- a/content/public/app/content_main_delegate.h
+++ b/content/public/app/content_main_delegate.h
@@ -9,6 +9,7 @@
@@ -84,8 +84,8 @@ index db611d99a6c0f18f39967b38791822fda7d175b5..cc150475de655d5ef20a107ae3ef80c0
#include <vector>
#include "base/notreached.h"
@@ -174,6 +175,8 @@ class CONTENT_EXPORT ContentMainDelegate {
virtual bool ShouldHandleConsoleControlEvents();
@@ -181,6 +182,8 @@ class CONTENT_EXPORT ContentMainDelegate {
virtual bool ShouldInitializePerfetto(InvokedIn invoked_in);
#endif
+ virtual std::string_view GetBrowserV8SnapshotFilename();

View File

@@ -8,10 +8,10 @@ Allow registering custom protocols to handle service worker main script fetching
Refs https://bugs.chromium.org/p/chromium/issues/detail?id=996511
diff --git a/content/browser/service_worker/service_worker_context_wrapper.cc b/content/browser/service_worker/service_worker_context_wrapper.cc
index 25c9e17bd063cc07fd2727474395a9276c4a000d..413f3019bd55388e8ebc8fe39af766b7c61e9924 100644
index cdd2f243082290767abbee39b4e80a67c705a789..7168d496663675455b417f709339aab08aabc9f0 100644
--- a/content/browser/service_worker/service_worker_context_wrapper.cc
+++ b/content/browser/service_worker/service_worker_context_wrapper.cc
@@ -1957,6 +1957,26 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
@@ -1972,6 +1972,26 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
loader_factory_bundle_info =
context()->loader_factory_bundle_for_update_check()->Clone();
@@ -38,9 +38,9 @@ index 25c9e17bd063cc07fd2727474395a9276c4a000d..413f3019bd55388e8ebc8fe39af766b7
if (auto* config = content::WebUIConfigMap::GetInstance().GetConfig(
browser_context(), scope)) {
// If this is a Service Worker for a WebUI, the WebUI's URLDataSource
@@ -1976,9 +1996,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
@@ -1991,9 +2011,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
features::kEnableServiceWorkersForChromeScheme) &&
scope.scheme_piece() == kChromeUIScheme) {
scope.scheme() == kChromeUIScheme) {
config->RegisterURLDataSource(browser_context());
- static_cast<blink::PendingURLLoaderFactoryBundle*>(
- loader_factory_bundle_info.get())
@@ -49,9 +49,9 @@ index 25c9e17bd063cc07fd2727474395a9276c4a000d..413f3019bd55388e8ebc8fe39af766b7
.emplace(kChromeUIScheme, CreateWebUIServiceWorkerLoaderFactory(
browser_context(), kChromeUIScheme,
base::flat_set<std::string>()));
@@ -1986,9 +2004,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
@@ -2001,9 +2019,7 @@ ServiceWorkerContextWrapper::GetLoaderFactoryForBrowserInitiatedRequest(
features::kEnableServiceWorkersForChromeUntrusted) &&
scope.scheme_piece() == kChromeUIUntrustedScheme) {
scope.scheme() == kChromeUIUntrustedScheme) {
config->RegisterURLDataSource(browser_context());
- static_cast<blink::PendingURLLoaderFactoryBundle*>(
- loader_factory_bundle_info.get())

View File

@@ -82,10 +82,10 @@ index 786c526588d81b8b5b1b5dd3760719a53e005995..f66b7d0b4dfcbb8ed3dde5a9ff463ae2
const Source& GetSource(int index) const override;
DesktopMediaList::Type GetMediaListType() const override;
diff --git a/chrome/browser/media/webrtc/native_desktop_media_list.cc b/chrome/browser/media/webrtc/native_desktop_media_list.cc
index 4383a2dd4a132e3012c206404399d73ac2d40ad4..912921c2b448e2badac50e8a7ed527aeb8f433a9 100644
index 3be638f1032815d39634b5725031d7f3124e1ad2..fce3e30bc736ac72a42d24956d4abf9f49c8fc41 100644
--- a/chrome/browser/media/webrtc/native_desktop_media_list.cc
+++ b/chrome/browser/media/webrtc/native_desktop_media_list.cc
@@ -214,9 +214,13 @@ content::DesktopMediaID::Id GetUpdatedWindowId(
@@ -216,9 +216,13 @@ content::DesktopMediaID::Id GetUpdatedWindowId(
}
}
#elif BUILDFLAG(IS_MAC)
@@ -99,7 +99,7 @@ index 4383a2dd4a132e3012c206404399d73ac2d40ad4..912921c2b448e2badac50e8a7ed527ae
#endif
return window_id;
@@ -319,7 +323,7 @@ class NativeDesktopMediaList::Worker
@@ -321,7 +325,7 @@ class NativeDesktopMediaList::Worker
base::WeakPtr<NativeDesktopMediaList> media_list_;
DesktopMediaID::Type source_type_;
@@ -108,7 +108,7 @@ index 4383a2dd4a132e3012c206404399d73ac2d40ad4..912921c2b448e2badac50e8a7ed527ae
const ThumbnailCapturer::FrameDeliveryMethod frame_delivery_method_;
const bool add_current_process_windows_;
const bool auto_show_delegated_source_list_;
@@ -601,6 +605,12 @@ void NativeDesktopMediaList::Worker::RefreshNextThumbnail() {
@@ -603,6 +607,12 @@ void NativeDesktopMediaList::Worker::RefreshNextThumbnail() {
FROM_HERE,
base::BindOnce(&NativeDesktopMediaList::UpdateNativeThumbnailsFinished,
media_list_));
@@ -121,7 +121,7 @@ index 4383a2dd4a132e3012c206404399d73ac2d40ad4..912921c2b448e2badac50e8a7ed527ae
}
void NativeDesktopMediaList::Worker::OnCaptureResult(
@@ -1008,6 +1018,11 @@ void NativeDesktopMediaList::RefreshForVizFrameSinkWindows(
@@ -1009,6 +1019,11 @@ void NativeDesktopMediaList::RefreshForVizFrameSinkWindows(
FROM_HERE, base::BindOnce(&Worker::RefreshThumbnails,
base::Unretained(worker_.get()),
std::move(native_ids), thumbnail_size_));

Some files were not shown because too many files have changed in this diff Show More