build: roll EngFlow/reclient-configs to d3a4d5e

* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix

.devcontainer/docker-compose.yml

@@ -2,7 +2,7 @@ version: '3'
 
 services:
   buildtools:
-    image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
+    image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
 
     volumes:
       - ..:/workspaces/gclient/src/electron:cached

.github/ISSUE_TEMPLATE/bug_report.yml

@@ -58,6 +58,16 @@ body:
     label: Last Known Working Electron version
     description: What is the last version of Electron this worked in, if applicable?
     placeholder: 16.0.0
+- type: dropdown
+  attributes:
+    label: Does the issue also appear in Chromium / Google Chrome?
+    description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
+    options:
+      - I don't know how to test
+      - "Yes"
+      - "No"
+  validations:
+    required: true
 - type: textarea
   attributes:
     label: Expected Behavior

.github/actions/build-electron/action.yml

@@ -70,7 +70,11 @@ runs:
 
         # Upload build stats to Datadog
         if ! [ -z $DD_API_KEY ]; then
-          npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
+          if [ "$TARGET_PLATFORM" = "win" ]; then
+            npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
+          else
+            npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
+          fi
         else
           echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
         fi
@@ -132,6 +136,14 @@ runs:
       run: |
         cd src
         e build --target electron:electron_chromedriver_zip
+
+        if [ "${{ inputs.is-asan }}" != "true" ]; then
+          target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
+          if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
+            target_os="${target_os}_mas"
+          fi
+          electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
+        fi
     - name: Create installed_software.json ${{ inputs.step-suffix }}
       shell: powershell
       if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -176,7 +188,7 @@ runs:
       shell: bash
       run: |
         cd src/electron
-        node script/yarn.js create-typescript-definitions
+        node script/yarn create-typescript-definitions
     - name: Publish Electron Dist ${{ inputs.step-suffix }}
       if: ${{ inputs.is-release == 'true' }}
       shell: bash

.github/actions/checkout/action.yml

@@ -143,17 +143,16 @@ runs:
           echo "No changes to patches detected"
         fi
       fi
-  - name: Remove patch conflict problem matchers
+  - name: Remove patch conflict problem matcher
     shell: bash
     run: |
       echo "::remove-matcher owner=merge-conflict::"
       echo "::remove-matcher owner=patch-conflict::"
-      echo "::remove-matcher owner=patch-needs-update::"
   - name: Upload patches stats
     if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
     shell: bash
     run: |
-      node src/electron/script/patches-stats.mjs --upload-stats || true
+      npx node src/electron/script/patches-stats.mjs --upload-stats || true
   # delete all .git directories under src/ except for
   # third_party/angle/ and third_party/dawn/ because of build time generation of files
   # gen/angle/commit.h depends on third_party/angle/.git/HEAD
@@ -173,7 +172,6 @@ runs:
     run: |
       rm -rf src/android_webview
       rm -rf src/ios/chrome
-      rm -rf src/third_party/blink/web_tests
       rm -rf src/third_party/blink/perf_tests
       rm -rf src/chrome/test/data/xr/webvr_info
       rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

.github/actions/free-space-macos/action.yml

@@ -6,6 +6,8 @@ runs:
     - name: Free Space on MacOS
       shell: bash
       run: |
+        echo "Disk usage before cleanup:"
+        df -h
         sudo mkdir -p $TMPDIR/del-target
 
         tmpify() {
@@ -15,28 +17,30 @@ runs:
         }
 
         strip_universal_deep() {
-          opwd=$(pwd)
-          cd $1
-          f=$(find . -perm +111 -type f)
-          for fp in $f
-          do
-            if [[ $(file "$fp") == *"universal binary"* ]]; then
-              if [ "`arch`" == "arm64" ]; then
-                if [[ $(file "$fp") == *"x86_64"* ]]; then
-                  sudo lipo -remove x86_64 "$fp" -o "$fp" || true
-                fi
-              else
-                if [[ $(file "$fp") == *"arm64e)"* ]]; then
-                  sudo lipo -remove arm64e "$fp" -o "$fp" || true
-                fi
-                if [[ $(file "$fp") == *"arm64)"* ]]; then
-                  sudo lipo -remove arm64 "$fp" -o "$fp" || true
+          if [ -d "$1" ]; then
+            opwd=$(pwd)
+            cd $1
+            f=$(find . -perm +111 -type f)
+            for fp in $f
+            do
+              if [[ $(file "$fp") == *"universal binary"* ]]; then
+                if [ "`arch`" == "arm64" ]; then
+                  if [[ $(file "$fp") == *"x86_64"* ]]; then
+                    sudo lipo -remove x86_64 "$fp" -o "$fp" || true
+                  fi
+                else
+                  if [[ $(file "$fp") == *"arm64e)"* ]]; then
+                    sudo lipo -remove arm64e "$fp" -o "$fp" || true
+                  fi
+                  if [[ $(file "$fp") == *"arm64)"* ]]; then
+                    sudo lipo -remove arm64 "$fp" -o "$fp" || true
+                  fi
                 fi
               fi
-            fi
-          done
+            done
 
-          cd $opwd
+            cd $opwd
+          fi
         }
 
         tmpify /Library/Developer/CoreSimulator
@@ -58,10 +62,9 @@ runs:
 
         sudo rm -rf /Applications/Safari.app
         sudo rm -rf /Applications/Xcode_16.1.app
-        sudo rm -rf /Applications/Xcode_16.3.app
         sudo rm -rf /Applications/Xcode_16.2.app
+        sudo rm -rf /Applications/Xcode_16.3.app
         sudo rm -rf /Applications/Google Chrome.app
-        sudo rm -rf /Applications/Xcode_16.4.app
         sudo rm -rf /Applications/Google Chrome for Testing.app
         sudo rm -rf	/Applications/Firefox.app
         sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
@@ -73,4 +76,5 @@ runs:
 
         # lipo off some huge binaries arm64 versions to save space
         strip_universal_deep $(xcode-select -p)/../SharedFrameworks
-        # strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
+        # strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
+        sudo mdutil -a -i off

.github/actions/generate-types/action.yml

@@ -13,16 +13,12 @@ runs:
   - name: Generating Types for SHA in ${{ inputs.sha-file }}
     shell: bash
     run: |
-      export ELECTRON_DIR=$(pwd)
-      if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
-        cd /tmp
-        git clone https://github.com/electron/electron.git
-        cd electron
-      fi
-      git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
-      node script/yarn.js install --immutable
+      git checkout $(cat ${{ inputs.sha-file }})
+      rm -rf node_modules
+      yarn install --frozen-lockfile --ignore-scripts
       echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
       node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
       node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
-      mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
+      mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
+      git checkout .
     working-directory: ./electron

.github/actions/install-build-tools/action.yml

@@ -15,7 +15,7 @@ runs:
         git config --global core.preloadindex true
         git config --global core.longpaths true
       fi
-      export BUILD_TOOLS_SHA=4430e4a505e0f4fa2a41b707a10a36f780bbdd26
+      export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
       npm i -g @electron/build-tools
       # Update depot_tools to ensure python
       e d update_depot_tools

.github/actions/install-dependencies/action.yml

@@ -6,7 +6,7 @@ runs:
   - name: Get yarn cache directory path
     shell: bash
     id: yarn-cache-dir-path
-    run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
+    run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
   - uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
     id: yarn-cache
     with:
@@ -18,14 +18,4 @@ runs:
     shell: bash
     run: |
       cd src/electron
-      if [ "$TARGET_ARCH" = "x86" ]; then
-        export npm_config_arch="ia32"
-      fi
-      # if running on linux arm skip yarn Builds
-      ARCH=$(uname -m)
-      if [ "$ARCH" = "armv7l" ]; then
-        echo "Skipping yarn build on linux arm"
-        node script/yarn.js install --immutable --mode=skip-build
-      else
-        node script/yarn.js install --immutable
-      fi
+      node script/yarn install --frozen-lockfile --prefer-offline

.github/problem-matchers/patch-conflict.json

@@ -19,16 +19,6 @@
           "line": 3
         }
       ]
-    },
-    {
-      "owner": "patch-needs-update",
-      "pattern": [
-        {
-          "regexp": "^((patches\/.*): needs update)$",
-          "message": 1,
-          "file": 2
-        }
-      ]
     }
   ]
 }

.github/workflows/archaeologist-dig.yml

@@ -3,21 +3,17 @@ name: Archaeologist
 on:
   pull_request:
 
-permissions: {}
-
 jobs:
    archaeologist-dig:
     name: Archaeologist Dig
     runs-on: ubuntu-latest
-    permissions:
-      contents: read
     steps:
       - name: Checkout Electron
-        uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
+        uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
         with:
           fetch-depth: 0
       - name: Setup Node.js/npm
-        uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
+        uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
         with:
           node-version: 20.19.x
       - name: Setting Up Dig Site
@@ -45,7 +41,7 @@ jobs:
           sha-file: .dig-old
           filename: electron.old.d.ts
       - name: Upload artifacts
-        uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
+        uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
         with:
           name: artifacts
           path: electron/artifacts

.github/workflows/audit-branch-ci.yml

@@ -15,8 +15,12 @@ jobs:
     permissions:
       contents: read
     steps:
-      - run: npm install @actions/cache @electron/fiddle-core
-      - uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
+      - name: Setup Node.js
+        uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
+        with:
+          node-version: 22.17.x
+      - run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
+      - uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
         id: audit-errors
         with:
           github-token: ${{ secrets.GITHUB_TOKEN }}
@@ -29,7 +33,7 @@ jobs:
             // Only want the most recent workflow run that wasn't skipped or cancelled
             const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
 
-            const versions = await ElectronVersions.create(undefined, { ignoreCache: true });
+            const versions = await ElectronVersions.create({ ignoreCache: true });
             const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
 
             for (const branch of ["main", ...branches]) {
@@ -69,6 +73,7 @@ jobs:
                       annotation_level === "failure" &&
                       !message.startsWith("Process completed with exit code") &&
                       !message.startsWith("Response status code does not indicate success") &&
+                      !message.startsWith("The hosted runner lost communication with the server") &&
                       !/Unable to make request/.test(message) &&
                       !/The requested URL returned error/.test(message),
                   )
@@ -101,7 +106,6 @@ jobs:
             }
 
             if (runsWithErrors.length > 0) {
-              core.setOutput('errorsFound', true);
               core.summary.addHeading('⚠️ Runs with Errors');
               core.summary.addTable([
                 [
@@ -128,6 +132,7 @@ jobs:
 
               // Set this as failed so it's easy to scan runs to find failures
               if (runsWithErrors.find((run) => !run.isStale)) {
+                core.setOutput('errorsFound', true);
                 process.exitCode = 1;
               }
             } else {
@@ -137,7 +142,7 @@ jobs:
             await core.summary.write();
       - name: Send Slack message if errors
         if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
-        uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
+        uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
         with:
           payload: |
             link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"

.github/workflows/branch-created.yml

@@ -75,7 +75,7 @@ jobs:
           org: electron
       - name: Generate Release Project Board Metadata
         if: ${{ steps.check-major-version.outputs.MAJOR }}
-        uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
+        uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
         id: generate-project-metadata
         with:
           script: |

.github/workflows/build-git-cache.yml

@@ -6,15 +6,11 @@ on:
   schedule:
     - cron: "0 0 * * *"
 
-permissions: {}
-
 jobs:
   build-git-cache-linux:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
-      image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
+      image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
       options: --user root
       volumes:
         - /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -23,7 +19,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -34,10 +30,8 @@ jobs:
 
   build-git-cache-windows:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
-      image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
+      image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
       options: --user root --device /dev/fuse --cap-add SYS_ADMIN
       volumes:
         - /mnt/win-cache:/mnt/win-cache
@@ -47,7 +41,7 @@ jobs:
       TARGET_OS: 'win'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -58,12 +52,10 @@ jobs:
 
   build-git-cache-macos:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     # This job updates the same git cache as linux, so it needs to run after the linux one.
     needs: build-git-cache-linux
     container:
-      image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
+      image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
       options: --user root
       volumes:
         - /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -72,7 +64,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/build.yml

@@ -6,7 +6,7 @@ on:
       build-image-sha:
         type: string
         description: 'SHA for electron/build image'
-        default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
+        default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
         required: true
       skip-macos:
         type: boolean
@@ -43,13 +43,10 @@ defaults:
   run:
     shell: bash
 
-permissions: {}
-
 jobs:
   setup:
     runs-on: ubuntu-latest
     permissions:
-      contents: read
       pull-requests: read
     outputs:
         docs: ${{ steps.filter.outputs.docs }}
@@ -57,7 +54,7 @@ jobs:
         build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
         docs-only: ${{ steps.set-output.outputs.docs-only }}
     steps:
-    - uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
+    - uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         ref: ${{ github.event.pull_request.head.sha }}
     - uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -66,17 +63,13 @@ jobs:
         filters: |
           docs:
             - 'docs/**'
-            - README.md
-            - SECURITY.md
-            - CONTRIBUTING.md
-            - CODE_OF_CONDUCT.md
           src:
             - '!docs/**'
     - name: Set Outputs for Build Image SHA & Docs Only
       id: set-output
       run: |
         if [ -z "${{ inputs.build-image-sha }}" ]; then
-          echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
+          echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
         else
           echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
         fi
@@ -87,8 +80,6 @@ jobs:
     needs: setup
     if: ${{ !inputs.skip-lint }}
     uses: ./.github/workflows/pipeline-electron-lint.yml
-    permissions:
-      contents: read
     with:
       container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
     secrets: inherit
@@ -98,8 +89,6 @@ jobs:
     needs: [setup, checkout-linux]
     if: ${{ needs.setup.outputs.docs-only == 'true' }}
     uses: ./.github/workflows/pipeline-electron-docs-only.yml
-    permissions:
-      contents: read
     with:
       container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
     secrets: inherit
@@ -109,8 +98,6 @@ jobs:
     needs: setup
     if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
       options: --user root
@@ -124,7 +111,7 @@ jobs:
       build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -139,8 +126,6 @@ jobs:
     needs: setup
     if: ${{ !inputs.skip-linux}}
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
       options: --user root
@@ -156,7 +141,7 @@ jobs:
       build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -170,8 +155,6 @@ jobs:
     needs: setup
     if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
       options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -188,7 +171,7 @@ jobs:
       build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -202,20 +185,16 @@ jobs:
   # GN Check Jobs
   macos-gn-check:
     uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
-    permissions:
-      contents: read
     needs: checkout-macos
     with:
       target-platform: macos
       target-archs: x64 arm64
-      check-runs-on: macos-14
+      check-runs-on: macos-15
       gn-build-type: testing
     secrets: inherit
 
   linux-gn-check:
     uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
-    permissions:
-      contents: read
     needs: checkout-linux
     if: ${{ needs.setup.outputs.src == 'true' }}
     with:
@@ -228,8 +207,6 @@ jobs:
 
   windows-gn-check:
     uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
-    permissions:
-      contents: read
     needs: checkout-windows
     with:
       target-platform: win
@@ -248,8 +225,8 @@ jobs:
     uses: ./.github/workflows/pipeline-electron-build-and-test.yml
     needs: checkout-macos
     with:
-      build-runs-on: macos-14-xlarge
-      test-runs-on: macos-14-large 
+      build-runs-on: macos-15-xlarge
+      test-runs-on: macos-15-large
       target-platform: macos
       target-arch: x64
       is-release: false
@@ -267,8 +244,8 @@ jobs:
     uses: ./.github/workflows/pipeline-electron-build-and-test.yml
     needs: checkout-macos
     with:
-      build-runs-on: macos-14-xlarge
-      test-runs-on: macos-14
+      build-runs-on: macos-15-xlarge
+      test-runs-on: macos-15
       target-platform: macos
       target-arch: arm64
       is-release: false
@@ -333,7 +310,7 @@ jobs:
       build-runs-on: electron-arc-centralus-linux-amd64-32core
       test-runs-on: electron-arc-centralus-linux-arm64-4core
       build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
-      test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
+      test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
       target-platform: linux
       target-arch: arm
       is-release: false
@@ -423,8 +400,6 @@ jobs:
   gha-done:
     name: GitHub Actions Completed
     runs-on: ubuntu-latest
-    permissions:
-      contents: read
     needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
     if: always() && !contains(needs.*.result, 'failure')
     steps: 

.github/workflows/clean-src-cache.yml

@@ -1,20 +1,16 @@
 name: Clean Source Cache
 
-# Description:
-# This workflow cleans up the source cache on the cross-instance cache volume
-# to free up space. It runs daily at midnight and clears files older than 15 days.
+description: |
+  This workflow cleans up the source cache on the cross-instance cache volume
+  to free up space. It runs daily at midnight and clears files older than 15 days.
 
 on:
   schedule:
     - cron: "0 0 * * *"
 
-permissions: {}
-
 jobs:
   clean-src-cache:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
       options: --user root

.github/workflows/issue-commented.yml

@@ -10,15 +10,24 @@ permissions: {}
 jobs:
   issue-commented:
     name: Remove blocked/{need-info,need-repro} on comment
-    if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
+    if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
     runs-on: ubuntu-latest
     steps:
+      - name: Get author association
+        id: get-author-association
+        env:
+          GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
+        run: |
+          AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
+          echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
+        if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
         id: generate-token
         with:
           creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
       - name: Remove label
+        if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
         env:
           GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
           ISSUE_URL: ${{ github.event.issue.html_url }}

.github/workflows/issue-labeled.yml

@@ -4,15 +4,14 @@ on:
   issues:
     types: [labeled]
 
-permissions: {}
+permissions:  # added using https://github.com/step-security/secure-workflows
+  contents: read
 
 jobs:
   issue-labeled-with-status:
     name: status/{confirmed,reviewed} label added
     if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
     runs-on: ubuntu-latest
-    permissions:
-      contents: read
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -32,8 +31,6 @@ jobs:
     name: blocked/* label added
     if: startsWith(github.event.label.name, 'blocked/')
     runs-on: ubuntu-latest
-    permissions:
-      contents: read
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -75,7 +72,7 @@ jobs:
           creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
       - name: Create comment
         if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
-        uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
+        uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
         with:
           actions: 'create-comment'
           token: ${{ steps.generate-token.outputs.token }}

.github/workflows/issue-opened.yml

@@ -11,7 +11,6 @@ jobs:
   add-to-issue-triage:
     if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
     runs-on: ubuntu-latest
-    permissions: {}
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -29,7 +28,6 @@ jobs:
   set-labels:
     if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
     runs-on: ubuntu-latest
-    permissions: {}
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -39,7 +37,7 @@ jobs:
           org: electron
       - run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
       - name: Add labels
-        uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
+        uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
         id: add-labels
         env:
           ISSUE_BODY: ${{ github.event.issue.body }}
@@ -136,7 +134,7 @@ jobs:
             }
       - name: Create unsupported major comment
         if: ${{ steps.add-labels.outputs.unsupportedMajor }}
-        uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
+        uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
         with:
           actions: 'create-comment'
           token: ${{ steps.generate-token.outputs.token }}

.github/workflows/issue-transferred.yml

@@ -10,7 +10,6 @@ jobs:
   issue-transferred:
     name: Issue Transferred
     runs-on: ubuntu-latest
-    permissions: {}
     if: ${{ !github.event.changes.new_repository.private }}
     steps:
       - name: Generate GitHub App token

.github/workflows/issue-unlabeled.yml

@@ -4,15 +4,14 @@ on:
   issues:
     types: [unlabeled]
 
-permissions: {}
+permissions:
+  contents: read
 
 jobs:
   issue-unlabeled-blocked:
     name: All blocked/* labels removed
     if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
     runs-on: ubuntu-latest
-    permissions:
-      contents: read
     steps:
       - name: Check for any blocked labels
         id: check-for-blocked-labels

.github/workflows/linux-publish.yml

@@ -6,7 +6,7 @@ on:
       build-image-sha:
         type: string
         description: 'SHA for electron/build image'
-        default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
+        default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
       upload-to-storage:
         description: 'Uploads to Azure storage'
         required: false
@@ -17,13 +17,9 @@ on:
         type: boolean
         default: false
 
-permissions: {}
-
 jobs:
   checkout-linux:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
       options: --user root
@@ -35,7 +31,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -44,8 +40,6 @@ jobs:
 
   publish-x64:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-linux
     with:
       environment: production-release
@@ -61,8 +55,6 @@ jobs:
 
   publish-arm:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-linux
     with:
       environment: production-release
@@ -78,8 +70,6 @@ jobs:
 
   publish-arm64:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-linux
     with:
       environment: production-release

.github/workflows/macos-publish.yml

@@ -6,7 +6,7 @@ on:
       build-image-sha:
         type: string
         description: 'SHA for electron/build image'
-        default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
+        default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
         required: true
       upload-to-storage:
         description: 'Uploads to Azure storage'
@@ -18,13 +18,9 @@ on:
         type: boolean
         default: false
 
-permissions: {}
-
 jobs:
   checkout-macos:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
       options: --user root
@@ -36,7 +32,7 @@ jobs:
       GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -48,12 +44,10 @@ jobs:
 
   publish-x64-darwin:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-14-xlarge
+      build-runs-on: macos-15-xlarge
       target-platform: macos
       target-arch: x64
       target-variant: darwin
@@ -65,12 +59,10 @@ jobs:
 
   publish-x64-mas:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-14-xlarge
+      build-runs-on: macos-15-xlarge
       target-platform: macos
       target-arch: x64
       target-variant: mas
@@ -82,12 +74,10 @@ jobs:
 
   publish-arm64-darwin:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-14-xlarge
+      build-runs-on: macos-15-xlarge
       target-platform: macos
       target-arch: arm64
       target-variant: darwin
@@ -99,12 +89,10 @@ jobs:
 
   publish-arm64-mas:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-macos
     with:
       environment: production-release
-      build-runs-on: macos-14-xlarge
+      build-runs-on: macos-15-xlarge
       target-platform: macos
       target-arch: arm64
       target-variant: mas

.github/workflows/non-maintainer-dependency-change.yml

@@ -7,22 +7,28 @@ on:
       - 'spec/yarn.lock'
       - '.github/workflows/**'
       - '.github/actions/**'
-      - '.yarn/**'
-      - '.yarnrc.yml'
 
 permissions: {}
 
 jobs:
   check-for-non-maintainer-dependency-change:
     name: Check for disallowed non-maintainer change
-    if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.pull_request.author_association) && github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
+    if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
     permissions:
       contents: read
       pull-requests: write
     runs-on: ubuntu-latest
     steps:
+      - name: Get author association
+        id: get-author-association
+        env:
+          GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
+        run: |
+          AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
+          echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
       - name: Check for existing review
         id: check-for-review
+        if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
         env:
           GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
           PR_URL: ${{ github.event.pull_request.html_url }}

.github/workflows/pipeline-electron-build-and-test-and-nan.yml

@@ -55,8 +55,6 @@ on:
         type: boolean
         default: false
 
-permissions: {}
-
 concurrency:
   group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
   cancel-in-progress: ${{ github.ref_protected != true }}
@@ -64,8 +62,6 @@ concurrency:
 jobs:
   build:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     with:
       build-runs-on: ${{ inputs.build-runs-on }}
       build-container: ${{ inputs.build-container }}
@@ -78,10 +74,6 @@ jobs:
     secrets: inherit
   test:
     uses: ./.github/workflows/pipeline-segment-electron-test.yml
-    permissions:
-      contents: read
-      issues: read
-      pull-requests: read
     needs: build
     with:
       target-arch: ${{ inputs.target-arch }}
@@ -91,8 +83,6 @@ jobs:
     secrets: inherit
   nn-test:
     uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
-    permissions:
-      contents: read
     needs: build
     with:
       target-arch: ${{ inputs.target-arch }}

.github/workflows/pipeline-electron-build-and-test.yml

@@ -64,13 +64,14 @@ concurrency:
   group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
   cancel-in-progress: ${{ github.ref_protected != true }}
 
-permissions: {}
+permissions:
+  contents: read
+  issues: read
+  pull-requests: read  
 
 jobs:
   build:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     with:
       build-runs-on: ${{ inputs.build-runs-on }}
       build-container: ${{ inputs.build-container }}
@@ -85,10 +86,6 @@ jobs:
     secrets: inherit
   test:
     uses: ./.github/workflows/pipeline-segment-electron-test.yml
-    permissions:
-      contents: read
-      issues: read
-      pull-requests: read
     needs: build
     with:
       target-arch: ${{ inputs.target-arch }}

.github/workflows/pipeline-electron-docs-only.yml

@@ -8,8 +8,6 @@ on:
         description: 'Container to run the docs-only ts compile in'
         type: string
 
-permissions: {}
-
 concurrency:
   group: electron-docs-only-${{ github.ref }}
   cancel-in-progress: true
@@ -21,13 +19,11 @@ jobs:
   docs-only:
     name: Docs Only Compile
     runs-on: electron-arc-centralus-linux-amd64-4core
-    permissions:
-      contents: read
     timeout-minutes: 20
     container: ${{ fromJSON(inputs.container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -43,7 +39,7 @@ jobs:
       with:
         target-platform: linux
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -54,12 +50,12 @@ jobs:
       shell: bash
       run: |
         cd src/electron
-        node script/yarn.js create-typescript-definitions
-        node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
+        node script/yarn create-typescript-definitions
+        node script/yarn tsc -p tsconfig.default_app.json --noEmit
         for f in build/webpack/*.js
         do
             out="${f:29}"
             if [ "$out" != "base.js" ]; then
-            node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
+            node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
             fi
         done

.github/workflows/pipeline-electron-lint.yml

@@ -8,8 +8,6 @@ on:
         description: 'Container to run lint in'
         type: string
 
-permissions: {}
-
 concurrency:
   group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
   cancel-in-progress: ${{ github.ref_protected != true }}
@@ -21,13 +19,11 @@ jobs:
   lint:
     name: Lint
     runs-on: electron-arc-centralus-linux-amd64-4core
-    permissions:
-      contents: read
     timeout-minutes: 20
     container: ${{ fromJSON(inputs.container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -78,11 +74,11 @@ jobs:
         # but then we would lint its contents (at least gn format), and it doesn't pass it.
 
         cd src/electron
-        node script/yarn.js install --immutable
-        node script/yarn.js lint
+        node script/yarn install --frozen-lockfile
+        node script/yarn lint
     - name: Run Script Typechecker
       shell: bash
       run: |
         cd src/electron
-        node script/yarn.js tsc -p tsconfig.script.json
+        node script/yarn tsc -p tsconfig.script.json
     

.github/workflows/pipeline-segment-electron-build.yml

@@ -59,8 +59,6 @@ on:
         type: boolean
         default: false
 
-permissions: {}
-
 concurrency:
   group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
   cancel-in-progress: ${{ github.ref_protected != true }}
@@ -83,8 +81,6 @@ jobs:
       run:
         shell: bash
     runs-on: ${{ inputs.build-runs-on }}
-    permissions:
-      contents: read
     container: ${{ fromJSON(inputs.build-container) }}
     environment: ${{ inputs.environment }}
     env:
@@ -95,7 +91,7 @@ jobs:
       run: |
         mkdir src
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -119,7 +115,7 @@ jobs:
       run: df -h
     - name: Setup Node.js/npm
       if: ${{ inputs.target-platform == 'macos' }}
-      uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
+      uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
       with:
         node-version: 20.19.x
         cache: yarn
@@ -163,7 +159,7 @@ jobs:
       if: ${{ inputs.target-platform == 'linux' }}
       uses: ./src/electron/.github/actions/restore-cache-aks
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pipeline-segment-electron-gn-check.yml

@@ -26,8 +26,6 @@ on:
         type: string
         default: testing
 
-permissions: {}
-
 concurrency:
   group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
   cancel-in-progress: true
@@ -43,12 +41,10 @@ jobs:
       run:
         shell: bash
     runs-on: ${{ inputs.check-runs-on }}
-    permissions:
-      contents: read
     container: ${{ fromJSON(inputs.check-container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -115,7 +111,7 @@ jobs:
     - name: Add CHROMIUM_BUILDTOOLS_PATH to env
       run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0

.github/workflows/pipeline-segment-electron-test.yml

@@ -35,7 +35,10 @@ concurrency:
   group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
   cancel-in-progress: ${{ github.ref_protected != true }}
 
-permissions: {}
+permissions:
+  contents: read
+  issues: read
+  pull-requests: read
 
 env:
   CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -50,10 +53,6 @@ jobs:
       run:
         shell: bash
     runs-on: ${{ inputs.test-runs-on }}
-    permissions:
-      contents: read
-      issues: read
-      pull-requests: read
     container: ${{ fromJSON(inputs.test-container) }}
     strategy:
       fail-fast: false
@@ -69,14 +68,16 @@ jobs:
       if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
       run: |
         cp $(which node) /mnt/runner-externals/node20/bin/
+        cp $(which node) /mnt/runner-externals/node24/bin/
     - name: Setup Node.js/npm
       if: ${{ inputs.target-platform == 'win' }}
-      uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
+      uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
       with:
         node-version: 20.19.x
     - name: Add TCC permissions on macOS
       if: ${{ inputs.target-platform == 'macos' }}
       run: |
+        epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
         configure_user_tccdb () {
           local values=$1
           local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
@@ -95,11 +96,14 @@ jobs:
             "'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
             "'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
             "'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
+            "'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
+            "'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
+            "'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
         )
         for values in "${userValuesArray[@]}"; do
           # Sonoma and higher have a few extra values
           # Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
-          if [ "$OSTYPE" = "darwin23" ]; then
+          if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
             configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
             configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
           else
@@ -110,12 +114,21 @@ jobs:
     - name: Turn off the unexpectedly quit dialog on macOS
       if: ${{ inputs.target-platform == 'macos' }}
       run: defaults write com.apple.CrashReporter DialogType server
+    - name: Set xcode to 16.4
+      if: ${{ inputs.target-platform == 'macos' }}
+      run: sudo xcode-select --switch /Applications/Xcode_16.4.app
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
         ref: ${{ github.event.pull_request.head.sha }}
+    - name: Turn off screenshot nag on macOS
+      if: ${{ inputs.target-platform == 'macos' }}
+      run: |
+        defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
+        src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
+        src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
     - name: Setup SSH Debugging
       if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
       uses: ./src/electron/.github/actions/ssh-debug
@@ -154,12 +167,12 @@ jobs:
         echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
         echo "IS_ASAN=true" >> $GITHUB_ENV
     - name: Download Generated Artifacts
-      uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
+      uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
       with:
         name: generated_artifacts_${{ env.ARTIFACT_KEY }}
         path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
     - name: Download Src Artifacts
-      uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
+      uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
       with:
         name: src_artifacts_${{ env.ARTIFACT_KEY }}
         path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
@@ -177,12 +190,16 @@ jobs:
       run: |
         cd src/out/Default
         unzip -:o dist.zip
-    - name: Import & Trust Self-Signed Codesigning Cert on MacOS
-      if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
+    #- name: Import & Trust Self-Signed Codesigning Cert on MacOS
+    #  if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
+    #  run: |
+    #    sudo security authorizationdb write com.apple.trust-settings.admin allow
+    #    cd src/electron
+    #    ./script/codesign/generate-identity.sh
+    - name: Install Datadog CLI
       run: |
-        sudo security authorizationdb write com.apple.trust-settings.admin allow
         cd src/electron
-        ./script/codesign/generate-identity.sh
+        node script/yarn global add @datadog/datadog-ci
     - name: Run Electron Tests
       shell: bash
       env:
@@ -208,7 +225,7 @@ jobs:
               export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
             fi
           fi
-          node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
+          node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
         else
           chown :builduser .. && chmod g+w ..
           chown -R :builduser . && chmod -R g+w .
@@ -225,14 +242,9 @@ jobs:
             export MOCHA_TIMEOUT=180000
             echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
             cd electron
-            runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
+            runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
           else
-            if [ "${{ inputs.target-arch }}" = "arm" ]; then
-              runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
-            else 
-              runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
-            fi
-            
+            runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
           fi
         fi
     - name: Upload Test results to Datadog
@@ -244,14 +256,13 @@ jobs:
         DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
       run: |
         if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
-          cd src/electron
-          export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
-          $DATADOG_PATH junit upload junit/test-results-main.xml
-        fi
+          export DATADOG_PATH=`node src/electron/script/yarn global bin`
+          $DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
+        fi          
       if: always() && !cancelled()
     - name: Upload Test Artifacts
       if: always() && !cancelled()
-      uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
+      uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
       with:
         name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
         path: src/electron/spec/artifacts

.github/workflows/pipeline-segment-node-nan-test.yml

@@ -26,8 +26,6 @@ on:
         type: string
         default: testing
 
-permissions: {}
-
 concurrency:
   group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
   cancel-in-progress: ${{ github.ref_protected != true }}
@@ -41,8 +39,6 @@ jobs:
   node-tests:
     name: Run Node.js Tests
     runs-on: electron-arc-centralus-linux-amd64-8core
-    permissions:
-      contents: read
     timeout-minutes: 30
     env: 
       TARGET_ARCH: ${{ inputs.target-arch }}
@@ -50,7 +46,7 @@ jobs:
     container: ${{ fromJSON(inputs.test-container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -65,12 +61,12 @@ jobs:
     - name: Install Dependencies
       uses: ./src/electron/.github/actions/install-dependencies
     - name: Download Generated Artifacts
-      uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
+      uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
       with:
         name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
         path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
     - name: Download Src Artifacts
-      uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
+      uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
       with:
         name: src_artifacts_linux_${{ env.TARGET_ARCH }}
         path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -97,8 +93,6 @@ jobs:
   nan-tests:
     name: Run Nan Tests
     runs-on: electron-arc-centralus-linux-amd64-4core
-    permissions:
-      contents: read
     timeout-minutes: 30
     env: 
       TARGET_ARCH: ${{ inputs.target-arch }}
@@ -106,7 +100,7 @@ jobs:
     container: ${{ fromJSON(inputs.test-container) }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -121,12 +115,12 @@ jobs:
     - name: Install Dependencies
       uses: ./src/electron/.github/actions/install-dependencies
     - name: Download Generated Artifacts
-      uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
+      uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
       with:
         name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
         path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
     - name: Download Src Artifacts
-      uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
+      uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
       with:
         name: src_artifacts_linux_${{ env.TARGET_ARCH }}
         path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -138,16 +132,10 @@ jobs:
         unzip -:o dist.zip
     - name: Setup Linux for Headless Testing
       run: sh -e /etc/init.d/xvfb start
-    - name: Add Clang problem matcher
-      shell: bash
-      run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
     - name: Run Nan Tests
       run: |
         cd src
         node electron/script/nan-spec-runner.js
-    - name: Remove Clang problem matcher
-      shell: bash
-      run: echo "::remove-matcher owner=clang::"
     - name: Wait for active SSH sessions
       shell: bash
       if: always() && !cancelled()

.github/workflows/pull-request-labeled.yml

@@ -11,10 +11,9 @@ jobs:
     name: backport/requested label added
     if: github.event.label.name == 'backport/requested 🗳'
     runs-on: ubuntu-latest
-    permissions: {}
     steps:
       - name: Trigger Slack workflow
-        uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
+        uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
         with:
           webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }} 
           webhook-type: webhook-trigger
@@ -29,7 +28,6 @@ jobs:
     name: deprecation-review/complete label added
     if: github.event.label.name == 'deprecation-review/complete ✅'
     runs-on: ubuntu-latest
-    permissions: {}
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

.github/workflows/scorecards.yml

@@ -22,13 +22,13 @@ jobs:
 
     steps:
       - name: "Checkout code"
-        uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
+        uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
         with:
           persist-credentials: false
 
       # This is a pre-submit / pre-release.
       - name: "Run analysis"
-        uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
+        uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
         with:
           results_file: results.sarif
           results_format: sarif
@@ -42,7 +42,7 @@ jobs:
       # Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
       # format to the repository Actions tab.
       - name: "Upload artifact"
-        uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
+        uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
         with:
           name: SARIF file
           path: results.sarif
@@ -50,6 +50,6 @@ jobs:
 
       # Upload the results to GitHub's code scanning dashboard.
       - name: "Upload to code-scanning"
-        uses: github/codeql-action/upload-sarif@ce28f5bb42b7a9f2c824e633a3f6ee835bab6858 # v3.29.0
+        uses: github/codeql-action/upload-sarif@4e94bd11f71e507f7f87df81788dff88d1dacbfb # v3.29.5
         with:
           sarif_file: results.sarif

.github/workflows/semantic.yml

@@ -7,7 +7,8 @@ on:
       - edited
       - synchronize
 
-permissions: {}
+permissions:
+  contents: read
 
 jobs:
   main:
@@ -18,7 +19,7 @@ jobs:
     runs-on: ubuntu-latest
     steps:
       - name: semantic-pull-request
-        uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
+        uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
         env:
           GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
         with:

.github/workflows/stable-prep-items.yml

@@ -11,7 +11,6 @@ jobs:
   check-stable-prep-items:
     name: Check Stable Prep Items
     runs-on: ubuntu-latest
-    permissions: {}
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

.github/workflows/stale.yml

@@ -10,14 +10,13 @@ permissions: {}
 jobs:
   stale:
     runs-on: ubuntu-latest
-    permissions: {}
     steps:
       - name: Generate GitHub App token
         uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
         id: generate-token
         with:
           creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
-      - uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
+      - uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
         with:
           repo-token: ${{ steps.generate-token.outputs.token }}
           days-before-stale: 90
@@ -28,11 +27,10 @@ jobs:
             This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
           close-issue-message: >
             This issue has been closed due to inactivity, and will not be monitored.  If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
-          exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
+          exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
           only-pr-labels: not-a-real-label
   pending-repro:
     runs-on: ubuntu-latest
-    permissions: {}
     if: ${{ always() }}
     needs: stale
     steps:
@@ -41,7 +39,7 @@ jobs:
         id: generate-token
         with:
           creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
-      - uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
+      - uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
         with:
           repo-token: ${{ steps.generate-token.outputs.token }}
           days-before-stale: -1

.github/workflows/windows-publish.yml

@@ -6,7 +6,7 @@ on:
       build-image-sha:
         type: string
         description: 'SHA for electron/build image'
-        default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
+        default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
         required: true
       upload-to-storage:
         description: 'Uploads to Azure storage'
@@ -18,13 +18,9 @@ on:
         type: boolean
         default: false
 
-permissions: {}
-
 jobs:
   checkout-windows:
     runs-on: electron-arc-centralus-linux-amd64-32core
-    permissions:
-      contents: read
     container:
       image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
       options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -40,7 +36,7 @@ jobs:
       build-image-sha: ${{ inputs.build-image-sha }}
     steps:
     - name: Checkout Electron
-      uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
+      uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
       with:
         path: src/electron
         fetch-depth: 0
@@ -52,8 +48,6 @@ jobs:
 
   publish-x64-win:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-windows
     with:
       environment: production-release
@@ -68,8 +62,6 @@ jobs:
 
   publish-arm64-win:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-windows
     with:
       environment: production-release
@@ -84,8 +76,6 @@ jobs:
 
   publish-x86-win:
     uses: ./.github/workflows/pipeline-segment-electron-build.yml
-    permissions:
-      contents: read
     needs: checkout-windows
     with:
       environment: production-release

.gitignore

@@ -53,5 +53,3 @@ ts-gen
 patches/mtime-cache.json
 
 spec/fixtures/logo.png
-
-.yarn/install-state.gz

.nvmrc

@@ -1 +1 @@
-20
+22

.yarnrc.yml

@@ -1,12 +0,0 @@
-enableScripts: false
-
-nmHoistingLimits: workspaces
-
-nodeLinker: node-modules
-
-npmMinimalAgeGate: 10080
-
-npmPreapprovedPackages:
-  - "@electron/*"
-
-yarnPath: .yarn/releases/yarn-4.12.0.cjs

BUILD.gn

@@ -586,7 +586,13 @@ source_set("electron_lib") {
   }
 
   if (is_mac) {
+    # Disable C++ modules to resolve linking error when including MacOS SDK
+    # headers from third_party/electron_node/deps/uv/include/uv/darwin.h
+    # TODO(samuelmaddock): consider revisiting this in the future
+    use_libcxx_modules = false
+
     deps += [
+      "//components/os_crypt/common:keychain_password_mac",
       "//components/remote_cocoa/app_shim",
       "//components/remote_cocoa/browser",
       "//content/browser:mac_helpers",
@@ -689,7 +695,6 @@ source_set("electron_lib") {
       "//components/app_launch_prefetch",
       "//components/crash/core/app:crash_export_thunks",
       "//third_party/libxml:xml_writer",
-      "//ui/native_theme:native_theme_browser",
       "//ui/wm",
       "//ui/wm/public",
     ]
@@ -781,9 +786,13 @@ source_set("electron_lib") {
 
 action("mksnapshot_checksum_gen") {
   script = "build/checksum_header.py"
+
   outputs = [ "$target_gen_dir/snapshot_checksum.h" ]
   inputs = [ "$root_out_dir/$v8_context_snapshot_filename" ]
-  args = rebase_path(inputs) + rebase_path(outputs)
+  args = rebase_path(inputs)
+
+  args += rebase_path(outputs)
+
   deps = [ "//tools/v8_context_snapshot" ]
 }
 

DEPS

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
 
 vars = {
   'chromium_version':
-    '140.0.7339.249',
+    '144.0.7506.0',
   'node_version':
-    'v22.22.0',
+    'v24.10.0',
   'nan_version':
-    'e14bdcd1f72d62bca1d541b66da43130384ec213',
+    '675cefebca42410733da8a454c8d9391fcebfbc2',
   'squirrel.mac_version':
     '0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
   'reactiveobjc_version':
@@ -14,7 +14,7 @@ vars = {
   'mantle_version':
     '78d3966b3c331292ea29ec38661b25df0a245948',
   'engflow_reclient_configs_version':
-    '955335c30a752e9ef7bff375baab5e0819b6c00d',
+    'd3a4d5e20f46c7cc771cf59cf6bd8e6f3c763ee1',
 
   'pyyaml_version': '3.12',
 
@@ -30,6 +30,9 @@ vars = {
   # The path of the sysroots.json file.
   'sysroots_json_path': 'electron/script/sysroots.json',
 
+  # KEEP IN SYNC WITH utils.js FILE
+  'yarn_version': '1.22.22',
+
   # To be able to build clean Chromium from sources.
   'apply_patches': True,
 
@@ -152,7 +155,7 @@ hooks = [
     'action': [
       'python3',
       '-c',
-      'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
+      'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
     ],
   },
   {

SECURITY.md

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
 
 Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
 
+## Escalation
+
+If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
+
+If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
+
 ## The Electron Security Notification Process
 
 For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

build/args/all.gn

@@ -2,7 +2,7 @@ is_electron_build = true
 root_extra_deps = [ "//electron" ]
 
 # Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
-node_module_version = 139
+node_module_version = 143
 
 v8_promise_internal_field_count = 1
 v8_embedder_string = "-electron.0"
@@ -19,6 +19,10 @@ proprietary_codecs = true
 
 enable_printing = true
 
+# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
+# CI is using MacOS 15.5 which doesn't have the required modulemaps.
+use_clang_modules = false
+
 # Removes DLLs from the build, which are only meant to be used for Chromium development.
 # See https://github.com/electron/electron/pull/17985
 angle_enable_vulkan_validation_layers = false

build/checksum_header.py

@@ -12,7 +12,7 @@ TEMPLATE_H = """
 
 namespace electron::snapshot_checksum {
 
-const std::string kChecksum = "{checksum}";
+inline constexpr std::string_view kChecksum = "{checksum}";
 
 }  // namespace electron::snapshot_checksum
 

build/rules.gni

@@ -67,10 +67,6 @@ template("mac_xib_bundle_data") {
     ibtool_flags = [
       "--minimum-deployment-target",
       mac_deployment_target,
-
-      # TODO(rsesek): Enable this once all the bots are on Xcode 7+.
-      # "--target-device",
-      # "mac",
     ]
   }
 

chromium_src/BUILD.gn

@@ -23,6 +23,8 @@ static_library("chrome") {
     "//chrome/browser/browser_process.h",
     "//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
     "//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
+    "//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
+    "//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
     "//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
     "//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
     "//chrome/browser/devtools/devtools_eye_dropper.cc",
@@ -142,8 +144,6 @@ static_library("chrome") {
     "//chrome/browser/ui/views/overlay/toggle_camera_button.h",
     "//chrome/browser/ui/views/overlay/toggle_microphone_button.cc",
     "//chrome/browser/ui/views/overlay/toggle_microphone_button.h",
-    "//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
-    "//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
     "//chrome/browser/ui/views/overlay/video_overlay_window_views.cc",
     "//chrome/browser/ui/views/overlay/video_overlay_window_views.h",
     "//chrome/browser/ui/views/picture_in_picture/picture_in_picture_bounds_change_animation.cc",
@@ -280,6 +280,8 @@ static_library("chrome") {
       "//chrome/browser/process_singleton_mac.mm",
       "//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.h",
       "//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.mm",
+      "//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
+      "//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
     ]
     deps += [ ":system_media_capture_permissions_mac_conflict" ]
   }
@@ -502,15 +504,17 @@ source_set("chrome_spellchecker") {
   ]
 }
 
-# These sources create an object file conflict with one in |:chrome|, so they
-# must live in a separate target.
-# Conflicting sources:
-#   //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
-#   //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
-source_set("system_media_capture_permissions_mac_conflict") {
-  sources = [
-    "//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
-    "//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
-  ]
-  deps = [ "//chrome/common" ]
+if (is_mac) {
+  # These sources create an object file conflict with one in |:chrome|, so they
+  # must live in a separate target.
+  # Conflicting sources:
+  #   //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
+  #   //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
+  source_set("system_media_capture_permissions_mac_conflict") {
+    sources = [
+      "//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
+      "//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
+    ]
+    deps = [ "//chrome/common" ]
+  }
 }

docs/api/app.md

@@ -421,6 +421,7 @@ Returns:
     * `oom` - Process ran out of memory
     * `launch-failed` - Process never successfully launched
     * `integrity-failure` - Windows code integrity checks failed
+    * `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
   * `exitCode` number - The exit code for the process
       (e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
   * `serviceName` string (optional) - The non-localized name of the process.
@@ -564,8 +565,9 @@ and subscribing to the `ready` event if the app is not ready yet.
   * `steal` boolean _macOS_ - Make the receiver the active app even if another app is
   currently active.
 
-On Linux, focuses on the first visible window. On macOS, makes the application
-the active app. On Windows, focuses on the application's first window.
+On macOS, makes the application the active app. On Windows, focuses on the application's
+first window. On Linux, either focuses on the first visible window (X11) or requests
+focus but may instead show a notification or flash the app icon (Wayland).
 
 You should seek to use the `steal` option as sparingly as possible.
 

docs/api/browser-window.md

@@ -140,6 +140,10 @@ state is `hidden` in order to minimize power consumption.
   move.
 * On Linux the type of modal windows will be changed to `dialog`.
 * On Linux many desktop environments do not support hiding a modal window.
+* On Wayland (Linux) it is generally not possible to programmatically resize windows
+  after creation, or to position, move, focus, or blur windows without user input.
+  If your app needs these capabilities, run it in Xwayland by appending the flag
+  `--ozone-platform=x11`.
 
 ## Class: BrowserWindow extends `BaseWindow`
 
@@ -656,10 +660,15 @@ the [close event](#event-close).
 
 Focuses on the window.
 
+On Wayland (Linux), the desktop environment may show a notification or flash
+the app icon if the window or app is not already focused.
+
 #### `win.blur()`
 
 Removes focus from the window.
 
+Not supported on Wayland (Linux).
+
 #### `win.isFocused()`
 
 Returns `boolean` - Whether the window is focused.
@@ -676,6 +685,8 @@ Shows and gives focus to the window.
 
 Shows the window but doesn't focus on it.
 
+Not supported on Wayland (Linux).
+
 #### `win.hide()`
 
 Hides the window.
@@ -824,6 +835,8 @@ Closes the currently open [Quick Look][quick-look] panel.
 
 Resizes and moves the window to the supplied bounds. Any properties that are not supplied will default to their current values.
 
+On Wayland (Linux), has the same limitations as `setSize` and `setPosition`.
+
 ```js
 const { BrowserWindow } = require('electron')
 
@@ -866,6 +879,8 @@ See [Setting `backgroundColor`](#setting-the-backgroundcolor-property).
 Resizes and moves the window's client area (e.g. the web page) to
 the supplied bounds.
 
+On Wayland (Linux), has the same limitations as `setContentSize` and `setPosition`.
+
 #### `win.getContentBounds()`
 
 Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window's client area as `Object`.
@@ -895,6 +910,8 @@ Returns `boolean` - whether the window is enabled.
 
 Resizes the window to `width` and `height`. If `width` or `height` are below any set minimum size constraints the window will snap to its minimum size.
 
+On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
+
 #### `win.getSize()`
 
 Returns `Integer[]` - Contains the window's width and height.
@@ -907,6 +924,8 @@ Returns `Integer[]` - Contains the window's width and height.
 
 Resizes the window's client area (e.g. the web page) to `width` and `height`.
 
+On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
+
 #### `win.getContentSize()`
 
 Returns `Integer[]` - Contains the window's client area's width and height.
@@ -1044,12 +1063,16 @@ this method throws an error.
 
 #### `win.moveTop()`
 
-Moves window to top(z-order) regardless of focus
+Moves window to top(z-order) regardless of focus.
+
+Not supported on Wayland (Linux).
 
 #### `win.center()`
 
 Moves window to the center of the screen.
 
+Not supported on Wayland (Linux).
+
 #### `win.setPosition(x, y[, animate])`
 
 * `x` Integer
@@ -1058,6 +1081,8 @@ Moves window to the center of the screen.
 
 Moves window to `x` and `y`.
 
+Not supported on Wayland (Linux).
+
 #### `win.getPosition()`
 
 Returns `Integer[]` - Contains the window's current position.

docs/api/client-request.md

@@ -25,11 +25,6 @@ following properties:
     with which the request is associated. Defaults to the empty string. The
     `session` option supersedes `partition`. Thus if a `session` is explicitly
     specified, `partition` is ignored.
-  * `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
-    custom protocol handlers registered for the request's URL scheme will not be
-    called. This allows forwarding an intercepted request to the built-in
-    handler. [webRequest](web-request.md) handlers will still be triggered
-    when bypassing custom protocols. Defaults to `false`.
   * `credentials` string (optional) - Can be `include`, `omit` or
     `same-origin`. Whether to send
     [credentials](https://fetch.spec.whatwg.org/#credentials) with this

docs/api/command-line-switches.md

@@ -86,7 +86,7 @@ Field trials to be forcefully enabled or disabled.
 
 For example: `WebRTC-Audio-Red-For-Opus/Enabled/`
 
-### --host-rules=`rules`
+### --host-rules=`rules` _Deprecated_
 
 A comma-separated list of `rules` that control how hostnames are mapped.
 
@@ -104,9 +104,23 @@ These mappings apply to the endpoint host in a net request (the TCP connect
 and host resolver in a direct connection, and the `CONNECT` in an HTTP proxy
 connection, and the endpoint host in a `SOCKS` proxy connection).
 
+**Deprecated:** Use the `--host-resolver-rules` switch instead.
+
 ### --host-resolver-rules=`rules`
 
-Like `--host-rules` but these `rules` only apply to the host resolver.
+A comma-separated list of `rules` that control how hostnames are mapped.
+
+For example:
+
+* `MAP * 127.0.0.1` Forces all hostnames to be mapped to 127.0.0.1
+* `MAP *.google.com proxy` Forces all google.com subdomains to be resolved to
+  "proxy".
+* `MAP test.com [::1]:77` Forces "test.com" to resolve to IPv6 loopback. Will
+  also force the port of the resulting socket address to be 77.
+* `MAP * baz, EXCLUDE www.google.com` Remaps everything to "baz", except for
+  "www.google.com".
+
+These `rules` only apply to the host resolver.
 
 ### --ignore-certificate-errors
 
@@ -179,6 +193,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
 Forces renderer process and Chromium helper processes to run un-sandboxed.
 Should only be used for testing.
 
+### --no-stdio-init
+
+Disable stdio initialization during node initialization.
+Used to avoid node initialization crash when the nul device is disabled on Windows platform.
+
 ### --proxy-bypass-list=`hosts`
 
 Instructs Electron to bypass the proxy server for the given semi-colon-separated
@@ -331,6 +350,22 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
 
 Disable exposition of [Navigator API][] on the global scope from Node.js.
 
+## Chromium Flags
+
+There isn't a documented list of all Chromium switches, but there are a few ways to find them.
+
+The easiest way is through Chromium's flags page, which you can access at `about://flags`. These flags don't directly match switch names, but they show up in the process's command-line arguments.
+
+To see these arguments, enable a flag in `about://flags`, then go to `about://version` in Chromium. You'll find a list of command-line arguments, including `--flag-switches-begin --your --list --flag-switches-end`, which contains the list of your flag enabled switches.
+
+Most flags are included as part of `--enable-features=`, but some are standalone switches, like `--enable-experimental-web-platform-features`.
+
+A complete list of flags exists in [Chromium's flag metadata page](https://source.chromium.org/chromium/chromium/src/+/main:chrome/browser/flag-metadata.json), but this list includes platform, environment and GPU specific, expired and potentially non-functional flags, so many of them might not always work in every situation.
+
+Keep in mind that standalone switches can sometimes be split into individual features, so there's no fully complete list of switches.
+
+Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
+
 [app]: app.md
 [append-switch]: command-line.md#commandlineappendswitchswitch-value
 [debugging-main-process]: ../tutorial/debugging-main-process.md

docs/api/context-bridge.md

@@ -157,6 +157,7 @@ has been included below for completeness:
 | [Cloneable Types](https://developer.mozilla.org/en-US/docs/Web/API/Web_Workers_API/Structured_clone_algorithm) | Simple | ✅ | ✅ | See the linked document on cloneable types |
 | `Element` | Complex | ✅ | ✅ | Prototype modifications are dropped.  Sending custom elements will not work. |
 | `Blob` | Complex | ✅ | ✅ | N/A |
+| `VideoFrame` | Complex | ✅ | ✅ | N/A |
 | `Symbol` | N/A | ❌ | ❌ | Symbols cannot be copied across contexts so they are dropped |
 
 If the type you care about is not in the above table, it is probably not supported.

docs/api/desktop-capturer.md

@@ -102,6 +102,10 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
 
 ## Caveats
 
+`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
+
+PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
+
 `navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
 
 It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

docs/api/native-image.md

@@ -202,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
 Returns `NativeImage`
 
 Creates a new `NativeImage` instance from the `NSImage` that maps to the
-given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
-documentation for a list of possible values.
+given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
 
 The `hslShift` is applied to the image with the following rules:
 

docs/api/session.md

@@ -66,7 +66,7 @@ The `session` module has the following properties:
 
 ### `session.defaultSession`
 
-A `Session` object, the default session object of the app.
+A `Session` object, the default session object of the app, available after `app.whenReady` is called.
 
 ## Class: Session
 

docs/api/structures/color-space.md

@@ -0,0 +1,195 @@
+# ColorSpace Object
+
+* `primaries` string - The color primaries of the color space. Can be one of the following values:
+  * `bt709` - BT709 primaries (also used for sRGB)
+  * `bt470m` - BT470M primaries
+  * `bt470bg` - BT470BG primaries
+  * `smpte170m` - SMPTE170M primaries
+  * `smpte240m` - SMPTE240M primaries
+  * `film` - Film primaries
+  * `bt2020` - BT2020 primaries
+  * `smptest428-1` - SMPTEST428-1 primaries
+  * `smptest431-2` - SMPTEST431-2 primaries
+  * `p3` - P3 primaries
+  * `xyz-d50` - XYZ D50 primaries
+  * `adobe-rgb` - Adobe RGB primaries
+  * `apple-generic-rgb` - Apple Generic RGB primaries
+  * `wide-gamut-color-spin` - Wide Gamut Color Spin primaries
+  * `ebu-3213-e` - EBU 3213-E primaries
+  * `custom` - Custom primaries
+  * `invalid` - Invalid primaries
+
+* `transfer` string - The transfer function of the color space. Can be one of the following values:
+  * `bt709` - BT709 transfer function
+  * `bt709-apple` - BT709 Apple transfer function
+  * `gamma18` - Gamma 1.8 transfer function
+  * `gamma22` - Gamma 2.2 transfer function
+  * `gamma24` - Gamma 2.4 transfer function
+  * `gamma28` - Gamma 2.8 transfer function
+  * `smpte170m` - SMPTE170M transfer function
+  * `smpte240m` - SMPTE240M transfer function
+  * `linear` - Linear transfer function
+  * `log` - Log transfer function
+  * `log-sqrt` - Log Square Root transfer function
+  * `iec61966-2-4` - IEC61966-2-4 transfer function
+  * `bt1361-ecg` - BT1361 ECG transfer function
+  * `srgb` - sRGB transfer function
+  * `bt2020-10` - BT2020-10 transfer function
+  * `bt2020-12` - BT2020-12 transfer function
+  * `pq` - PQ (Perceptual Quantizer) transfer function
+  * `smptest428-1` - SMPTEST428-1 transfer function
+  * `hlg` - HLG (Hybrid Log-Gamma) transfer function
+  * `srgb-hdr` - sRGB HDR transfer function
+  * `linear-hdr` - Linear HDR transfer function
+  * `custom` - Custom transfer function
+  * `custom-hdr` - Custom HDR transfer function
+  * `scrgb-linear-80-nits` - scRGB Linear 80 nits transfer function
+  * `invalid` - Invalid transfer function
+
+* `matrix` string - The color matrix of the color space. Can be one of the following values:
+  * `rgb` - RGB matrix
+  * `bt709` - BT709 matrix
+  * `fcc` - FCC matrix
+  * `bt470bg` - BT470BG matrix
+  * `smpte170m` - SMPTE170M matrix
+  * `smpte240m` - SMPTE240M matrix
+  * `ycocg` - YCoCg matrix
+  * `bt2020-ncl` - BT2020 NCL matrix
+  * `ydzdx` - YDzDx matrix
+  * `gbr` - GBR matrix
+  * `invalid` - Invalid matrix
+
+* `range` string - The color range of the color space. Can be one of the following values:
+  * `limited` - Limited color range (RGB values ranging from 16 to 235)
+  * `full` - Full color range (RGB values from 0 to 255)
+  * `derived` - Range defined by the transfer function and matrix
+  * `invalid` - Invalid range
+
+## Common `ColorSpace` definitions
+
+### Standard Color Spaces
+
+**sRGB**:
+
+  ```js
+  const cs = {
+    primaries: 'bt709',
+    transfer: 'srgb',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+**Display P3**:
+
+  ```js
+  const cs = {
+    primaries: 'p3',
+    transfer: 'srgb',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+**XYZ D50**:
+
+  ```js
+  const cs = {
+    primaries: 'xyz-d50',
+    transfer: 'linear',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+### HDR Color Spaces
+
+**Extended sRGB** (extends sRGB to all real values):
+
+  ```js
+  const cs = {
+    primaries: 'bt709',
+    transfer: 'srgb-hdr',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+**scRGB Linear** (linear transfer function for all real values):
+
+  ```js
+  const cs = {
+    primaries: 'bt709',
+    transfer: 'linear-hdr',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+**scRGB Linear 80 Nits** (with an SDR white level of 80 nits):
+
+  ```js
+  const cs = {
+    primaries: 'bt709',
+    transfer: 'scrgb-linear-80-nits',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+**HDR10** (BT.2020 primaries with PQ transfer function):
+
+  ```js
+  const cs = {
+    primaries: 'bt2020',
+    transfer: 'pq',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+**HLG** (BT.2020 primaries with HLG transfer function):
+
+  ```js
+  const cs = {
+    primaries: 'bt2020',
+    transfer: 'hlg',
+    matrix: 'rgb',
+    range: 'full'
+  }
+  ```
+
+### Video Color Spaces
+
+**Rec. 601** (SDTV):
+
+  ```js
+  const cs = {
+    primaries: 'smpte170m',
+    transfer: 'smpte170m',
+    matrix: 'smpte170m',
+    range: 'limited'
+  }
+  ```
+
+**Rec. 709** (HDTV):
+
+  ```js
+  const cs = {
+    primaries: 'bt709',
+    transfer: 'bt709',
+    matrix: 'bt709',
+    range: 'limited'
+  }
+  ```
+
+**JPEG** (typical color space for JPEG images):
+
+  ```js
+  const cs = {
+    primaries: 'bt709',
+    transfer: 'srgb',
+    matrix: 'smpte170m',
+    range: 'full'
+  }
+  ```

docs/api/structures/offscreen-shared-texture.md

@@ -2,9 +2,13 @@
 
 * `textureInfo` Object - The shared texture info.
   * `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
-  * `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
+  * `pixelFormat` string - The pixel format of the texture.
+    * `rgba` - The texture format is 8-bit unorm RGBA.
+    * `bgra` - The texture format is 8-bit unorm BGRA.
+    * `rgbaf16` - The texture format is 16-bit float RGBA.
   * `codedSize` [Size](size.md) - The full dimensions of the video frame.
-  * `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In OSR case, it is expected to have the full section area.
+  * `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
+  * `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.
   * `contentRect` [Rectangle](rectangle.md) - The region of the video frame that capturer would like to populate. In OSR case, it is the same with `dirtyRect` that needs to be painted.
   * `timestamp` number - The time in microseconds since the capture start.
   * `metadata` Object - Extra metadata. See comments in src\media\base\video_frame_metadata.h for accurate details.
@@ -12,13 +16,6 @@
     * `regionCaptureRect` [Rectangle](rectangle.md) (optional) - May reflect the frame's contents origin if region capture is used internally.
     * `sourceSize` [Rectangle](rectangle.md) (optional) - Full size of the source frame.
     * `frameCount` number (optional) - The increasing count of captured frame. May contain gaps if frames are dropped between two consecutively received frames.
-  * `sharedTextureHandle` Buffer _Windows_ _macOS_ - The handle to the shared texture.
-  * `planes` Object[] _Linux_ - Each plane's info of the shared texture.
-    * `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
-    * `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
-    * `size` number - Size in bytes of the plane. This is necessary to map the buffers.
-    * `fd` number - File descriptor for the underlying memory object (usually dmabuf).
-  * `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
+  * `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle data.
 * `release` Function - Release the resources. The `texture` cannot be directly passed to another process, users need to maintain texture lifecycles in
-  main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important
-  that you call `texture.release()` as soon as you're done with the texture.
+  main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important that you call `texture.release()` as soon as you're done with the texture.

docs/api/structures/render-process-gone-details.md

@@ -8,6 +8,7 @@
   * `oom` - Process ran out of memory
   * `launch-failed` - Process never successfully launched
   * `integrity-failure` - Windows code integrity checks failed
+  * `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
 * `exitCode` Integer - The exit code of the process, unless `reason` is
   `launch-failed`, in which case `exitCode` will be a platform-specific
   launch failure error code.

docs/api/structures/shared-texture-handle.md

@@ -0,0 +1,12 @@
+# SharedTextureHandle Object
+
+* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process.
+* `ioSurface` Buffer (optional) _macOS_ - IOSurfaceRef holds the shared texture. Note that this IOSurface is local to current process (not global).
+* `nativePixmap` Object (optional) _Linux_ - Structure contains planes of shared texture.
+  * `planes` Object[] _Linux_ - Each plane's info of the shared texture.
+    * `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
+    * `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
+    * `size` number - Size in bytes of the plane. This is necessary to map the buffers.
+    * `fd` number - File descriptor for the underlying memory object (usually dmabuf).
+  * `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
+  * `supportsZeroCopyWebGpuImport` boolean _Linux_ - Indicates whether supports zero copy import to WebGPU.

docs/api/structures/usb-device.md

@@ -1,17 +1,35 @@
 # USBDevice Object
 
+* `configuration` Object (optional) - A [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) object containing information about the currently selected configuration of a USB device.
+  * `configurationValue` Integer - the configuration value of this configuration.
+  * `configurationName` string - the name provided by the device to describe this configuration.
+  * `interfaces` Object[] - An array of [USBInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBInterface) objects containing information about an interface provided by the USB device.
+    * `interfaceNumber` Integer - the interface number of this interface.
+    * `alternate` Object - the currently selected alternative configuration of this interface.
+      * `alternateSetting` Integer - the alternate setting number of this interface.
+      * `interfaceClass` Integer - the class of this interface. See [USB.org](https://www.usb.org/defined-class-codes) for class code descriptions.
+      * `interfaceSubclass` Integer - the subclass of this interface.
+      * `interfaceProtocol` Integer - the protocol supported by this interface.
+      * `interfaceName` string (optional) - the name of the interface, if one is provided by the device.
+      * `endpoints` Object[] - an array containing instances of the [USBEndpoint interface](https://developer.mozilla.org/en-US/docs/Web/API/USBEndpoint) describing each of the endpoints that are part of this interface.
+        * `endpointNumber` Integer - this endpoint's "endpoint number" which is a value from 1 to 15.
+        * `direction` string - the direction in which this endpoint transfers data - can be either 'in' or 'out'.
+        * `type` string - the type of this endpoint - can be either 'bulk', 'interrupt', or 'isochronous'.
+        * `packetSize` Integer - the size of the packets that data sent through this endpoint will be divided into.
+    * `alternates` Object[] - an array containing instances of the [USBAlternateInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBAlternateInterface) interface describing each of the alternative configurations possible for this interface.
+* `configurations` Object[] - An array of [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) interfaces for controlling a paired USB device.
+* `deviceClass` Integer - The device class for the communication interface supported by the device.
 * `deviceId` string - Unique identifier for the device.
-* `vendorId` Integer - The USB vendor ID.
-* `productId` Integer - The USB product ID.
-* `productName` string (optional) - Name of the device.
-* `serialNumber` string (optional) - The USB device serial number.
-* `manufacturerName` string (optional) - The manufacturer name of the device.
-* `usbVersionMajor` Integer - The USB protocol major version supported by the device
-* `usbVersionMinor` Integer - The USB protocol minor version supported by the device
-* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device
-* `deviceClass` Integer - The device class for the communication interface supported by the device
-* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device
-* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device
+* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device.
+* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device.
 * `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
 * `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
 * `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
+* `manufacturerName` string (optional) - The manufacturer name of the device.
+* `productId` Integer - The USB product ID.
+* `productName` string (optional) - Name of the device.
+* `serialNumber` string (optional) - The USB device serial number.
+* `usbVersionMajor` Integer - The USB protocol major version supported by the device.
+* `usbVersionMinor` Integer - The USB protocol minor version supported by the device.
+* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device.
+* `vendorId` Integer - The USB vendor ID.

docs/api/structures/web-preferences.md

@@ -89,6 +89,11 @@
      paint event. Defaults to `false`. See the
     [offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
     more details.
+  * `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
+    The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
+    The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
+    * `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
+    * `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
 * `contextIsolation` boolean (optional) - Whether to run Electron APIs and
   the specified `preload` script in a separate JavaScript context. Defaults
   to `true`. The context that the `preload` script runs in will only have

docs/api/system-preferences.md

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
 
 The `systemPreferences` object emits the following events:
 
-### Event: 'accent-color-changed' _Windows_
+### Event: 'accent-color-changed' _Windows_ _Linux_
 
 Returns:
 
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
 Removes the `key` in `NSUserDefaults`. This can be used to restore the default
 or global value of a `key` previously set with `setUserDefault`.
 
-### `systemPreferences.getAccentColor()` _Windows_ _macOS_
+### `systemPreferences.getAccentColor()`
 
 Returns `string` - The users current system wide accent color preference in RGBA
 hexadecimal form.

docs/breaking-changes.md

@@ -12,6 +12,37 @@ This document uses the following convention to categorize breaking changes:
 * **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
 * **Removed:** An API or feature was removed, and is no longer supported by Electron.
 
+## Planned Breaking API Changes (39.0)
+
+### Deprecated: `--host-rules` command line switch
+
+Chromium is deprecating the `--host-rules` switch.
+
+You should use `--host-resolver-rules` instead.
+
+### Behavior Changed: window.open popups are always resizable
+
+Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
+
+To restore previous behavior:
+
+```js
+webContents.setWindowOpenHandler((details) => {
+  return {
+    action: 'allow',
+    overrideBrowserWindowOptions: {
+      resizable: details.features.includes('resizable=yes')
+    }
+  }
+})
+```
+
+### Behavior Changed: shared texture OSR `paint` event data structure
+
+When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
+It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
+See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
+
 ## Planned Breaking API Changes (38.0)
 
 ### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable

docs/development/build-instructions-linux.md

@@ -6,17 +6,77 @@ Follow the guidelines below for building **Electron itself** on Linux, for the p
 
 ## Prerequisites
 
-Due to Electron's dependency on Chromium, prerequisites and dependencies for Electron change over time. [Chromium's documentation on building on Linux](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/linux/build_instructions.md) has up to date information for building Chromium on Linux. This documentation can generally
-be followed for building Electron on Linux as well.
+* At least 25GB disk space and 8GB RAM.
+* Python >= 3.9.
+* [Node.js](https://nodejs.org/download/) >= 22.12.0
+* [clang](https://clang.llvm.org/get_started.html) 3.4 or later.
+* Development headers of GTK 3 and libnotify.
 
-Additionally, Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) can be referenced to get the current dependencies that Electron requires in addition to what Chromium installs via [build/install-deps.sh](https://chromium.googlesource.com/chromium/src/+/HEAD/build/install-build-deps.sh).
+On Ubuntu >= 20.04, install the following libraries:
+
+```sh
+$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
+                       libnotify-dev libasound2-dev libcap-dev \
+                       libcups2-dev libxtst-dev \
+                       libxss1 libnss3-dev gcc-multilib g++-multilib curl \
+                       gperf bison python3-dbusmock openjdk-8-jre
+```
+
+On Ubuntu < 20.04, install the following libraries:
+
+```sh
+$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
+                       libnotify-dev libgnome-keyring-dev \
+                       libasound2-dev libcap-dev libcups2-dev libxtst-dev \
+                       libxss1 libnss3-dev gcc-multilib g++-multilib curl \
+                       gperf bison python-dbusmock openjdk-8-jre
+```
+
+On RHEL / CentOS, install the following libraries:
+
+```sh
+$ sudo yum install clang dbus-devel gtk3-devel libnotify-devel \
+                   libgnome-keyring-devel xorg-x11-server-utils libcap-devel \
+                   cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
+                   nss-devel python-dbusmock openjdk-8-jre
+```
+
+On Fedora, install the following libraries:
+
+```sh
+$ sudo dnf install clang dbus-devel gperf gtk3-devel \
+                   libnotify-devel libgnome-keyring-devel libcap-devel \
+                   cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
+                   nss-devel python-dbusmock
+```
+
+On Arch Linux / Manjaro, install the following libraries:
+
+```sh
+$ sudo pacman -Syu base-devel clang libdbus gtk2 libnotify \
+                   libgnome-keyring alsa-lib libcap libcups libxtst \
+                   libxss nss gcc-multilib curl gperf bison \
+                   python2 python-dbusmock jdk8-openjdk
+```
+
+Other distributions may offer similar packages for installation via package
+managers such as pacman. Or one can compile from source code.
 
 ### Cross compilation
 
-If you want to build for an `arm` target, you can use Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) to install the additional dependencies by passing the `--arm argument`:
+If you want to build for an `arm` target you should also install the following
+dependencies:
 
 ```sh
-$ sudo install-deps.sh --arm
+$ sudo apt-get install libc6-dev-armhf-cross linux-libc-dev-armhf-cross \
+                       g++-arm-linux-gnueabihf
+```
+
+Similarly for `arm64`, install the following:
+
+```sh
+$ sudo apt-get install libc6-dev-arm64-cross linux-libc-dev-arm64-cross \
+                       g++-aarch64-linux-gnu
 ```
 
 And to cross-compile for `arm` or targets, you should pass the

docs/glossary.md

@@ -12,6 +12,15 @@ The ASAR format was created primarily to improve performance on Windows when
 reading large quantities of small files (e.g. when loading your app's JavaScript
 dependency tree from `node_modules`).
 
+### ASAR integrity
+
+ASAR integrity is an security feature that validates the contents of your app's
+ASAR archives at runtime. When enabled, your Electron app will verify the
+header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
+hashes, the app will forcefully terminate.
+
+See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
+
 ### code signing
 
 Code signing is a process where an app developer digitally signs their code to

docs/tutorial/asar-integrity.md

@@ -5,7 +5,7 @@ slug: asar-integrity
 hide_title: false
 ---
 
-ASAR integrity is an experimental feature that validates the contents of your app's
+ASAR integrity is a security feature that validates the contents of your app's
 [ASAR archives](./asar-archives.md) at runtime.
 
 ## Version support
@@ -77,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
 ### Using Electron tooling
 
 Electron Forge and Electron Packager do this setup automatically for you with no additional
-configuration. The minimum required versions for ASAR integrity are:
+configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
 
 * `@electron/packager@18.3.1`
 * `@electron/forge@7.4.0`

docs/tutorial/automated-testing.md

@@ -74,46 +74,22 @@ describe('keyboard input', () => {
 Furthermore, WebdriverIO allows you to access Electron APIs to get static information about your application:
 
 ```js @ts-nocheck
-import { browser, $, expect } from '@wdio/globals'
+import { browser } from '@wdio/globals'
 
-describe('when the make smaller button is clicked', () => {
-  it('should decrease the window height and width by 10 pixels', async () => {
-    const boundsBefore = await browser.electron.browserWindow('getBounds')
-    expect(boundsBefore.width).toEqual(210)
-    expect(boundsBefore.height).toEqual(310)
-
-    await $('.make-smaller').click()
-    const boundsAfter = await browser.electron.browserWindow('getBounds')
-    expect(boundsAfter.width).toEqual(200)
-    expect(boundsAfter.height).toEqual(300)
-  })
-})
-```
-
-or to retrieve other Electron process information:
-
-```js @ts-nocheck
-import fs from 'node:fs'
-import path from 'node:path'
-
-import { browser, expect } from '@wdio/globals'
-
-const packageJson = JSON.parse(fs.readFileSync(path.join(__dirname, '..', 'package.json'), { encoding: 'utf-8' }))
-const { name, version } = packageJson
-
-describe('electron APIs', () => {
-  it('should retrieve app metadata through the electron API', async () => {
-    const appName = await browser.electron.app('getName')
-    expect(appName).toEqual(name)
-    const appVersion = await browser.electron.app('getVersion')
-    expect(appVersion).toEqual(version)
-  })
-
-  it('should pass args through to the launched application', async () => {
-    // custom args are set in the wdio.conf.js file as they need to be set before WDIO starts
-    const argv = await browser.electron.mainProcess('argv')
-    expect(argv).toContain('--foo')
-    expect(argv).toContain('--bar=baz')
+describe('trigger message modal', async () => {
+  it('message modal can be triggered from a test', async () => {
+    await browser.electron.execute(
+      (electron, param1, param2, param3) => {
+        const appWindow = electron.BrowserWindow.getFocusedWindow()
+        electron.dialog.showMessageBox(appWindow, {
+          message: 'Hello World!',
+          detail: `${param1} + ${param2} + ${param3} = ${param1 + param2 + param3}`
+        })
+      },
+      1,
+      2,
+      3
+    )
   })
 })
 ```
@@ -206,7 +182,7 @@ npm install --save-dev @playwright/test
 ```
 
 :::caution Dependencies
-This tutorial was written with `@playwright/test@1.41.1`. Check out
+This tutorial was written with `@playwright/test@1.52.0`. Check out
 [Playwright's releases][playwright-releases] page to learn about
 changes that might affect the code below.
 :::
@@ -218,10 +194,10 @@ To point this API to your Electron app, you can pass the path to your main proce
 entry point (here, it is `main.js`).
 
 ```js {5} @ts-nocheck
-const { test, _electron: electron } = require('@playwright/test')
+import { test, _electron as electron } from '@playwright/test'
 
 test('launch app', async () => {
-  const electronApp = await electron.launch({ args: ['main.js'] })
+  const electronApp = await electron.launch({ args: ['.'] })
   // close app
   await electronApp.close()
 })
@@ -231,10 +207,10 @@ After that, you will access to an instance of Playwright's `ElectronApp` class.
 is a powerful class that has access to main process modules for example:
 
 ```js {5-10} @ts-nocheck
-const { test, _electron: electron } = require('@playwright/test')
+import { test, _electron as electron } from '@playwright/test'
 
 test('get isPackaged', async () => {
-  const electronApp = await electron.launch({ args: ['main.js'] })
+  const electronApp = await electron.launch({ args: ['.'] })
   const isPackaged = await electronApp.evaluate(async ({ app }) => {
     // This runs in Electron's main process, parameter here is always
     // the result of the require('electron') in the main app script.
@@ -250,10 +226,10 @@ It can also create individual [Page][playwright-page] objects from Electron Brow
 For example, to grab the first BrowserWindow and save a screenshot:
 
 ```js {6-7} @ts-nocheck
-const { test, _electron: electron } = require('@playwright/test')
+import { test, _electron as electron } from '@playwright/test'
 
 test('save screenshot', async () => {
-  const electronApp = await electron.launch({ args: ['main.js'] })
+  const electronApp = await electron.launch({ args: ['.'] })
   const window = await electronApp.firstWindow()
   await window.screenshot({ path: 'intro.png' })
   // close app
@@ -265,7 +241,7 @@ Putting all this together using the Playwright test-runner, let's create a `exam
 test file with a single test and assertion:
 
 ```js title='example.spec.js' @ts-nocheck
-const { test, expect, _electron: electron } = require('@playwright/test')
+import { test, expect, _electron as electron } from '@playwright/test'
 
 test('example test', async () => {
   const electronApp = await electron.launch({ args: ['.'] })

docs/tutorial/electron-timelines.md

@@ -9,10 +9,11 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
 
 | Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
 | ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
-| 39.0.0 |  2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | TBD | ✅ |
+| 40.0.0 |  2025-Oct-30 | 2025-Dec-03 | 2025-Oct-28 | 2026-Jun-30 | M144 | TBD | ✅ |
+| 39.0.0 |  2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
 | 38.0.0 |  2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
 | 37.0.0 |  2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
-| 36.0.0 |  2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | ✅ |
+| 36.0.0 |  2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
 | 35.0.0 |  2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
 | 34.0.0 |  2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
 | 33.0.0 |  2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
@@ -121,22 +122,3 @@ and that number is reduced to two in major version 10, the three-argument versio
 continue to work until, at minimum, major version 12. Past the minimum two-version
 threshold, we will attempt to support backwards compatibility beyond two versions
 until the maintainers feel the maintenance burden is too high to continue doing so.
-
-### End-of-life
-
-When a release branch reaches the end of its support cycle, the series
-will be deprecated in NPM and a final end-of-support release will be
-made. This release will add a warning to inform that an unsupported
-version of Electron is in use.
-
-These steps are to help app developers learn when a branch they're
-using becomes unsupported, but without being excessively intrusive
-to end users.
-
-If an application has exceptional circumstances and needs to stay
-on an unsupported series of Electron, developers can silence the
-end-of-support warning by omitting the final release from the app's
-`package.json` `devDependencies`. For example, since the 1-6-x series
-ended with an end-of-support 1.6.18 release, developers could choose
-to stay in the 1-6-x series without warnings with `devDependency` of
-`"electron": 1.6.0 - 1.6.17`.

docs/tutorial/fuses.md

@@ -4,11 +4,24 @@
 
 ## What are fuses?
 
-For a subset of Electron functionality it makes sense to disable certain features for an entire application.  For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature.  We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
+From a security perspective, it makes sense to disable certain unused Electron features
+that are powerful but may make your app's security posture weaker. For example, any app that doesn't
+use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
+subset of "living off the land" attacks.
 
-Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions.  Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
+We also don't want Electron consumers forking to achieve this goal, as building from source and
+maintaining a fork is a massive technical challenge and costs a lot of time and money.
 
-## Current Fuses
+Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
+that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
+
+Because they are flipped at package time before you code sign your app, the OS becomes responsible
+for ensuring those bits aren't flipped back via OS-level code signing validation
+(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
+[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
+on Windows).
+
+## Current fuses
 
 ### `runAsNode`
 
@@ -16,7 +29,11 @@ Fuses are the solution to this problem, at a high level they are "magic bits" in
 
 **@electron/fuses:** `FuseV1Options.RunAsNode`
 
-The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not.  Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
+The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
+environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
+as expected, as it depends on this environment variable to function. Instead, we recommend that you
+use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
+standalone Node.js process (e.g. a SQLite server process).
 
 ### `cookieEncryption`
 
@@ -24,7 +41,12 @@ The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variab
 
 **@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
 
-The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys.  By default the sqlite database that Chromium uses to store cookies stores the values in plaintext.  If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse.  Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless.  Most apps can safely enable this fuse.
+The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
+cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
+values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
+does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
+fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
+later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
 
 ### `nodeOptions`
 
@@ -32,7 +54,11 @@ The cookieEncryption fuse toggles whether the cookie store on disk is encrypted
 
 **@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
 
-The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)  and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected.  The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production.  Most apps can safely disable this fuse.
+The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
+and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
+environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
+kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
+Most apps can safely disable this fuse.
 
 ### `nodeCliInspect`
 
@@ -40,7 +66,9 @@ The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api
 
 **@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
 
-The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not.  When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector.  Most apps can safely disable this fuse.
+The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
+or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
+inspector. Most apps can safely disable this fuse.
 
 ### `embeddedAsarIntegrityValidation`
 
@@ -48,9 +76,12 @@ The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. f
 
 **@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
 
-The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded.  This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
+The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
+content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
+performance impact but may marginally slow down file reads from inside the `app.asar` archive.
+Most apps can safely enable this fuse.
 
-For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
+For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
 
 ### `onlyLoadAppFromAsar`
 
@@ -58,7 +89,15 @@ For more information on how to use asar integrity validation please read the [As
 
 **@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
 
-The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code.  By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`.  When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
+The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
+By default, Electron will search for this code in the following order:
+
+1. `app.asar`
+1. `app`
+1. `default_app.asar`
+
+When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
+it is impossible to load non-validated code.
 
 ### `loadBrowserProcessSpecificV8Snapshot`
 
@@ -66,11 +105,17 @@ The onlyLoadAppFromAsar fuse changes the search system that Electron uses to loc
 
 **@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
 
-The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process.  By default Electron's processes will all use the same V8 snapshot file.  When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
+V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
+initialized heaps and then load them back in to avoid the cost of initializing the heap.
 
-V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
+The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
+process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
+enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
+Other processes will use the V8 snapshot file that they normally do.
 
-Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
+Using separate snapshots for renderer processes and the main process can improve security, especially
+to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
+See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
 
 ### `grantFileProtocolExtraPrivileges`
 
@@ -78,19 +123,25 @@ Using separate snapshots for renderer processes and the main process can improve
 
 **@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
 
-The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser.  This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.  If you aren't serving pages from `file://` you should disable this fuse.
+The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
+are given privileges beyond what they would receive in a traditional web browser. This behavior was
+core to Electron apps in original versions of Electron, but is no longer required as apps should be
+[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
+
+If you aren't serving pages from `file://`, you should disable this fuse.
 
 The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
 
 * `file://` protocol pages can use `fetch` to load other assets over `file://`
 * `file://` protocol pages can use service workers
-* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
+* `file://` protocol pages have universal access granted to child frames also running on `file://`
+  protocols regardless of sandbox settings
 
-## How do I flip the fuses?
+## How do I flip fuses?
 
 ### The easy way
 
-We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy.  Check out the README of that module for more details on usage and potential error cases.
+[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
 
 ```js @ts-nocheck
 const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -106,29 +157,37 @@ flipFuses(
 )
 ```
 
-You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
+You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
+app using the `@electron/fuses` CLI.
 
 ```bash
 npx @electron/fuses read --app /Applications/Foo.app
 ```
 
+>[!NOTE]
+> If you are using Electron Forge to distribute your application, you can flip fuses using
+> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
+> which comes pre-installed with all templates.
+
 ### The hard way
 
-#### Quick Glossary
+> [!IMPORTANT]
+> Glossary:
+>
+> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
+> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
+> * **Fuse Schema**: The format/allowed values for the fuse wire
 
-* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
-* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
-* **Fuse Schema**: The format / allowed values for the fuse wire
+Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
+sequence of bytes that represent the state of the fuses you want.
 
-Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
-
-Somewhere in the Electron binary there will be a sequence of bytes that look like this:
+Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
 
 ```text
 | ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
 ```
 
-* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
+* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
 * `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
 * `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
 * `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -136,6 +195,6 @@ Somewhere in the Electron binary there will be a sequence of bytes that look lik
   * "1" (0x31) indicates the fuse is enabled
   * "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
 
-To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
+To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
 
 You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

docs/tutorial/native-file-drag-drop.md

@@ -110,4 +110,10 @@ the item is a Markdown file located in the root of the project:
 
 ![Drag and drop](../images/drag-and-drop.gif)
 
+## Dragging files into your app
+
+You can use the standard
+[Drag and Drop web API](https://developer.mozilla.org/en-US/docs/Web/API/HTML_Drag_and_Drop_API)
+for dragging and dropping files into your app.
+
 [`contextBridge`]: ../api/context-bridge.md

docs/tutorial/security.md

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
 You should at least follow these steps to improve the security of your application:
 
 1. [Only load secure content](#1-only-load-secure-content)
-2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
+2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
 3. [Enable context isolation in all renderers](#3-enable-context-isolation)
 4. [Enable process sandboxing](#4-enable-process-sandboxing)
 5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -299,7 +299,7 @@ const { session } = require('electron')
 const { URL } = require('node:url')
 
 session
-  .fromPartition('some-partition')
+  .defaultSession
   .setPermissionRequestHandler((webContents, permission, callback) => {
     const parsedUrl = new URL(webContents.getURL())
 
@@ -316,6 +316,8 @@ session
   })
 ```
 
+Note: `session.defaultSession` is only available after `app.whenReady` is called.
+
 ### 6. Do not disable `webSecurity`
 
 :::info
@@ -406,6 +408,8 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
 })
 ```
 
+Note: `session.defaultSession` is only available after `app.whenReady` is called.
+
 #### CSP meta tag
 
 CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
@@ -818,10 +822,10 @@ that your application might have the rights for.
 
 #### How?
 
-We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
+[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
 flipping these fuses easy. Check out the README of that module for more details on usage and
 potential error cases, and refer to
-[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
+[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
 
 ### 20. Do not expose Electron APIs to untrusted web content
 

filenames.auto.gni

@@ -82,6 +82,7 @@ auto_filenames = {
     "docs/api/structures/browser-window-options.md",
     "docs/api/structures/certificate-principal.md",
     "docs/api/structures/certificate.md",
+    "docs/api/structures/color-space.md",
     "docs/api/structures/cookie.md",
     "docs/api/structures/cpu-usage.md",
     "docs/api/structures/crash-report.md",
@@ -143,6 +144,7 @@ auto_filenames = {
     "docs/api/structures/service-worker-info.md",
     "docs/api/structures/shared-dictionary-info.md",
     "docs/api/structures/shared-dictionary-usage-info.md",
+    "docs/api/structures/shared-texture-handle.md",
     "docs/api/structures/shared-worker-info.md",
     "docs/api/structures/sharing-item.md",
     "docs/api/structures/shortcut-details.md",

filenames.gni

@@ -629,8 +629,6 @@ filenames = {
     "shell/common/gin_converters/usb_device_info_converter.h",
     "shell/common/gin_converters/value_converter.cc",
     "shell/common/gin_converters/value_converter.h",
-    "shell/common/gin_helper/arguments.cc",
-    "shell/common/gin_helper/arguments.h",
     "shell/common/gin_helper/callback.cc",
     "shell/common/gin_helper/callback.h",
     "shell/common/gin_helper/cleaned_up_at_exit.cc",

filenames.libcxx.gni

@@ -217,6 +217,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__atomic/check_memory_order.h",
   "//third_party/libc++/src/include/__atomic/contention_t.h",
   "//third_party/libc++/src/include/__atomic/fence.h",
+  "//third_party/libc++/src/include/__atomic/floating_point_helper.h",
   "//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
   "//third_party/libc++/src/include/__atomic/kill_dependency.h",
   "//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -840,7 +841,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__cxx03/cmath",
   "//third_party/libc++/src/include/__cxx03/codecvt",
   "//third_party/libc++/src/include/__cxx03/complex",
-  "//third_party/libc++/src/include/__cxx03/complex.h",
   "//third_party/libc++/src/include/__cxx03/condition_variable",
   "//third_party/libc++/src/include/__cxx03/csetjmp",
   "//third_party/libc++/src/include/__cxx03/csignal",
@@ -853,25 +853,20 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__cxx03/cstring",
   "//third_party/libc++/src/include/__cxx03/ctgmath",
   "//third_party/libc++/src/include/__cxx03/ctime",
-  "//third_party/libc++/src/include/__cxx03/ctype.h",
   "//third_party/libc++/src/include/__cxx03/cuchar",
   "//third_party/libc++/src/include/__cxx03/cwchar",
   "//third_party/libc++/src/include/__cxx03/cwctype",
   "//third_party/libc++/src/include/__cxx03/deque",
-  "//third_party/libc++/src/include/__cxx03/errno.h",
   "//third_party/libc++/src/include/__cxx03/exception",
   "//third_party/libc++/src/include/__cxx03/experimental/__config",
   "//third_party/libc++/src/include/__cxx03/experimental/utility",
   "//third_party/libc++/src/include/__cxx03/ext/__hash",
   "//third_party/libc++/src/include/__cxx03/ext/hash_map",
   "//third_party/libc++/src/include/__cxx03/ext/hash_set",
-  "//third_party/libc++/src/include/__cxx03/fenv.h",
-  "//third_party/libc++/src/include/__cxx03/float.h",
   "//third_party/libc++/src/include/__cxx03/forward_list",
   "//third_party/libc++/src/include/__cxx03/fstream",
   "//third_party/libc++/src/include/__cxx03/functional",
   "//third_party/libc++/src/include/__cxx03/future",
-  "//third_party/libc++/src/include/__cxx03/inttypes.h",
   "//third_party/libc++/src/include/__cxx03/iomanip",
   "//third_party/libc++/src/include/__cxx03/ios",
   "//third_party/libc++/src/include/__cxx03/iosfwd",
@@ -898,11 +893,8 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__cxx03/sstream",
   "//third_party/libc++/src/include/__cxx03/stack",
   "//third_party/libc++/src/include/__cxx03/stdatomic.h",
-  "//third_party/libc++/src/include/__cxx03/stdbool.h",
-  "//third_party/libc++/src/include/__cxx03/stddef.h",
   "//third_party/libc++/src/include/__cxx03/stdexcept",
   "//third_party/libc++/src/include/__cxx03/stdint.h",
-  "//third_party/libc++/src/include/__cxx03/stdio.h",
   "//third_party/libc++/src/include/__cxx03/stdlib.h",
   "//third_party/libc++/src/include/__cxx03/streambuf",
   "//third_party/libc++/src/include/__cxx03/string",
@@ -910,7 +902,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__cxx03/string_view",
   "//third_party/libc++/src/include/__cxx03/strstream",
   "//third_party/libc++/src/include/__cxx03/system_error",
-  "//third_party/libc++/src/include/__cxx03/tgmath.h",
   "//third_party/libc++/src/include/__cxx03/thread",
   "//third_party/libc++/src/include/__cxx03/type_traits",
   "//third_party/libc++/src/include/__cxx03/typeindex",
@@ -923,7 +914,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__cxx03/vector",
   "//third_party/libc++/src/include/__cxx03/version",
   "//third_party/libc++/src/include/__cxx03/wchar.h",
-  "//third_party/libc++/src/include/__cxx03/wctype.h",
   "//third_party/libc++/src/include/__debug_utils/randomize_range.h",
   "//third_party/libc++/src/include/__debug_utils/sanitizers.h",
   "//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
@@ -1034,14 +1024,12 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__fwd/get.h",
   "//third_party/libc++/src/include/__fwd/ios.h",
   "//third_party/libc++/src/include/__fwd/istream.h",
-  "//third_party/libc++/src/include/__fwd/map.h",
   "//third_party/libc++/src/include/__fwd/mdspan.h",
   "//third_party/libc++/src/include/__fwd/memory.h",
   "//third_party/libc++/src/include/__fwd/memory_resource.h",
   "//third_party/libc++/src/include/__fwd/ostream.h",
   "//third_party/libc++/src/include/__fwd/pair.h",
   "//third_party/libc++/src/include/__fwd/queue.h",
-  "//third_party/libc++/src/include/__fwd/set.h",
   "//third_party/libc++/src/include/__fwd/span.h",
   "//third_party/libc++/src/include/__fwd/sstream.h",
   "//third_party/libc++/src/include/__fwd/stack.h",
@@ -1117,6 +1105,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__locale_dir/support/freebsd.h",
   "//third_party/libc++/src/include/__locale_dir/support/fuchsia.h",
   "//third_party/libc++/src/include/__locale_dir/support/linux.h",
+  "//third_party/libc++/src/include/__locale_dir/support/netbsd.h",
   "//third_party/libc++/src/include/__locale_dir/support/no_locale/characters.h",
   "//third_party/libc++/src/include/__locale_dir/support/no_locale/strtonum.h",
   "//third_party/libc++/src/include/__locale_dir/support/windows.h",
@@ -1367,11 +1356,9 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__tree",
   "//third_party/libc++/src/include/__tuple/find_index.h",
   "//third_party/libc++/src/include/__tuple/ignore.h",
-  "//third_party/libc++/src/include/__tuple/make_tuple_types.h",
   "//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
   "//third_party/libc++/src/include/__tuple/tuple_element.h",
   "//third_party/libc++/src/include/__tuple/tuple_like.h",
-  "//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
   "//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
   "//third_party/libc++/src/include/__tuple/tuple_size.h",
   "//third_party/libc++/src/include/__tuple/tuple_types.h",
@@ -1381,7 +1368,6 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__type_traits/aligned_storage.h",
   "//third_party/libc++/src/include/__type_traits/aligned_union.h",
   "//third_party/libc++/src/include/__type_traits/alignment_of.h",
-  "//third_party/libc++/src/include/__type_traits/can_extract_key.h",
   "//third_party/libc++/src/include/__type_traits/common_reference.h",
   "//third_party/libc++/src/include/__type_traits/common_type.h",
   "//third_party/libc++/src/include/__type_traits/conditional.h",
@@ -1429,6 +1415,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__type_traits/is_floating_point.h",
   "//third_party/libc++/src/include/__type_traits/is_function.h",
   "//third_party/libc++/src/include/__type_traits/is_fundamental.h",
+  "//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
   "//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
   "//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
   "//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1462,6 +1449,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__type_traits/is_trivially_relocatable.h",
   "//third_party/libc++/src/include/__type_traits/is_unbounded_array.h",
   "//third_party/libc++/src/include/__type_traits/is_union.h",
+  "//third_party/libc++/src/include/__type_traits/is_unqualified.h",
   "//third_party/libc++/src/include/__type_traits/is_unsigned.h",
   "//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
   "//third_party/libc++/src/include/__type_traits/is_void.h",
@@ -1470,6 +1458,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
   "//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
   "//third_party/libc++/src/include/__type_traits/make_signed.h",
+  "//third_party/libc++/src/include/__type_traits/make_transparent.h",
   "//third_party/libc++/src/include/__type_traits/make_unsigned.h",
   "//third_party/libc++/src/include/__type_traits/maybe_const.h",
   "//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1501,6 +1490,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__utility/cmp.h",
   "//third_party/libc++/src/include/__utility/convert_to_integral.h",
   "//third_party/libc++/src/include/__utility/declval.h",
+  "//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
   "//third_party/libc++/src/include/__utility/element_count.h",
   "//third_party/libc++/src/include/__utility/empty.h",
   "//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1511,6 +1501,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__utility/integer_sequence.h",
   "//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
   "//third_party/libc++/src/include/__utility/is_valid_range.h",
+  "//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
   "//third_party/libc++/src/include/__utility/move.h",
   "//third_party/libc++/src/include/__utility/no_destroy.h",
   "//third_party/libc++/src/include/__utility/pair.h",
@@ -1522,6 +1513,7 @@ libcxx_headers = [
   "//third_party/libc++/src/include/__utility/small_buffer.h",
   "//third_party/libc++/src/include/__utility/swap.h",
   "//third_party/libc++/src/include/__utility/to_underlying.h",
+  "//third_party/libc++/src/include/__utility/try_key_extraction.h",
   "//third_party/libc++/src/include/__utility/unreachable.h",
   "//third_party/libc++/src/include/__variant/monostate.h",
   "//third_party/libc++/src/include/__vector/comparison.h",

lib/browser/api/app.ts

@@ -1,11 +1,14 @@
 import { Menu } from 'electron/main';
 
+import { EventEmitter } from 'events';
 import * as fs from 'fs';
 
 const bindings = process._linkedBinding('electron_browser_app');
 const commandLine = process._linkedBinding('electron_common_command_line');
 const { app } = bindings;
 
+Object.setPrototypeOf(app, EventEmitter.prototype);
+
 // Only one app object permitted.
 export default app;
 

lib/browser/api/menu.ts

@@ -46,11 +46,11 @@ Menu.prototype._isCommandIdEnabled = function (id) {
 };
 
 Menu.prototype._shouldCommandIdWorkWhenHidden = function (id) {
-  return this.commandsMap[id] ? !!this.commandsMap[id].acceleratorWorksWhenHidden : false;
+  return this.commandsMap[id]?.acceleratorWorksWhenHidden ?? false;
 };
 
 Menu.prototype._isCommandIdVisible = function (id) {
-  return this.commandsMap[id] ? this.commandsMap[id].visible : false;
+  return this.commandsMap[id]?.visible ?? false;
 };
 
 Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator) {
@@ -61,12 +61,12 @@ Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator
 };
 
 Menu.prototype._shouldRegisterAcceleratorForCommandId = function (id) {
-  return this.commandsMap[id] ? this.commandsMap[id].registerAccelerator : false;
+  return this.commandsMap[id]?.registerAccelerator ?? false;
 };
 
 if (process.platform === 'darwin') {
   Menu.prototype._getSharingItemForCommandId = function (id) {
-    return this.commandsMap[id] ? this.commandsMap[id].sharingItem : null;
+    return this.commandsMap[id]?.sharingItem ?? null;
   };
 }
 

lib/browser/api/web-contents.ts

@@ -882,7 +882,7 @@ export function create (options = {}): Electron.WebContents {
   return new (WebContents as any)(options);
 }
 
-export function fromId (id: string) {
+export function fromId (id: number) {
   return binding.fromId(id);
 }
 

lib/browser/parse-features-string.ts

@@ -91,6 +91,12 @@ export function parseFeatures (features: string) {
     delete parsed[key];
   }
 
+  // Per spec - https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev
+  // windows are always resizable.
+  if (parsed.resizable !== undefined) {
+    delete parsed.resizable;
+  }
+
   if (parsed.left !== undefined) parsed.x = parsed.left;
   if (parsed.top !== undefined) parsed.y = parsed.top;
 

lib/common/api/net-client-request.ts

@@ -289,8 +289,7 @@ function parseOptions (optionsIn: ClientRequestConstructorOptions | string): Nod
     referrerPolicy: options.referrerPolicy,
     cache: options.cache,
     allowNonHttpProtocols: Object.hasOwn(options, kAllowNonHttpProtocols),
-    priority: options.priority,
-    bypassCustomProtocolHandlers: options.bypassCustomProtocolHandlers
+    priority: options.priority
   };
   if ('priorityIncremental' in options) {
     urlLoaderOptions.priorityIncremental = options.priorityIncremental;
@@ -428,9 +427,8 @@ export class ClientRequest extends Writable implements Electron.ClientRequest {
     this._started = true;
     const stringifyValues = (obj: Record<string, { name: string, value: string | string[] }>) => {
       const ret: Record<string, string> = {};
-      for (const k of Object.keys(obj)) {
-        const kv = obj[k];
-        ret[kv.name] = kv.value.toString();
+      for (const { name, value } of Object.values(obj)) {
+        ret[name] = value.toString();
       }
       return ret;
     };

lib/node/asar-fs-wrapper.ts

@@ -746,7 +746,7 @@ export const wrapFsWithAsar = (fs: Record<string, any>) => {
 
       context.readdirResults.push(dirent);
       if (dirent!.isDirectory() || stat === 1) {
-        context.pathsQueue.push(path.join(dirent!.path, dirent!.name));
+        context.pathsQueue.push(path.join(dirent!.parentPath, dirent!.name));
       }
     }
   }

npm/cli.js

@@ -5,7 +5,9 @@ const proc = require('child_process');
 const electron = require('./');
 
 const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
+let childClosed = false;
 child.on('close', function (code, signal) {
+  childClosed = true;
   if (code === null) {
     console.error(electron, 'exited with signal', signal);
     process.exit(1);
@@ -15,7 +17,7 @@ child.on('close', function (code, signal) {
 
 const handleTerminationSignal = function (signal) {
   process.on(signal, function signalHandler () {
-    if (!child.killed) {
+    if (!childClosed) {
       child.kill(signal);
     }
   });
@@ -23,3 +25,4 @@ const handleTerminationSignal = function (signal) {
 
 handleTerminationSignal('SIGINT');
 handleTerminationSignal('SIGTERM');
+handleTerminationSignal('SIGUSR2');

npm/package.json

@@ -9,7 +9,7 @@
   },
   "dependencies": {
     "@electron/get": "^2.0.0",
-    "@types/node": "^22.7.7",
+    "@types/node": "^24.9.0",
     "extract-zip": "^2.0.1"
   },
   "engines": {

package.json

@@ -1,23 +1,22 @@
 {
-  "name": "@electron-ci/dev-root",
+  "name": "electron",
   "version": "0.0.0-development",
   "repository": "https://github.com/electron/electron",
   "description": "Build cross platform desktop apps with JavaScript, HTML, and CSS",
   "devDependencies": {
-    "@azure/storage-blob": "^12.25.0",
-    "@datadog/datadog-ci": "^4.1.2",
+    "@azure/storage-blob": "^12.28.0",
     "@electron/asar": "^3.2.13",
     "@electron/docs-parser": "^2.0.0",
     "@electron/fiddle-core": "^1.3.4",
-    "@electron/github-app-auth": "^3.2.0",
-    "@electron/lint-roller": "^3.1.1",
-    "@electron/typescript-definitions": "^9.1.2",
-    "@octokit/rest": "^20.0.2",
+    "@electron/github-app-auth": "^2.2.1",
+    "@electron/lint-roller": "^3.1.2",
+    "@electron/typescript-definitions": "^9.1.5",
+    "@octokit/rest": "^20.1.2",
     "@primer/octicons": "^10.0.0",
     "@types/minimist": "^1.2.5",
-    "@types/node": "^22.7.7",
+    "@types/node": "^24.9.0",
     "@types/semver": "^7.5.8",
-    "@types/stream-json": "^1.7.7",
+    "@types/stream-json": "^1.7.8",
     "@types/temp": "^0.9.4",
     "@typescript-eslint/eslint-plugin": "^8.32.1",
     "@typescript-eslint/parser": "^8.7.0",
@@ -25,6 +24,7 @@
     "buffer": "^6.0.3",
     "chalk": "^4.1.0",
     "check-for-leaks": "^1.2.1",
+    "dugite": "^2.7.1",
     "eslint": "^8.57.1",
     "eslint-config-standard": "^17.1.0",
     "eslint-plugin-import": "^2.32.0",
@@ -34,29 +34,28 @@
     "eslint-plugin-node": "^11.1.0",
     "eslint-plugin-promise": "^6.6.0",
     "events": "^3.2.0",
-    "folder-hash": "^2.1.1",
+    "folder-hash": "^4.1.1",
     "got": "^11.8.5",
     "husky": "^9.1.7",
     "lint-staged": "^16.1.0",
     "markdownlint-cli2": "^0.18.0",
     "minimist": "^1.2.8",
-    "node-gyp": "^11.4.2",
     "null-loader": "^4.0.1",
     "pre-flight": "^2.0.0",
     "process": "^0.11.10",
     "remark-cli": "^12.0.1",
-    "remark-preset-lint-markdown-style-guide": "^4.0.0",
+    "remark-preset-lint-markdown-style-guide": "^6.0.1",
     "semver": "^7.6.3",
-    "stream-json": "^1.8.0",
+    "stream-json": "^1.9.1",
     "tap-xunit": "^2.4.1",
     "temp": "^0.9.4",
     "timers-browserify": "1.4.2",
     "ts-loader": "^8.0.2",
     "ts-node": "6.2.0",
-    "typescript": "^5.6.2",
+    "typescript": "^5.8.3",
     "url": "^0.11.4",
     "webpack": "^5.95.0",
-    "webpack-cli": "^5.1.4",
+    "webpack-cli": "^6.0.1",
     "wrapper-webpack-plugin": "^2.2.0"
   },
   "private": true,
@@ -135,18 +134,6 @@
     ]
   },
   "resolutions": {
-    "dbus-native/xml2js": "0.5.0",
-    "abstract-socket": "github:deepak1556/node-abstractsocket#928cc591decd12aff7dad96449da8afc29832c19",
-    "minimist@npm:~0.0.1": "0.2.4"
-  },
-  "packageManager": "yarn@4.12.0",
-  "workspaces": [
-    "spec",
-    "spec/fixtures/native-addon/*"
-  ],
-  "dependenciesMeta": {
-    "abstract-socket": {
-      "built": true
-    }
+    "nan": "nodejs/nan#e14bdcd1f72d62bca1d541b66da43130384ec213"
   }
 }

patches/angle/.patches

@@ -1 +0,0 @@
-cherry-pick-2f564f1ca07b.patch

patches/angle/cherry-pick-2f564f1ca07b.patch

@@ -1,125 +0,0 @@
-From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
-From: Mark Mentovai <mark@chromium.org>
-Date: Tue, 16 Sep 2025 16:46:36 -0400
-Subject: mac: handle Metal toolchain being unbundled from Xcode 26
-MIME-Version: 1.0
-Content-Type: text/plain; charset=UTF-8
-Content-Transfer-Encoding: 8bit
-
-The Metal toolchain was formerly part of Xcode, but in Xcode 26, it has
-been unbundled and is now a separate install. Attempting to use the
-Metal toolchain without installing it results in a build error, such as:
-
-error: error: cannot execute tool 'metal' due to missing Metal
-Toolchain; use: xcodebuild -downloadComponent MetalToolchain
-
-By running the suggested command, the Metal toolchain can be installed,
-but the existing angle build does not know how to find it correctly.
-
-For system Xcode installations, tools from the Metal toolchain (`metal`
-and `metallib`) can be run via `xcrun`. This construct should work
-equally well for older Xcode versions, for situations where it’s still
-in use.
-
-For the hermetic toolchain, we’ll continue splicing the Metal toolchain
-into the location it had previously been avialable (see
-https://chromium-review.googlesource.com/c/6950738), although this is
-subject to change in the future.
-
-Bug: chromium:423933062, chromium:445400016
-Change-Id: I139eca51938f7cecfec9b90fd488947160ef4ec9
-Reviewed-on: https://chromium-review.googlesource.com/c/angle/angle/+/6955000
-Auto-Submit: Mark Mentovai <mark@chromium.org>
-Commit-Queue: Mark Mentovai <mark@chromium.org>
-Reviewed-by: Geoff Lang <geofflang@chromium.org>
-
-diff --git a/src/libANGLE/renderer/metal/BUILD.gn b/src/libANGLE/renderer/metal/BUILD.gn
-index 96e9ee8420810f6a3ca9a0c290d4a654200eb7b9..50ac42a5b9a0f7c8b3b161af40c598cb34ff132a 100644
---- a/src/libANGLE/renderer/metal/BUILD.gn
-+++ b/src/libANGLE/renderer/metal/BUILD.gn
-@@ -24,20 +24,56 @@ config("angle_metal_backend_config") {
- }
- 
- if (metal_internal_shader_compilation_supported) {
-+  template("run_metal_tool") {
-+    action(target_name) {
-+      forward_variables_from(invoker,
-+                             [
-+                               "deps",
-+                               "sources",
-+                               "outputs",
-+                               "metal_tool",
-+                             ])
-+      script = "shaders/metal_wrapper.py"
-+      if (use_system_xcode) {
-+        # System Xcode: run metal and metallib via xcrun. Since Xcode 26.0, the
-+        # Metal toolchain has been unbundled from Xcode, and must be installed
-+        # separately by running `xcodebuild -downloadComponent MetalToolchain`.
-+        # There is a vestigial metal executable in mac_bin_path, but it’s
-+        # incapable of running successfuly without the
-+        # rest of the Metal toolchain surrounding it. `xcrun` is able to find
-+        # and run the correct Metal toolchain when properly installed.
-+        #
-+        # If you’re using system Xcode and your build fails with this message:
-+        #   error: error: cannot execute tool 'metal' due to missing Metal Toolchain; use: xcodebuild -downloadComponent MetalToolchain
-+        # then do what the error message suggests, and then retry your build.
-+        args = [
-+          "xcrun",
-+          metal_tool,
-+        ]
-+      } else {
-+        # Hermetic Xcode: at least for now, the Metal toolchain is
-+        # “spliced” into the location in the hermetic toolchain where it lived
-+        # before Xcode 26.0, so it can be run directly from there.
-+        args = [ mac_bin_path + metal_tool ]
-+      }
-+
-+      args += invoker.args
-+    }
-+  }
-+
-   _metal_internal_shaders_air_file =
-       "$root_gen_dir/angle/mtl_internal_shaders_autogen.air"
- 
--  action("angle_metal_internal_shaders_to_air") {
--    script = "shaders/metal_wrapper.py"
--
--    outputs = [ _metal_internal_shaders_air_file ]
--
-+  run_metal_tool("angle_metal_internal_shaders_to_air") {
-     _metal_internal_shaders_metal_source =
-         "shaders/mtl_internal_shaders_autogen.metal"
-     sources = [ _metal_internal_shaders_metal_source ]
- 
-+    outputs = [ _metal_internal_shaders_air_file ]
-+
-+    metal_tool = "metal"
-+
-     args = [
--      mac_bin_path + "metal",
-       "-c",
-       rebase_path(_metal_internal_shaders_metal_source, root_build_dir),
-       "-o",
-@@ -60,17 +96,16 @@ if (metal_internal_shader_compilation_supported) {
-   _metal_internal_shaders_metallib_file =
-       "$root_gen_dir/angle/mtl_internal_shaders_autogen.metallib"
- 
--  action("angle_metal_internal_shaders_to_mtllib") {
--    script = "shaders/metal_wrapper.py"
--
--    outputs = [ _metal_internal_shaders_metallib_file ]
-+  run_metal_tool("angle_metal_internal_shaders_to_mtllib") {
-+    deps = [ ":angle_metal_internal_shaders_to_air" ]
- 
-     sources = [ _metal_internal_shaders_air_file ]
- 
--    deps = [ ":angle_metal_internal_shaders_to_air" ]
-+    outputs = [ _metal_internal_shaders_metallib_file ]
-+
-+    metal_tool = "metallib"
- 
-     args = [
--      mac_bin_path + "metallib",
-       rebase_path(_metal_internal_shaders_air_file, root_build_dir),
-       "-o",
-       rebase_path(_metal_internal_shaders_metallib_file, root_build_dir),

patches/boringssl/expose_ripemd160.patch

@@ -10,10 +10,10 @@ this patch is required to provide ripemd160 support in the nodejs crypto
 module.
 
 diff --git a/crypto/digest/digest_extra.cc b/crypto/digest/digest_extra.cc
-index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d27388be99 100644
+index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47b9e3034f 100644
 --- a/crypto/digest/digest_extra.cc
 +++ b/crypto/digest/digest_extra.cc
-@@ -46,6 +46,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
+@@ -47,6 +47,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
      {NID_sha512, EVP_sha512, SN_sha512, LN_sha512},
      {NID_sha512_256, EVP_sha512_256, SN_sha512_256, LN_sha512_256},
      {NID_md5_sha1, EVP_md5_sha1, SN_md5_sha1, LN_md5_sha1},
@@ -22,7 +22,7 @@ index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d2
      // hash function when given a signature OID. To avoid unintended lax parsing
      // of hash OIDs, this is no longer supported for lookup by OID or NID.
 diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
-index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
+index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
 --- a/crypto/fipsmodule/digest/digests.cc.inc
 +++ b/crypto/fipsmodule/digest/digests.cc.inc
 @@ -18,6 +18,7 @@
@@ -62,27 +62,27 @@ index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d2
 +
  #undef CHECK
 diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
-index e04b80cd6a1a215fc87f8fd8d750c3d258c3974f..8fdf1c624794f568bfc77b7b6b0c510b23905a4d 100644
+index feaf17c72cecb8099bc11ac10747fbad719ddca9..891a73f229e3f0838cb2fa99b8fb24fdeac1962b 100644
 --- a/decrepit/evp/evp_do_all.cc
 +++ b/decrepit/evp/evp_do_all.cc
 @@ -79,6 +79,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
-   callback(EVP_sha384(), "SHA384", NULL, arg);
-   callback(EVP_sha512(), "SHA512", NULL, arg);
-   callback(EVP_sha512_256(), "SHA512-256", NULL, arg);
-+  callback(EVP_ripemd160(), "ripemd160", NULL, arg);
+   callback(EVP_sha384(), "SHA384", nullptr, arg);
+   callback(EVP_sha512(), "SHA512", nullptr, arg);
+   callback(EVP_sha512_256(), "SHA512-256", nullptr, arg);
++  callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
  
-   callback(EVP_md4(), "md4", NULL, arg);
-   callback(EVP_md5(), "md5", NULL, arg);
+   callback(EVP_md4(), "md4", nullptr, arg);
+   callback(EVP_md5(), "md5", nullptr, arg);
 @@ -88,6 +89,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
-   callback(EVP_sha384(), "sha384", NULL, arg);
-   callback(EVP_sha512(), "sha512", NULL, arg);
-   callback(EVP_sha512_256(), "sha512-256", NULL, arg);
-+  callback(EVP_ripemd160(), "ripemd160", NULL, arg);
+   callback(EVP_sha384(), "sha384", nullptr, arg);
+   callback(EVP_sha512(), "sha512", nullptr, arg);
+   callback(EVP_sha512_256(), "sha512-256", nullptr, arg);
++  callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
  }
  
  void EVP_MD_do_all(void (*callback)(const EVP_MD *cipher, const char *name,
 diff --git a/include/openssl/digest.h b/include/openssl/digest.h
-index 710c6e6d110378d1db10d8c2ae57b2d844c603b9..dbb1e0cd5e9480d1ac7a86cbca6fae29d6a8dca4 100644
+index a86c18926e7798a3b0aae70c53870e03b5acd0ab..f4f27f9e803533d8db50d89e7a0125384a025a46 100644
 --- a/include/openssl/digest.h
 +++ b/include/openssl/digest.h
 @@ -48,6 +48,9 @@ OPENSSL_EXPORT const EVP_MD *EVP_blake2b256(void);

patches/boringssl/feat_expose_several_extra_cipher_functions.patch

@@ -28,7 +28,7 @@ RC2 Ciphers: rc2-40-cbc
 It's unclear whether this would be accepted upstream. We should try regardless.
 
 diff --git a/crypto/cipher/get_cipher.cc b/crypto/cipher/get_cipher.cc
-index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f825851b634 100644
+index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da0229687f 100644
 --- a/crypto/cipher/get_cipher.cc
 +++ b/crypto/cipher/get_cipher.cc
 @@ -31,6 +31,7 @@ static const struct {
@@ -64,64 +64,64 @@ index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f82
  
  const EVP_CIPHER *EVP_get_cipherbynid(int nid) {
 diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
-index 8fdf1c624794f568bfc77b7b6b0c510b23905a4d..2e40c031e8c681fe921331b26dbf63f4df2fcf71 100644
+index 891a73f229e3f0838cb2fa99b8fb24fdeac1962b..f7d0c5dc66f016eb9338c15e7f5ef59e6de2969d 100644
 --- a/decrepit/evp/evp_do_all.cc
 +++ b/decrepit/evp/evp_do_all.cc
 @@ -20,8 +20,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
                                                 const char *unused, void *arg),
                                void *arg) {
-   callback(EVP_aes_128_cbc(), "AES-128-CBC", NULL, arg);
-+  callback(EVP_aes_128_cfb128(), "AES-128-CFB", NULL, arg);
-   callback(EVP_aes_192_cbc(), "AES-192-CBC", NULL, arg);
-   callback(EVP_aes_256_cbc(), "AES-256-CBC", NULL, arg);
-+  callback(EVP_aes_256_cfb128(), "AES-256-CFB", NULL, arg);
-   callback(EVP_aes_128_ctr(), "AES-128-CTR", NULL, arg);
-   callback(EVP_aes_192_ctr(), "AES-192-CTR", NULL, arg);
-   callback(EVP_aes_256_ctr(), "AES-256-CTR", NULL, arg);
+   callback(EVP_aes_128_cbc(), "AES-128-CBC", nullptr, arg);
++  callback(EVP_aes_128_cfb128(), "AES-128-CFB", nullptr, arg);
+   callback(EVP_aes_192_cbc(), "AES-192-CBC", nullptr, arg);
+   callback(EVP_aes_256_cbc(), "AES-256-CBC", nullptr, arg);
++  callback(EVP_aes_256_cfb128(), "AES-256-CFB", nullptr, arg);
+   callback(EVP_aes_128_ctr(), "AES-128-CTR", nullptr, arg);
+   callback(EVP_aes_192_ctr(), "AES-192-CTR", nullptr, arg);
+   callback(EVP_aes_256_ctr(), "AES-256-CTR", nullptr, arg);
 @@ -34,9 +36,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
-   callback(EVP_aes_128_gcm(), "AES-128-GCM", NULL, arg);
-   callback(EVP_aes_192_gcm(), "AES-192-GCM", NULL, arg);
-   callback(EVP_aes_256_gcm(), "AES-256-GCM", NULL, arg);
-+  callback(EVP_bf_cbc(), "BF-CBC", NULL, arg);
-+  callback(EVP_bf_cfb(), "BF-CFB", NULL, arg);
-+  callback(EVP_bf_ecb(), "BF-ECB", NULL, arg);
-   callback(EVP_des_cbc(), "DES-CBC", NULL, arg);
-   callback(EVP_des_ecb(), "DES-ECB", NULL, arg);
-   callback(EVP_des_ede(), "DES-EDE", NULL, arg);
-+  callback(EVP_des_ede3(), "DES-EDE3", NULL, arg);
-   callback(EVP_des_ede_cbc(), "DES-EDE-CBC", NULL, arg);
-   callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", NULL, arg);
-   callback(EVP_rc2_cbc(), "RC2-CBC", NULL, arg);
+   callback(EVP_aes_128_gcm(), "AES-128-GCM", nullptr, arg);
+   callback(EVP_aes_192_gcm(), "AES-192-GCM", nullptr, arg);
+   callback(EVP_aes_256_gcm(), "AES-256-GCM", nullptr, arg);
++  callback(EVP_bf_cbc(), "BF-CBC", nullptr, arg);
++  callback(EVP_bf_cfb(), "BF-CFB", nullptr, arg);
++  callback(EVP_bf_ecb(), "BF-ECB", nullptr, arg);
+   callback(EVP_des_cbc(), "DES-CBC", nullptr, arg);
+   callback(EVP_des_ecb(), "DES-ECB", nullptr, arg);
+   callback(EVP_des_ede(), "DES-EDE", nullptr, arg);
++  callback(EVP_des_ede3(), "DES-EDE3", nullptr, arg);
+   callback(EVP_des_ede_cbc(), "DES-EDE-CBC", nullptr, arg);
+   callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", nullptr, arg);
+   callback(EVP_rc2_cbc(), "RC2-CBC", nullptr, arg);
 @@ -44,8 +50,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
  
    // OpenSSL returns everything twice, the second time in lower case.
-   callback(EVP_aes_128_cbc(), "aes-128-cbc", NULL, arg);
-+  callback(EVP_aes_128_cfb128(), "aes-128-cfb", NULL, arg);
-   callback(EVP_aes_192_cbc(), "aes-192-cbc", NULL, arg);
-   callback(EVP_aes_256_cbc(), "aes-256-cbc", NULL, arg);
-+  callback(EVP_aes_256_cfb128(), "aes-256-cfb", NULL, arg);
-   callback(EVP_aes_128_ctr(), "aes-128-ctr", NULL, arg);
-   callback(EVP_aes_192_ctr(), "aes-192-ctr", NULL, arg);
-   callback(EVP_aes_256_ctr(), "aes-256-ctr", NULL, arg);
+   callback(EVP_aes_128_cbc(), "aes-128-cbc", nullptr, arg);
++  callback(EVP_aes_128_cfb128(), "aes-128-cfb", nullptr, arg);
+   callback(EVP_aes_192_cbc(), "aes-192-cbc", nullptr, arg);
+   callback(EVP_aes_256_cbc(), "aes-256-cbc", nullptr, arg);
++  callback(EVP_aes_256_cfb128(), "aes-256-cfb", nullptr, arg);
+   callback(EVP_aes_128_ctr(), "aes-128-ctr", nullptr, arg);
+   callback(EVP_aes_192_ctr(), "aes-192-ctr", nullptr, arg);
+   callback(EVP_aes_256_ctr(), "aes-256-ctr", nullptr, arg);
 @@ -58,9 +66,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
-   callback(EVP_aes_128_gcm(), "aes-128-gcm", NULL, arg);
-   callback(EVP_aes_192_gcm(), "aes-192-gcm", NULL, arg);
-   callback(EVP_aes_256_gcm(), "aes-256-gcm", NULL, arg);
-+  callback(EVP_bf_cbc(), "bf-cbc", NULL, arg);
-+  callback(EVP_bf_cfb(), "bf-cfb", NULL, arg);
-+  callback(EVP_bf_ecb(), "bf-ecb", NULL, arg);
-   callback(EVP_des_cbc(), "des-cbc", NULL, arg);
-   callback(EVP_des_ecb(), "des-ecb", NULL, arg);
-   callback(EVP_des_ede(), "des-ede", NULL, arg);
-+  callback(EVP_des_ede3(), "des-ede3", NULL, arg);
-   callback(EVP_des_ede_cbc(), "des-ede-cbc", NULL, arg);
-   callback(EVP_des_ede3_cbc(), "des-ede3-cbc", NULL, arg);
-   callback(EVP_rc2_cbc(), "rc2-cbc", NULL, arg);
+   callback(EVP_aes_128_gcm(), "aes-128-gcm", nullptr, arg);
+   callback(EVP_aes_192_gcm(), "aes-192-gcm", nullptr, arg);
+   callback(EVP_aes_256_gcm(), "aes-256-gcm", nullptr, arg);
++  callback(EVP_bf_cbc(), "bf-cbc", nullptr, arg);
++  callback(EVP_bf_cfb(), "bf-cfb", nullptr, arg);
++  callback(EVP_bf_ecb(), "bf-ecb", nullptr, arg);
+   callback(EVP_des_cbc(), "des-cbc", nullptr, arg);
+   callback(EVP_des_ecb(), "des-ecb", nullptr, arg);
+   callback(EVP_des_ede(), "des-ede", nullptr, arg);
++  callback(EVP_des_ede3(), "des-ede3", nullptr, arg);
+   callback(EVP_des_ede_cbc(), "des-ede-cbc", nullptr, arg);
+   callback(EVP_des_ede3_cbc(), "des-ede3-cbc", nullptr, arg);
+   callback(EVP_rc2_cbc(), "rc2-cbc", nullptr, arg);
 diff --git a/include/openssl/cipher.h b/include/openssl/cipher.h
-index 13e68ad20ac08a462bb577d7f99e2c6f167579fa..4960d0eeb8f31bec4347ed2a1b63beba530de700 100644
+index a5533caf45eaacc4baef4a73d97e9bc2b6e3a942..35f24c1b22ea2c6b4766c0d87e75b6fc6b459f79 100644
 --- a/include/openssl/cipher.h
 +++ b/include/openssl/cipher.h
-@@ -448,6 +448,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
+@@ -461,6 +461,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
  
  // EVP_aes_128_cfb128 is only available in decrepit.
  OPENSSL_EXPORT const EVP_CIPHER *EVP_aes_128_cfb128(void);

patches/boringssl/revert_track_ssl_error_zero_return_explicitly.patch

@@ -8,7 +8,7 @@ This reverts commit ebd8b8965c74ab06bb91f7a00b23822e1f1f26ca.
 It is causing significant TLS failures in Node.js.
 
 diff --git a/ssl/ssl_buffer.cc b/ssl/ssl_buffer.cc
-index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a02124b80f9ef 100644
+index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad1655500d33 100644
 --- a/ssl/ssl_buffer.cc
 +++ b/ssl/ssl_buffer.cc
 @@ -230,7 +230,6 @@ int ssl_handle_open_record(SSL *ssl, bool *out_retry, ssl_open_record_t ret,
@@ -20,10 +20,10 @@ index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a0212
  
      case ssl_open_record_error:
 diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
-index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f8431434e42 100644
+index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e517ea6ae2 100644
 --- a/ssl/ssl_lib.cc
 +++ b/ssl/ssl_lib.cc
-@@ -1206,7 +1206,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
+@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
    }
  
    if (ret_code == 0) {
@@ -32,7 +32,7 @@ index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f84
        return SSL_ERROR_ZERO_RETURN;
      }
      // An EOF was observed which violates the protocol, and the underlying
-@@ -2567,13 +2567,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
+@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
    return CRYPTO_get_ex_data(&ctx->ex_data, idx);
  }
  

patches/chromium/.patches

@@ -110,7 +110,6 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
 fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
 refactor_expose_file_system_access_blocklist.patch
 feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
-fix_font_face_resolution_when_renderer_is_blocked.patch
 feat_enable_passing_exit_code_on_service_process_crash.patch
 chore_remove_reference_to_chrome_browser_themes.patch
 feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
@@ -132,11 +131,16 @@ chore_grandfather_in_electron_views_and_delegates.patch
 refactor_patch_electron_permissiontypes_into_blink.patch
 revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
 build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
-build_set_mac_sdk_minimum_to_10.patch
 fix_add_macos_memory_query_fallback_to_avoid_crash.patch
 fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
 feat_add_support_for_embedder_snapshot_validation.patch
-band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch
-inspectorpageagent_provisional_frame_speculative_fix.patch
+chore_restore_some_deprecated_wrapper_utility_in_gin.patch
+chore_add_electron_objects_to_wrappablepointertag.patch
+chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
+revert_partial_remove_unused_prehandlemouseevent.patch
+allow_electron_to_depend_on_components_os_crypt_sync.patch
 expose_referrerscriptinfo_hostdefinedoptionsindex.patch
-fix_release_mouse_buttons_on_focus_loss_on_wayland.patch
+chore_disable_protocol_handler_dcheck.patch
+fix_check_for_file_existence_before_setting_mtime.patch
+revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch
+fix_linux_tray_id.patch

patches/chromium/accelerator.patch

@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
    }
  
 diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
-index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
+index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
 --- a/ui/base/accelerators/accelerator.h
 +++ b/ui/base/accelerators/accelerator.h
-@@ -18,6 +18,7 @@
- #include <vector>
- 
- #include "base/component_export.h"
-+#include "third_party/abseil-cpp/absl/types/optional.h"
+@@ -21,6 +21,7 @@
  #include "base/time/time.h"
  #include "build/blink_buildflags.h"
  #include "build/build_config.h"
-@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
-     return interrupted_by_mouse_event_;
++#include "third_party/abseil-cpp/absl/types/optional.h"
+ #include "ui/events/event_constants.h"
+ #include "ui/events/keycodes/keyboard_codes.h"
+ 
+@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
+               << 18);  // masked to 6 bits
    }
  
 +  absl::optional<char16_t> shifted_char;

patches/chromium/add_contentgpuclient_precreatemessageloop_callback.patch

@@ -10,10 +10,10 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
 This should be upstreamed.
 
 diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
-index f9e15ddeeb022b77607ae7880a5a7121abc7a111..954a4966c73a74816131217756f17c04483bb1fe 100644
+index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
 --- a/content/gpu/gpu_main.cc
 +++ b/content/gpu/gpu_main.cc
-@@ -271,6 +271,10 @@ int GpuMain(MainFunctionParams parameters) {
+@@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {
    // to the GpuProcessHost once the GpuServiceImpl has started.
    viz::GpuLogMessageManager::GetInstance()->InstallPreInitializeLogHandler();
  
@@ -24,7 +24,7 @@ index f9e15ddeeb022b77607ae7880a5a7121abc7a111..954a4966c73a74816131217756f17c04
    // We are experiencing what appear to be memory-stomp issues in the GPU
    // process. These issues seem to be impacting the task executor and listeners
    // registered to it. Create the task executor on the heap to guard against
-@@ -380,7 +384,6 @@ int GpuMain(MainFunctionParams parameters) {
+@@ -381,7 +385,6 @@ int GpuMain(MainFunctionParams parameters) {
  #endif
    const bool dead_on_arrival = !init_success;
  

patches/chromium/add_didinstallconditionalfeatures.patch

@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
 context, which can cause some preload scripts to trip.
 
 diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
-index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e90be3d39b 100644
+index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
 --- a/content/public/renderer/render_frame_observer.h
 +++ b/content/public/renderer/render_frame_observer.h
-@@ -138,6 +138,8 @@ class CONTENT_EXPORT RenderFrameObserver {
+@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
    virtual void DidHandleOnloadEvents() {}
    virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
                                        int32_t world_id) {}
@@ -23,10 +23,10 @@ index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e9
                                          int32_t world_id) {}
    virtual void DidClearWindowObject() {}
 diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
-index ede4414f875254b77ffb29d0e1bfb254c619b10f..5f766b7d1bd20131b380e862090716de899d086c 100644
+index 30c2972e1fbc21d382304897c542ecd7fa95b896..3f512dcaec9f1d8a1375277ab8c6649d69070a33 100644
 --- a/content/renderer/render_frame_impl.cc
 +++ b/content/renderer/render_frame_impl.cc
-@@ -4676,6 +4676,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
+@@ -4665,6 +4665,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
      observer.DidCreateScriptContext(context, world_id);
  }
  
@@ -40,10 +40,10 @@ index ede4414f875254b77ffb29d0e1bfb254c619b10f..5f766b7d1bd20131b380e862090716de
                                                 int world_id) {
    for (auto& observer : observers_)
 diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
-index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa56dbfa2dc 100644
+index c3c45d6a953d7c068c0d6c8bfb6855cd4403aa6d..b3fd71b237c134853f796a1d8d803e4d28519d53 100644
 --- a/content/renderer/render_frame_impl.h
 +++ b/content/renderer/render_frame_impl.h
-@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
+@@ -602,6 +602,8 @@ class CONTENT_EXPORT RenderFrameImpl
    void DidObserveLayoutShift(double score, bool after_input_or_scroll) override;
    void DidCreateScriptContext(v8::Local<v8::Context> context,
                                int world_id) override;
@@ -53,10 +53,10 @@ index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa5
                                  int world_id) override;
    void DidChangeScrollOffset() override;
 diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
-index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00bf366e92d 100644
+index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
 --- a/third_party/blink/public/web/web_local_frame_client.h
 +++ b/third_party/blink/public/web/web_local_frame_client.h
-@@ -662,6 +662,9 @@ class BLINK_EXPORT WebLocalFrameClient {
+@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
    virtual void DidCreateScriptContext(v8::Local<v8::Context>,
                                        int32_t world_id) {}
  
@@ -67,10 +67,10 @@ index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00b
    virtual void WillReleaseScriptContext(v8::Local<v8::Context>,
                                          int32_t world_id) {}
 diff --git a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
-index b963abd8c4bf6ffaea1930a8d1f647a8a8c266bc..2e8653654686f4fc775288f059ff27daa38e02d5 100644
+index 3ce1ef340780075951fb8c1b65f2ec90569f34ef..898d7caac98727210ac5780b576526a71ec5a5aa 100644
 --- a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
 +++ b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
-@@ -216,6 +216,7 @@ void LocalWindowProxy::Initialize() {
+@@ -217,6 +217,7 @@ void LocalWindowProxy::Initialize() {
    }
  
    InstallConditionalFeatures();
@@ -92,11 +92,11 @@ index 36baf908d3be8aed44ff60b8de2cffe2eee15efe..8d73ddb12013ce195026b9f63050cf33
                                          int32_t world_id) = 0;
    virtual bool AllowScriptExtensions() = 0;
 diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
-index 22f1a4a3a903cb82a1066642e542bb78bf321d79..77d76bf97976e18a8bd077e005b8a3addf9b029d 100644
+index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9ae8d3379f 100644
 --- a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
 +++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
-@@ -295,6 +295,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
-     web_frame_->Client()->DidCreateScriptContext(context, world_id);
+@@ -300,6 +300,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
+   }
  }
  
 +void LocalFrameClientImpl::DidInstallConditionalFeatures(
@@ -110,7 +110,7 @@ index 22f1a4a3a903cb82a1066642e542bb78bf321d79..77d76bf97976e18a8bd077e005b8a3ad
      v8::Local<v8::Context> context,
      int32_t world_id) {
 diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.h b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
-index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf30267fddf7c4 100644
+index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e5844349c0b5 100644
 --- a/third_party/blink/renderer/core/frame/local_frame_client_impl.h
 +++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
 @@ -81,6 +81,8 @@ class CORE_EXPORT LocalFrameClientImpl final : public LocalFrameClient {
@@ -123,10 +123,10 @@ index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf3026
                                  int32_t world_id) override;
  
 diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
-index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
+index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
 --- a/third_party/blink/renderer/core/loader/empty_clients.h
 +++ b/third_party/blink/renderer/core/loader/empty_clients.h
-@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
+@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
  
    void DidCreateScriptContext(v8::Local<v8::Context>,
                                int32_t world_id) override {}

patches/chromium/add_electron_deps_to_license_credits_file.patch

@@ -7,12 +7,12 @@ Ensure that licenses for the dependencies introduced by Electron
 are included in `LICENSES.chromium.html`
 
 diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
-index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
+index 514be069768cc1bbd39f2b261cefb1a9f267f89f..0a1ab64914cfaa087e4000fb81bfafd18aa1b98b 100755
 --- a/tools/licenses/licenses.py
 +++ b/tools/licenses/licenses.py
-@@ -337,6 +337,31 @@ SPECIAL_CASES = {
+@@ -357,6 +357,31 @@ SPECIAL_CASES = {
          "License": "Apache 2.0",
-         "License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
+         "License File": ["//third_party/sample3/the_license"],
      },
 +    os.path.join('third_party', 'electron_node'): {
 +        "Name": "Node.js",

patches/chromium/add_ui_scopedcliboardwriter_writeunsaferawdata.patch

@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
 https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
 
 diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
-index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
+index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
 --- a/ui/base/clipboard/scoped_clipboard_writer.cc
 +++ b/ui/base/clipboard/scoped_clipboard_writer.cc
-@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
+@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
    }
  }
  
@@ -29,10 +29,10 @@ index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464e
    objects_.clear();
    raw_objects_.clear();
 diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
-index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
+index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
 --- a/ui/base/clipboard/scoped_clipboard_writer.h
 +++ b/ui/base/clipboard/scoped_clipboard_writer.h
-@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
+@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
    // This is only used to write custom format data.
    void WriteData(std::u16string_view format, mojo_base::BigBuffer data);
  

patches/chromium/add_webmessageportconverter_entangleandinjectmessageportchannel.patch

@@ -8,7 +8,7 @@ accessing Blink internals. Its inverse, which already exists, is used in
 Android WebView.
 
 diff --git a/third_party/blink/public/web/web_message_port_converter.h b/third_party/blink/public/web/web_message_port_converter.h
-index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e7521cb71b8 100644
+index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211a29548aa 100644
 --- a/third_party/blink/public/web/web_message_port_converter.h
 +++ b/third_party/blink/public/web/web_message_port_converter.h
 @@ -13,6 +13,7 @@
@@ -19,18 +19,20 @@ index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e75
  }  // namespace v8
  
  namespace blink {
-@@ -25,6 +26,9 @@ class BLINK_EXPORT WebMessagePortConverter {
+@@ -25,6 +26,11 @@ class BLINK_EXPORT WebMessagePortConverter {
    // neutered, it will return nullopt.
    static std::optional<MessagePortChannel>
    DisentangleAndExtractMessagePortChannel(v8::Isolate*, v8::Local<v8::Value>);
 +
 +  BLINK_EXPORT static v8::Local<v8::Value>
-+  EntangleAndInjectMessagePortChannel(v8::Local<v8::Context>, MessagePortChannel);
++  EntangleAndInjectMessagePortChannel(v8::Isolate*,
++                                      v8::Local<v8::Context>,
++                                      MessagePortChannel);
  };
  
  }  // namespace blink
 diff --git a/third_party/blink/renderer/core/exported/web_message_port_converter.cc b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
-index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef732225d6 100644
+index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d84213eba 100644
 --- a/third_party/blink/renderer/core/exported/web_message_port_converter.cc
 +++ b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
 @@ -6,6 +6,7 @@
@@ -41,19 +43,20 @@ index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef
  #include "third_party/blink/renderer/bindings/core/v8/v8_message_port.h"
  #include "third_party/blink/renderer/core/messaging/message_port.h"
  
-@@ -21,4 +22,15 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
+@@ -21,4 +22,16 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
    return port->Disentangle();
  }
  
 +v8::Local<v8::Value>
 +WebMessagePortConverter::EntangleAndInjectMessagePortChannel(
++    v8::Isolate* isolate,
 +    v8::Local<v8::Context> context,
 +    MessagePortChannel port_channel) {
 +  auto* execution_context = ToExecutionContext(context);
 +  CHECK(execution_context);
 +  auto* port = MakeGarbageCollected<MessagePort>(*execution_context);
 +  port->Entangle(std::move(port_channel));
-+  return port->ToV8(context->GetIsolate(), context->Global());
++  return port->ToV8(isolate, context->Global());
 +}
 +
  }  // namespace blink

patches/chromium/adjust_accessibility_ui_for_electron.patch

@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
 WindowList.
 
 diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
-index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aabbba621cb 100644
+index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3b33c3777 100644
 --- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
 +++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
 @@ -48,6 +48,7 @@
@@ -19,18 +19,18 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
  #include "content/public/browser/web_ui_data_source.h"
 +#include "electron/shell/browser/electron_browser_context.h"
  #include "ui/accessibility/accessibility_features.h"
+ #include "ui/accessibility/ax_mode.h"
  #include "ui/accessibility/ax_updates_and_events.h"
- #include "ui/accessibility/platform/ax_platform.h"
-@@ -173,7 +174,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
+@@ -179,7 +180,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
                                 rvh->GetRoutingID(), accessibility_mode);
  }
  
 -#if !BUILDFLAG(IS_ANDROID)
 +#if 0
- base::Value::Dict BuildTargetDescriptor(Browser* browser) {
+ base::Value::Dict BuildTargetDescriptor(BrowserWindowInterface* browser) {
    base::Value::Dict target_data;
-   target_data.Set(kSessionIdField, browser->session_id().id());
-@@ -197,7 +198,7 @@ void HandleAccessibilityRequestCallback(
+   target_data.Set(kSessionIdField, browser->GetSessionID().id());
+@@ -226,7 +227,7 @@ void HandleAccessibilityRequestCallback(
    auto& browser_accessibility_state =
        *content::BrowserAccessibilityState::GetInstance();
    base::Value::Dict data;
@@ -39,7 +39,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
    ui::AXMode mode = browser_accessibility_state.GetAccessibilityMode();
    bool native = mode.has_mode(ui::AXMode::kNativeAPIs);
    bool web = mode.has_mode(ui::AXMode::kWebContents);
-@@ -258,7 +259,7 @@ void HandleAccessibilityRequestCallback(
+@@ -287,7 +288,7 @@ void HandleAccessibilityRequestCallback(
    data.Set(kIsScreenReaderActive, is_screen_reader_active);
  
    std::string pref_api_type =
@@ -48,21 +48,23 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
    bool pref_api_type_supported = false;
  
    std::vector<ui::AXApiType::Type> supported_api_types =
-@@ -326,11 +327,11 @@ void HandleAccessibilityRequestCallback(
+@@ -355,13 +356,13 @@ void HandleAccessibilityRequestCallback(
    data.Set(kPagesField, std::move(page_list));
  
    base::Value::List browser_list;
 -#if !BUILDFLAG(IS_ANDROID)
 +#if 0
-   for (Browser* browser : *BrowserList::GetInstance()) {
-     browser_list.Append(BuildTargetDescriptor(browser));
-   }
+   ForEachCurrentBrowserWindowInterfaceOrderedByActivation(
+       [&browser_list](BrowserWindowInterface* browser) {
+         browser_list.Append(BuildTargetDescriptor(browser));
+         return true;
+       });
 -#endif  // !BUILDFLAG(IS_ANDROID)
 +#endif
    data.Set(kBrowsersField, std::move(browser_list));
  
-   std::string json_string;
-@@ -804,7 +805,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
+ #if BUILDFLAG(IS_WIN)
+@@ -848,7 +849,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
    const std::string value = CheckJSValue(data.FindString(kValueField));
  
    if (string_name == kApiTypeField) {
@@ -72,7 +74,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
      pref->SetString(prefs::kShownAccessibilityApiType, value);
    }
  }
-@@ -858,7 +860,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
+@@ -902,7 +904,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
                       AXPropertyFilter::ALLOW_EMPTY);
    AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
  
@@ -82,23 +84,25 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
    ui::AXApiType::Type api_type =
        ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
    std::string accessibility_contents =
-@@ -885,6 +888,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
-                      AXPropertyFilter::ALLOW_EMPTY);
-   AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
+@@ -922,7 +925,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
  
+   AllowJavascript();
+ 
+-#if !BUILDFLAG(IS_ANDROID)
 +#if 0
-   for (Browser* browser : *BrowserList::GetInstance()) {
-     if (browser->session_id().id() == session_id) {
-       base::Value::Dict result = BuildTargetDescriptor(browser);
-@@ -897,6 +901,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
-       return;
-     }
+   std::vector<AXPropertyFilter> property_filters;
+   AddPropertyFilters(property_filters, allow, AXPropertyFilter::ALLOW);
+   AddPropertyFilters(property_filters, allow_empty,
+@@ -949,7 +952,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
+   if (found) {
+     return;
    }
+-#endif  // !BUILDFLAG(IS_ANDROID)
 +#endif
- #endif  // !BUILDFLAG(IS_ANDROID)
    // No browser with the specified |session_id| was found.
    base::Value::Dict result;
-@@ -940,11 +945,13 @@ void AccessibilityUIMessageHandler::StopRecording(
+   result.Set(kSessionIdField, session_id);
+@@ -992,11 +995,13 @@ void AccessibilityUIMessageHandler::StopRecording(
  }
  
  ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
@@ -115,7 +119,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
    // Check to see if it is in the supported types list.
    if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
        supported_types.end()) {
-@@ -1014,8 +1021,11 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
+@@ -1066,10 +1071,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
  // static
  void AccessibilityUIMessageHandler::RegisterProfilePrefs(
      user_prefs::PrefRegistrySyncable* registry) {
@@ -127,11 +131,13 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
 +  registry->RegisterBooleanPref(prefs::kShowInternalAccessibilityTree, false);
 +#endif
  }
+ 
+ void AccessibilityUIMessageHandler::OnVisibilityChanged(
 diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.h b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
-index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7f1648148 100644
+index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83c1d1fa0a 100644
 --- a/chrome/browser/ui/webui/accessibility/accessibility_ui.h
 +++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
-@@ -27,6 +27,8 @@ namespace content {
+@@ -28,6 +28,8 @@ namespace content {
  class WebContents;
  }  // namespace content
  
@@ -140,7 +146,7 @@ index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7
  namespace user_prefs {
  class PrefRegistrySyncable;
  }  // namespace user_prefs
-@@ -77,6 +79,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler {
+@@ -79,6 +81,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler,
    static void RegisterProfilePrefs(user_prefs::PrefRegistrySyncable* registry);
  
   private:

patches/chromium/allow_disabling_blink_scheduler_throttling_per_renderview.patch

@@ -6,11 +6,11 @@ Subject: allow disabling blink scheduler throttling per RenderView
 This allows us to disable throttling for hidden windows.
 
 diff --git a/content/browser/renderer_host/navigation_controller_impl_unittest.cc b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
-index d321fe74be7af24d1246224d7a28c9dede3635b2..af2cb60c42863b1fdad487c28d544b7a7dade805 100644
+index 5765fe8264ecf117d68cdc2c95517f2fcc22715f..37a734f120427571cf5f4f7b6b6eabb881ba59cb 100644
 --- a/content/browser/renderer_host/navigation_controller_impl_unittest.cc
 +++ b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
-@@ -167,6 +167,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
-               (network::mojom::AttributionSupport support),
+@@ -168,6 +168,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
+               (bool supports_draggable_regions),
                (override));
  
 +  MOCK_METHOD(
@@ -23,10 +23,10 @@ index d321fe74be7af24d1246224d7a28c9dede3635b2..af2cb60c42863b1fdad487c28d544b7a
      return receiver_.BindNewEndpointAndPassDedicatedRemote();
    }
 diff --git a/content/browser/renderer_host/render_view_host_impl.cc b/content/browser/renderer_host/render_view_host_impl.cc
-index 87c448c04f8f164f7b2dca6f21a8ea9cc26db163..e88cfee7ad8495e7733c85efc8d21ad2aef26db0 100644
+index 357dc106e4c53122e87ea09a780f7976ad37f25e..5209b85dc285f5e177377bd06e36b8b175581cbb 100644
 --- a/content/browser/renderer_host/render_view_host_impl.cc
 +++ b/content/browser/renderer_host/render_view_host_impl.cc
-@@ -773,6 +773,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
+@@ -767,6 +767,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
    GetWidget()->GetAssociatedFrameWidget()->SetBackgroundOpaque(opaque);
  }
  
@@ -51,25 +51,25 @@ index 7944fe64e0da112fc670358b75506bb199bb5e4a..0e3c16c6af2a078943e9f39808134ab2
    void SendRendererPreferencesToRenderer(
        const blink::RendererPreferences& preferences);
 diff --git a/content/browser/renderer_host/render_widget_host_view_aura.cc b/content/browser/renderer_host/render_widget_host_view_aura.cc
-index b14f5bc3f023c512a066ce9ec9f681c96b1fafc4..b930145db575eb8c4e84297ddd610bd90fb5d3a8 100644
+index 84899b5208f036bd58ba51513820404b6c5a24b9..87fd5aa4fab7ddd0b444a3c8473ae35066c87054 100644
 --- a/content/browser/renderer_host/render_widget_host_view_aura.cc
 +++ b/content/browser/renderer_host/render_widget_host_view_aura.cc
-@@ -580,8 +580,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
+@@ -632,8 +632,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
    // OnShowWithPageVisibility will not call NotifyHostAndDelegateOnWasShown,
    // which updates `visibility_`, unless the host is hidden. Make sure no update
    // is needed.
--  CHECK(host_->is_hidden() || visibility_ == Visibility::VISIBLE);
+-  CHECK(host_->IsHidden() || visibility_ == Visibility::VISIBLE);
 -  OnShowWithPageVisibility(page_visibility);
-+  if (host_->is_hidden() || visibility_ == Visibility::VISIBLE)
++  if (host_->IsHidden() || visibility_ == Visibility::VISIBLE)
 +    OnShowWithPageVisibility(page_visibility);
  }
  
  void RenderWidgetHostViewAura::EnsurePlatformVisibility(
 diff --git a/content/public/browser/render_view_host.h b/content/public/browser/render_view_host.h
-index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb19389b72203b 100644
+index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060f0a640b1 100644
 --- a/content/public/browser/render_view_host.h
 +++ b/content/public/browser/render_view_host.h
-@@ -75,6 +75,9 @@ class CONTENT_EXPORT RenderViewHost {
+@@ -73,6 +73,9 @@ class CONTENT_EXPORT RenderViewHost {
    virtual void WriteIntoTrace(
        perfetto::TracedProto<TraceProto> context) const = 0;
  
@@ -80,34 +80,34 @@ index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb1938
    // This interface should only be implemented inside content.
    friend class RenderViewHostImpl;
 diff --git a/content/test/test_page_broadcast.h b/content/test/test_page_broadcast.h
-index 3f4fdfcdf2f701a394e182bd61baf226338ef7f8..f2faa1225e8ca6abb190e6f7a0775545fa3f785d 100644
+index 4c8d44cdb2fde8e174b78aee7defb980651da18e..f8bf421b5b32af4cd197cbf23f4bd281c3a12514 100644
 --- a/content/test/test_page_broadcast.h
 +++ b/content/test/test_page_broadcast.h
-@@ -51,6 +51,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
-       network::mojom::AttributionSupport support) override;
+@@ -52,6 +52,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
    void UpdateColorProviders(
        const blink::ColorProviderColorMaps& color_provider_colors) override;
+   void SetSupportsDraggableRegions(bool supports_draggable_regions) override;
 +  void SetSchedulerThrottling(bool allowed) override {}
  
    mojo::AssociatedReceiver<blink::mojom::PageBroadcast> receiver_;
  };
 diff --git a/third_party/blink/public/mojom/page/page.mojom b/third_party/blink/public/mojom/page/page.mojom
-index b6a4e3609af1f090f1f845d77fa0589e5b178d8a..989b2cf76ce88614b57e75ce2fcace101225f43e 100644
+index b00bc8a8a5044fbf46f627f9db56cea7f09d7ef6..114c3a4522d11c1348f681af500c487ccd97eea9 100644
 --- a/third_party/blink/public/mojom/page/page.mojom
 +++ b/third_party/blink/public/mojom/page/page.mojom
-@@ -175,4 +175,7 @@ interface PageBroadcast {
-   // 2. The ColorProvider associated with the WebContents changes as a result
-   // of theme changes.
-   UpdateColorProviders(ColorProviderColorMaps color_provider_colors);
+@@ -180,4 +180,7 @@ interface PageBroadcast {
+   // Indicates that the page's main frame should collect draggable regions set
+   // using the app-region CSS property.
+   SetSupportsDraggableRegions(bool supports_draggable_regions);
 +
 +  // Whether to enable the Renderer scheduler background throttling.
 +  SetSchedulerThrottling(bool allowed);
  };
 diff --git a/third_party/blink/public/web/web_view.h b/third_party/blink/public/web/web_view.h
-index c8d27cfee8ef3fe244291f4667b59df1037c359b..92ed53a689991ec8eca9572bf2f7a212acfc4a38 100644
+index 7f995dc1fab7a1b5319f6fe9bb4d37b3851dbf87..58c93c5acf9f63eb3391fafe2904b20284381a85 100644
 --- a/third_party/blink/public/web/web_view.h
 +++ b/third_party/blink/public/web/web_view.h
-@@ -360,6 +360,7 @@ class BLINK_EXPORT WebView {
+@@ -361,6 +361,7 @@ class BLINK_EXPORT WebView {
    // Scheduling -----------------------------------------------------------
  
    virtual PageScheduler* Scheduler() const = 0;
@@ -116,10 +116,10 @@ index c8d27cfee8ef3fe244291f4667b59df1037c359b..92ed53a689991ec8eca9572bf2f7a212
    // Visibility -----------------------------------------------------------
  
 diff --git a/third_party/blink/renderer/core/exported/web_view_impl.cc b/third_party/blink/renderer/core/exported/web_view_impl.cc
-index b0a8c14c845a69c72ab823af1eccad22b27f1ad6..6ba55d345d4b18c9c76e26a8a1eb3835dd692581 100644
+index 2bb50e492558f0130918717605bf48b8a61f1e14..b50e4805af36aa96c0ce69359adcf1b18d80c62a 100644
 --- a/third_party/blink/renderer/core/exported/web_view_impl.cc
 +++ b/third_party/blink/renderer/core/exported/web_view_impl.cc
-@@ -2485,6 +2485,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
+@@ -2499,6 +2499,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
    TRACE_EVENT2("navigation", "WebViewImpl::SetPageLifecycleStateInternal",
                 "old_state", old_state, "new_state", new_state);
  
@@ -130,7 +130,7 @@ index b0a8c14c845a69c72ab823af1eccad22b27f1ad6..6ba55d345d4b18c9c76e26a8a1eb3835
    bool storing_in_bfcache = new_state->is_in_back_forward_cache &&
                              !old_state->is_in_back_forward_cache;
    bool restoring_from_bfcache = !new_state->is_in_back_forward_cache &&
-@@ -3986,10 +3990,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
+@@ -4007,10 +4011,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
    return GetPage()->GetPageScheduler();
  }
  
@@ -155,10 +155,10 @@ index b0a8c14c845a69c72ab823af1eccad22b27f1ad6..6ba55d345d4b18c9c76e26a8a1eb3835
    // Do not throttle if the page should be painting.
    bool is_visible =
 diff --git a/third_party/blink/renderer/core/exported/web_view_impl.h b/third_party/blink/renderer/core/exported/web_view_impl.h
-index 5c8a5d7f9b675a460740643fc26d778a08ef7112..2ebae3e0a5b76eb9551d286af1ed64e1e58b9de4 100644
+index 881e561c0b4c55e30f6b4f69bcbbe092cc449fd1..9afced261ae85244f99dac4372fb7b1c3eabfbaa 100644
 --- a/third_party/blink/renderer/core/exported/web_view_impl.h
 +++ b/third_party/blink/renderer/core/exported/web_view_impl.h
-@@ -445,6 +445,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
+@@ -447,6 +447,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
    LocalDOMWindow* PagePopupWindow() const;
  
    PageScheduler* Scheduler() const override;
@@ -166,7 +166,7 @@ index 5c8a5d7f9b675a460740643fc26d778a08ef7112..2ebae3e0a5b76eb9551d286af1ed64e1
    void SetVisibilityState(mojom::blink::PageVisibilityState visibility_state,
                            bool is_initial_state) override;
    mojom::blink::PageVisibilityState GetVisibilityState() override;
-@@ -935,6 +936,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
+@@ -939,6 +940,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
    // If true, we send IPC messages when |preferred_size_| changes.
    bool send_preferred_size_changes_ = false;
  

patches/chromium/allow_electron_to_depend_on_components_os_crypt_sync.patch

@@ -0,0 +1,23 @@
+From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
+From: John Kleinschmidt <jkleinsc@electronjs.org>
+Date: Mon, 15 Sep 2025 15:52:55 -0400
+Subject: Allow electron to depend on components/os_crypt/sync.
+
+This is necessary after
+https://chromium-review.googlesource.com/c/chromium/src/+/6944749
+landed.  That CL notes that "new code should use os_crypt async",
+so we can remove this patch once we migrate our code to use
+os_crypt async.
+
+diff --git a/components/os_crypt/sync/BUILD.gn b/components/os_crypt/sync/BUILD.gn
+index 23aa391aaf380f87310fb295277809f8b105d6e8..bb308187837371ecfa2482affaf35ac7ed98c1f3 100644
+--- a/components/os_crypt/sync/BUILD.gn
++++ b/components/os_crypt/sync/BUILD.gn
+@@ -10,6 +10,7 @@ import("//components/os_crypt/sync/features.gni")
+ component("sync") {
+   # New code should use os_crypt async.
+   visibility = [
++    "//electron:*",
+     "//chrome/browser",
+     "//chrome/test:test_support",
+     "//components/os_crypt/async/browser:dpapi_key_provider",

patches/chromium/allow_in-process_windows_to_have_different_web_prefs.patch

@@ -8,10 +8,10 @@ WebPreferences of in-process child windows, rather than relying on
 process-level command line switches, as before.
 
 diff --git a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
-index 545a854789199a6f3056bf507f882446a5e11235..e733581553328010275c85465ee3a97a950afe4d 100644
+index 42005e4758187331909b87f82e6e008a03a14f7f..f76615d34483b3485d7729889d0a895d13961f57 100644
 --- a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
 +++ b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
-@@ -148,6 +148,19 @@ bool StructTraits<blink::mojom::WebPreferencesDataView,
+@@ -150,6 +150,19 @@ bool StructTraits<blink::mojom::WebPreferencesDataView,
    out->v8_cache_options = data.v8_cache_options();
    out->record_whole_document = data.record_whole_document();
    out->stylus_handwriting_enabled = data.stylus_handwriting_enabled();
@@ -32,7 +32,7 @@ index 545a854789199a6f3056bf507f882446a5e11235..e733581553328010275c85465ee3a97a
    out->accelerated_video_decode_enabled =
        data.accelerated_video_decode_enabled();
 diff --git a/third_party/blink/public/common/web_preferences/web_preferences.h b/third_party/blink/public/common/web_preferences/web_preferences.h
-index 3283422f7b6da21e6e9c6f35a52a643ba26a5e29..962d10f8166c3765b8d7434ecf941922981e3ce8 100644
+index c1f0a4cae029527f9ea966b53fea2faa31c4cd90..e2bfc5356fc824b79231775ad85a45c6634093f7 100644
 --- a/third_party/blink/public/common/web_preferences/web_preferences.h
 +++ b/third_party/blink/public/common/web_preferences/web_preferences.h
 @@ -9,6 +9,7 @@
@@ -43,9 +43,9 @@ index 3283422f7b6da21e6e9c6f35a52a643ba26a5e29..962d10f8166c3765b8d7434ecf941922
  #include "build/build_config.h"
  #include "net/nqe/effective_connection_type.h"
  #include "third_party/blink/public/common/common_export.h"
-@@ -456,6 +457,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
-   // Whether fingerprinting protection based on page content is enabled.
-   bool content_based_fingerprinting_protection_enabled = false;
+@@ -461,6 +462,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
+   bool should_screenshot_on_mainframe_same_doc_navigation = true;
+ #endif  // BUILDFLAG(IS_ANDROID)
  
 +  // Begin Electron-specific WebPreferences.
 +  bool context_isolation = false;
@@ -64,7 +64,7 @@ index 3283422f7b6da21e6e9c6f35a52a643ba26a5e29..962d10f8166c3765b8d7434ecf941922
    // chrome, except for the cases where it would require lots of extra work for
    // the embedder to use the same default value.
 diff --git a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
-index 49b374461da896943cd3da55ebcd8814098eeba9..13789a02f03dcfdbad798875d109882d9e548dff 100644
+index 3ab13439f0e03d1777ca78b638b98978d972bda5..c5f6f203d1ba36c3b1bb213d44b17adc472afbc4 100644
 --- a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
 +++ b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
 @@ -8,6 +8,7 @@
@@ -75,7 +75,7 @@ index 49b374461da896943cd3da55ebcd8814098eeba9..13789a02f03dcfdbad798875d109882d
  #include "mojo/public/cpp/bindings/struct_traits.h"
  #include "net/nqe/effective_connection_type.h"
  #include "third_party/blink/public/common/common_export.h"
-@@ -434,6 +435,52 @@ struct BLINK_COMMON_EXPORT StructTraits<blink::mojom::WebPreferencesDataView,
+@@ -439,6 +440,52 @@ struct BLINK_COMMON_EXPORT StructTraits<blink::mojom::WebPreferencesDataView,
      return r.stylus_handwriting_enabled;
    }
  
@@ -129,22 +129,18 @@ index 49b374461da896943cd3da55ebcd8814098eeba9..13789a02f03dcfdbad798875d109882d
      return r.cookie_enabled;
    }
 diff --git a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
-index 60432eee506ddfcb02c5eef396494bea4dc3e263..76c0de3cc8095ab834950e117f8f12fd51e94978 100644
+index 8b8f9837a5efd984ea1bd7b7b0c9462f65f5ac7e..7a3ccc78fc82181e1e9da9004305a827a80ed745 100644
 --- a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
 +++ b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
-@@ -8,9 +8,11 @@ import "third_party/blink/public/mojom/css/preferred_color_scheme.mojom";
- import "third_party/blink/public/mojom/css/preferred_contrast.mojom";
- import "third_party/blink/public/mojom/v8_cache_options.mojom";
- import "url/mojom/url.mojom";
+@@ -4,6 +4,7 @@
+ 
+ module blink.mojom;
+ 
 +import "mojo/public/mojom/base/file_path.mojom";
  import "mojo/public/mojom/base/string16.mojom";
  import "skia/public/mojom/skcolor.mojom";
- 
-+
- enum PointerType {
-   kPointerNone                              = 1,             // 1 << 0
-   kPointerFirstType                         = kPointerNone,
-@@ -217,6 +219,19 @@ struct WebPreferences {
+ import "third_party/blink/public/mojom/css/preferred_color_scheme.mojom";
+@@ -224,6 +225,19 @@ struct WebPreferences {
    // If true, stylus handwriting recognition to text input will be available in
    // editable input fields which are non-password type.
    bool stylus_handwriting_enabled;