Compare commits

...

165 Commits

Author SHA1 Message Date
trop[bot]
1265eccf43 build: apply additional compression on upload (#48777)
build: apply additional compression on upload for large files

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-04 20:04:28 +01:00
electron-roller[bot]
23792bc7ed chore: bump node to v24.11.0 (40-x-y) (#48775)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 12:36:51 -05:00
trop[bot]
4138dfeb19 chore: upgrade Node.js to v24.10.0 (#48739)
* chore: upgrade Node.js to v24.10.0

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup crypto patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup crypto test patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup lazyload fs patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: errant use of context->GetIsolate()

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: tweak BoringSSL compat patch for new changes

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: add back missing isolate dtor declaration

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! esm: fix module.exports export on CJS modules

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! src: prepare for v8 sandboxing

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump @types/node to v24

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fix const assignment in crypto test

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: sandbox pointer patch issues

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: rework source phase import patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup crypto tests

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: HostImportModuleWithPhaseDynamically todo

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: cjs esm failures

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove deleted specs

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: tweak sandboxed pr patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: disable parallel/test-os-checked-function

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: use WHATWG URL instead of url.parse

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fix accidental extra line

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-04 09:52:30 +01:00
trop[bot]
709a9f5f20 fix: release mouse buttons on focus loss on Wayland (#48759)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2025-11-03 11:20:43 -05:00
trop[bot]
a2bb5069a5 chore: bump chromium to 144.0.7500.0 (40-x-y) (#48745)
* chore: bump chromium in DEPS to 144.0.7500.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* build: explicitly disable reclient

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-03 13:18:33 +01:00
trop[bot]
2b99c7645d refactor: remove redundant map lookups in browser/api/menu.ts (#48732)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-30 09:43:25 -04:00
trop[bot]
3c8714a940 chore: bump chromium to 143.0.7499.0 (40-x-y) (#48729)
* chore: bump chromium in DEPS to 143.0.7499.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 15:40:58 -04:00
trop[bot]
a01b4becfa docs: use relative link for OffscreenSharedTexture (#48720)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-10-29 00:01:22 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
Keeley Hammond
c7aa0b537d chore: cherry-pick ec6c18478382 from v8 (#48335)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches
2025-09-16 19:08:15 -07:00
Robo
048d620701 fix: remove unneeded handlescope from JS callbacks (#48318)
fix: remove handlescope from JS callbacks
2025-09-16 06:56:38 +09:00
Charles Kerr
15cdae1cf0 refactor: make api::NetLog inherit from gin::Wrappable (#48308)
* refactor: remove unused v8::Isolate* arg from NetLog ctor

* refactor: allocate api::NetLog on cpp heap

* refactor: make electron::api::Session::net_log_ a cppgc::Member<api::NetLog>

* refactor: remove unnecessary EscapableHandleScope

* chore: code style consistency
2025-09-16 06:29:46 +09:00
Shelley Vohr
bac383c219 feat: add fileSystem to ses.setPermissionCheckHandler (#48170)
feat: add fileSystem to ses.setPermissionCheckHandler
2025-09-15 17:00:58 -04:00
John Kleinschmidt
49eb165ef9 ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48319)
cleanup
2025-09-15 16:31:49 -04:00
Charles Kerr
a468ed7f10 refactor: narrow or remove gin arguments (#48300)
* refactor: narrow App:SetJumpList() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow WebContents::AddWorkSpace() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowMessageBox() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowOpenDialog() arg from gin::Arguments* to v8::Isolate*

* refactor: remove unused gin::Arguments* arg from OverrideGlobalPropertyFromIsolatedWorld()

* refactor: narrow WebContents::StartDrag() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow NetLog::StopLogging() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow Protocol::IsProtocolHandled() arg from gin::Arguments* to v8::Isolate*
2025-09-13 08:19:07 +09:00
Calvin
5444738721 fix: set ozone platform for wayland (#48301)
* fix: set ozone platform for wayland

* whoops, includes. thx charles
2025-09-13 08:17:06 +09:00
Charles Kerr
a6959ca97b refactor: allocate api::Debugger on cpp heap (#48266)
* refactor: remove unused isolate arg from Debugger ctor

* refactor: make Debugger ctor, dtor public

needed for cppgc::MakeGarbageCollected()

This is what upstream does, e.g. https://chromium-review.googlesource.com/c/chromium/src/+/6722236

* fixup! refactor: remove unused isolate arg from Debugger ctor

mark Debugger ctor as explicit

* refactor: in EventEmitterMixin, handle both old and new WrapperInfo types

* refactor: make electron::api::Debugger inherit from gin::Wrappable

* refactor: add api::Debugger::GetTypeName()

* refactor: add api::Debugger::GetClassName()
2025-09-11 16:03:17 -04:00
dependabot[bot]
45353ae38c build(deps): bump actions/setup-node from 4.4.0 to 5.0.0 (#48282)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.4.0 to 5.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](49933ea528...a0853c2454)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 21:35:54 -05:00
Charles Kerr
f702327dce refactor: avoid unused inheritance in ServiceWorkerMain (#48279)
ServiceWorkerMain does not need to inherit from EventEmitterMixin
2025-09-10 11:16:35 -05:00
dependabot[bot]
fda3a3d493 build(deps): bump github/codeql-action from 3.29.11 to 3.30.1 (#48283)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.11 to 3.30.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3c3833e0f8...f1f6e5f6af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 09:47:34 -05:00
Michaela Laurencin
dae5dad167 docs: update release timeline for unsupported v35 (#48285) 2025-09-09 15:03:48 -07:00
John Kleinschmidt
940ebb6c7a chore: update patches (#48278) 2025-09-08 15:44:47 -04:00
electron-roller[bot]
793565e4be chore: bump chromium to 141.0.7390.7 (main) (#48212)
* chore: bump chromium in DEPS to 141.0.7381.3

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7382.0

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7384.0

* chore: bump chromium in DEPS to 141.0.7386.0

* [Extensions] Move devtools_page and chrome_url_overrides handlers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6862700

* Reland "[api] Advance deprecation of GetIsolate"

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6875273

* Move "system integrated UI" concept out of NativeTheme.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6867375

* chore: update patches

* Reland "[PermissionOptions] Return PermissionResult in callback for requests"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6851838

* Reland "[exit-time-destructors] Enable by default"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update patches

* [FSA] Revoke Read access after removing file via FileSystemAccess API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6677249

* chore: IWYU

* [DevToolsUIBindings] Accept an object for `dispatchHttpRequest` params

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6877528

* chore: IWYU

* Pass navigation UI parameters on EnterFullscreen in EAM

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6874923

* chore: rm band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch

* Remove unused PreHandleMouseEvent

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6880411

* 6878583: siso: update to version 1.4.1

https://chromium-review.googlesource.com/c/chromium/src/+/6878583

* Fold native_theme_browser into native_theme.

https://chromium-review.googlesource.com/c/chromium/src/+/6882627

* fixup: Reland "[exit-time-destructors] Enable by default

https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update filenames.libcxx.gni

* chore: IWYU

* fixup: chore: IWYU

* fixup: Reland "[exit-time-destructors] Enable by default

* fixup: Reland "[exit-time-destructors] Enable by default

* Remove common_theme.*; place its method in NativeTheme instead.

https://chromium-review.googlesource.com/c/chromium/src/+/6886029

* fixup: Reland "[exit-time-destructors] Enable by default

* Better track when WebPreferences need updates for color-related changes.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6886797

* chore: bump chromium in DEPS to 141.0.7390.7

* 6904664: Reland "Make BrowserContext::GetPath() const"

https://chromium-review.googlesource.com/c/chromium/src/+/6904664

* Restore read access after certain file modification operations

https://chromium-review.googlesource.com/c/chromium/src/+/6861041

* fixup: Move "system integrated UI" concept out of NativeTheme.

* fixup: Reland "[exit-time-destructors] Enable by default

* chore: update patches

* 6906096: Remove GetSysSkColor().

https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* Inline implementation of SysColorChangeListener into the lone user.

https://chromium-review.googlesource.com/c/chromium/src/+/6905083

Also 6906096: Remove GetSysSkColor(). | https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* fixup: 6906096: Remove GetSysSkColor()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-08 12:57:15 +02:00
electron-roller[bot]
1f322ebce3 chore: bump node to v22.19.0 (main) (#48222)
* chore: bump node in DEPS to v22.19.0

* chore: fixup patch indices

* crypto: add tls.setDefaultCACertificates()

https://github.com/nodejs/node/pull/58822

* esm: js-string Wasm builtins in ESM Integration

https://github.com/nodejs/node/pull/59179

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-05 17:16:45 -04:00
Samuel Attard
f009e077f2 build: update spec deps for clean audit (#48238) 2025-09-03 15:05:49 -04:00
Calvin
fed73040e2 docs: move some planned breaking changes to 39 (#48236) 2025-09-01 14:55:11 -07:00
Shelley Vohr
828fd59a72 fix: file-only picker incorrectly allowing some directories (#48198) 2025-08-29 13:14:45 -04:00
Shelley Vohr
e892840975 fix: ensure dragging works again after emitting contextmenu event (#48199) 2025-08-29 10:37:37 -04:00
Shelley Vohr
7373173e44 fix: showMessageDialog should center dialog to parent (#48181) 2025-08-29 09:56:51 +02:00
electron-roller[bot]
5d5e672f17 chore: bump chromium to 141.0.7361.0 (main) (#48054)
* chore: bump chromium in DEPS to 141.0.7352.0

* chore: update patches

* 6830573: Revert 'Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable' | https://chromium-review.googlesource.com/c/chromium/src/+/6830573

* chore: bump chromium in DEPS to 141.0.7354.0

* chore: bump chromium in DEPS to 141.0.7356.0

* chore: bump chromium in DEPS to 141.0.7357.0

* chore: bump chromium in DEPS to 141.0.7359.0

* chore: bump chromium in DEPS to 141.0.7361.0

* 6838518: [Mac] Correctly deallocate sandbox error buffers and prevent crash resulting from nullptr assignment | https://chromium-review.googlesource.com/c/chromium/src/+/6838518

* 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* chore: update patches

* fixup! 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* fixup! 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* fix: unsafe buffer warning in fix_properly_honor_printing_page_ranges.patch

* fix: FTBFS in src_remove_dependency_on_wrapper-descriptor-based_cppheap.patch

This change should be upstreamed.

Fixes this error:

../../third_party/electron_node/src/env.cc:606:3: error: no matching function for call to 'Wrap'
  606 |   v8::Object::Wrap<v8::CppHeapPointerTag::kDefaultTag>(
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1076:14: note: candidate function template not viable: cannot convert argument of incomplete type 'void *' to 'v8::Object::Wrappable *' for 3rd argument
 1076 | void Object::Wrap(v8::Isolate* isolate, const v8::Local<v8::Object>& wrapper,
      |              ^
 1077 |                   v8::Object::Wrappable* wrappable) {
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1084:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const PersistentBase<Object>' for 2nd argument
 1084 | void Object::Wrap(v8::Isolate* isolate, const PersistentBase<Object>& wrapper,
      |              ^                          ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1093:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const BasicTracedReference<Object>' for 2nd argument
 1093 | void Object::Wrap(v8::Isolate* isolate,
      |              ^
 1094 |                   const BasicTracedReference<Object>& wrapper,
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
1 error generated.

* [v8-init] Access crash key only from main thread | https://chromium-review.googlesource.com/c/chromium/src/+/6827167

* chore: e patches all

* chore: remove chore_restore_some_deprecated_wrapper_utility_in_gin.patch from patches

this remove line got re-added when rebasing roller/chromium/main

* chore: e patches all

* fix: include base/time/time.h when using base::Time

* chore: update patches

* Make --host-rules an alias for --host-resolver-rules.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/4867872

* ci: update BUILD_TOOLS_SHA

Refs https://github.com/electron/build-tools/pull/746

* [Fontations] Remove Fontations suffix from font names

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6835930

* temp: debug macOS addon build failure

* Revert "temp: debug macOS addon build failure"

This reverts commit 40bc8abab65dc83e17c4ab97cb6e7522a193fb44.

* test: run tests with Xcode 16.4

* ci: fix tccdb update for macOS 15

* spec: disable opening external application for loadURL

on macOS opening unknown external application will bring
up dialog to choose apps from application store which will
break our other test suites that want to capture screen
for pixel matching.

The loadURL spec that tests bad-scheme://foo is sufficient
that we hit the permission handler for openExternal since
at that point we already know the runtime gave up on handling
the scheme.

* chore: rebase patches

* chore: disable codesiging tests

* ci: update ScreenCaptureApprovals.plist for /bin/bash

* ci: try updating tcc permissions

* ci: update TCC permissions

Refs https://www.rainforestqa.com/blog/macos-tcc-db-deep-dive

* chore: test with 1st quadrant of the window

* chore: adjust for macOS 15 menubar height

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-29 12:31:47 +09:00
LZL
e39943bf45 fix: BrowserWindow add the same BrowserView (#48053)
fix: BrowserWindow add the same BrowserView (#48057)
2025-08-28 10:31:41 +02:00
David Sanders
f331606e07 build: bump NMV to 140 (#48196) 2025-08-27 18:57:00 -07:00
David Sanders
cca55117e4 build: refactor Linux binary stripping to align with upstream (#47932) 2025-08-27 18:56:31 -07:00
Erick Zhao
bf29d2f0bd docs: fix some module headings (#48177) 2025-08-27 14:52:26 -07:00
John Kleinschmidt
fea1a2a987 ci: use free GH arm runners (#47872) 2025-08-27 10:01:36 -04:00
dependabot[bot]
a51c56aca9 build(deps): bump amannn/action-semantic-pull-request from 6.0.1 to 6.1.1 (#48175)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 6.0.1 to 6.1.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](fdd4d3ddf6...48f256284b)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.1.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:52:36 +02:00
dependabot[bot]
89f25e6af3 build(deps): bump github/codeql-action from 3.29.10 to 3.29.11 (#48174)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.10 to 3.29.11.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](96f518a34f...3c3833e0f8)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.11
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:49:43 +02:00
Robo
e0db4046b2 refactor: allocate gin_helper::internal::Event on cpp heap (#48161) 2025-08-27 09:30:50 +09:00
Calvin
3b9130d815 docs: add release timeline for Electron 39 (#48167) 2025-08-26 14:19:56 -07:00
Shelley Vohr
52ed4646d9 chore: remove upstream OSR temp fix (#48162) 2025-08-26 16:22:45 -04:00
John Kleinschmidt
68098c317f build: remove no longer needed arg for siso (#48164)
* build: remove no longer needed arg for siso

* chore: test ffmpeg zip

* build: fix ffmpeg build with siso

* Revert "chore: test ffmpeg zip"

This reverts commit 2bbcc86039.
2025-08-25 16:46:36 -04:00
dependabot[bot]
52e0307cc1 build(deps): bump github/codeql-action from 3.29.7 to 3.29.10 (#48113)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.7 to 3.29.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](51f77329af...96f518a34f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 13:23:15 +02:00
dependabot[bot]
7fffe77909 build(deps-dev): bump stream-json and @types/stream-json (#48114)
Bumps [stream-json](https://github.com/uhop/stream-json) and [@types/stream-json](https://github.com/DefinitelyTyped/DefinitelyTyped/tree/HEAD/types/stream-json). These dependencies needed to be updated together.

Updates `stream-json` from 1.8.0 to 1.9.1
- [Commits](https://github.com/uhop/stream-json/compare/1.8.0...1.9.1)

Updates `@types/stream-json` from 1.7.7 to 1.7.8
- [Release notes](https://github.com/DefinitelyTyped/DefinitelyTyped/releases)
- [Commits](https://github.com/DefinitelyTyped/DefinitelyTyped/commits/HEAD/types/stream-json)

---
updated-dependencies:
- dependency-name: stream-json
  dependency-version: 1.9.1
  dependency-type: direct:development
  update-type: version-update:semver-minor
- dependency-name: "@types/stream-json"
  dependency-version: 1.7.8
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 12:58:38 +02:00
Robo
3ccb1bc0a8 refactor: allocate api::Session on cpp heap (#48141) 2025-08-25 18:52:06 +09:00
Shelley Vohr
0917ed5f6f fix: snapped restoration after minimization (#48142) 2025-08-22 14:37:45 -04:00
Samuel Attard
a67aad0f50 build: use siso instead of reclient (#47534) 2025-08-22 14:17:02 -04:00
reito
ceb6d28fd3 fix: webContent.fromId should be number instead of string (#48059) 2025-08-22 11:40:10 -04:00
Shelley Vohr
e12ab6708e chore: improve failed notification error messages on Windows (#48131) 2025-08-22 11:35:39 -04:00
Shelley Vohr
6101025368 fix: net.isOnline always true in utility processes (#48111)
* fix: net.isOnline always true in utilityProcesses

* Update shell/services/node/node_service.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-08-22 14:30:41 +02:00
dependabot[bot]
97b0280ad4 build(deps): bump amannn/action-semantic-pull-request from 5.5.3 to 6.0.1 (#48115)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 5.5.3 to 6.0.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](0723387faa...fdd4d3ddf6)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-21 10:44:27 +02:00
John Kleinschmidt
1044fe675d build: use new 7z command line switch (#48136)
-snld20 replaces -snld
2025-08-20 17:05:25 -04:00
John Kleinschmidt
42af60cc7e docs: update 38.0 breaking changes (#48117) 2025-08-20 14:15:01 -04:00
John Kleinschmidt
cadba11088 build: fixup docs only condition (#48128) 2025-08-20 12:58:54 -04:00
Shelley Vohr
8aeee3f714 refactor: use XmlWriter for Windows toasts (#48065)
refactor: use XmlWriter for Windows toasts
2025-08-20 16:06:51 +02:00
Robo
dd54e84a58 refactor: allocate api::App on cpp heap (#48118) 2025-08-20 20:35:08 +09:00
John Kleinschmidt
d4b7d9e9cf build: get source cache for docs only pipeline (#48120) 2025-08-20 11:07:00 +02:00
BILL SHEN
83a5ba1e2c feat: add fileBacked and purgeable fields to process.getSystemMemoryInfo() for macOS (#47628)
* fix: Optimize the value of memory.free in the return data of getSystemMemoryInfo().

* fix: Improve the value of memory in the return data of getSystemMemoryInfo().

* fix: complete API doc.

* Update docs/api/process.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* fix: update name to fileBacked.

* fix: fix with code conflict

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
2025-08-20 09:49:41 +02:00
559 changed files with 11598 additions and 7805 deletions

View File

@@ -17,9 +17,6 @@ inputs:
is-release:
description: 'Is release build'
required: true
strip-binaries:
description: 'Strip binaries (Linux only)'
required: false
generate-symbols:
description: 'Generate symbols'
required: true
@@ -63,22 +60,28 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build -j $NUMBER_OF_NINJA_PROCESSES
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Strip Electron Binaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.strip-binaries == 'true' }}
run: |
cd src
electron/script/copy-debug-symbols.py --target-cpu="${{ inputs.target-arch }}" --out-dir=out/Default/debug --compress
electron/script/strip-binaries.py --target-cpu="${{ inputs.target-arch }}" --verbose
electron/script/add-debug-link.py --target-cpu="${{ inputs.target-arch }}" --debug-dir=out/Default/debug
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
if [ "$TARGET_PLATFORM" = "win" ]; then
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
else
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
fi
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip -j $NUMBER_OF_NINJA_PROCESSES -d explain
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -86,11 +89,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot -j $NUMBER_OF_NINJA_PROCESSES
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -100,20 +102,6 @@ runs:
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
if [ "${{ inputs.target-platform }}" = "linux" ]; then
if [ "${{ inputs.target-arch }}" = "arm" ]; then
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x86_v8_arm/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x86_v8_arm/v8_context_snapshot_generator
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x64_v8_arm64/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x64_v8_arm64/v8_context_snapshot_generator
else
electron/script/strip-binaries.py --file $PWD/out/Default/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/v8_context_snapshot_generator
fi
fi
e build --target electron:electron_mksnapshot_zip -j $NUMBER_OF_NINJA_PROCESSES
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -147,7 +135,6 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
@@ -157,11 +144,6 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -181,41 +163,23 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
electron/script/zip-symbols.py -b $BUILD_PATH
fi
- name: Generate FFMpeg ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
if: ${{ inputs.is-release == 'true' }}
run: |
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg -j $NUMBER_OF_NINJA_PROCESSES
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip -j $NUMBER_OF_NINJA_PROCESSES
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:libcxxabi_headers_zip -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:libcxx_objects_zip -j $NUMBER_OF_NINJA_PROCESSES
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
@@ -238,7 +202,29 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash
run: |
cd src
e d siso report -C out/Default > siso_report.txt
SISO_REPORT_PATH=$(grep -o '/.*siso-report-[^ ]*' siso_report.txt)
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH" >> $GITHUB_ENV
cat siso_report.txt
echo "SISO REPORT AT $SISO_REPORT_PATH"
- name: Generate siso report (Windows)
if: ${{ inputs.target-platform == 'win' && !cancelled() }}
shell: powershell
run: |
cd src
e d siso report -C out\Default > siso_report.txt
$SISO_REPORT_PATH = Get-Content "siso_report.txt" | Select-String "report file:\s*(.+)" | ForEach-Object {
$_.Matches.Groups[1].Value.Trim()
}
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH"
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH" >> $env:GITHUB_ENV
- name: Generate Artifact Key
if: always() && !cancelled()
shell: bash
run: |
if [ "${{ inputs.is-asan }}" = "true" ]; then
@@ -250,9 +236,11 @@ runs:
# The current generated_artifacts_<< artifact.key >> name was taken from CircleCI
# to ensure we don't break anything, but we may be able to improve that.
- name: Move all Generated Artifacts to Upload Folder ${{ inputs.step-suffix }}
if: always() && !cancelled()
shell: bash
run: ./src/electron/script/actions/move-artifacts.sh
- name: Upload Generated Artifacts ${{ inputs.step-suffix }}
if: always() && !cancelled()
uses: actions/upload-artifact@65462800fd760344b1a7b4382951275a0abb4808
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}

View File

@@ -172,7 +172,6 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

View File

@@ -14,6 +14,9 @@ inputs:
description: 'Target platform, should be linux, win, macos'
package:
description: 'Package to install'
dependency-version:
description: 'Version of the dependency to install'
default: ''
runs:
using: "composite"
steps:
@@ -22,15 +25,23 @@ runs:
run : |
rm -rf ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }}
- name: Create ensure file for ${{ inputs.dependency }}
if: ${{ inputs.dependency-version == '' }}
shell: bash
run: |
echo '${{ inputs.package }}' `e d gclient getdep --deps-file=${{ inputs.deps-file }} -r '${{ inputs.installation-dir }}:${{ inputs.package }}'` > ${{ inputs.dependency }}_ensure_file
cat ${{ inputs.dependency }}_ensure_file
- name: CIPD installation of ${{ inputs.dependency }} (macOS)
if: ${{ inputs.target-platform == 'macos' }}
- name: Create ensure file for ${{ inputs.dependency }} from dependency-version
if: ${{ inputs.dependency-version != '' }}
shell: bash
run: |
echo "ensuring ${{ inputs.dependency }} on macOS"
echo '${{ inputs.package }} ${{ inputs.dependency-version }}' > ${{ inputs.dependency }}_ensure_file
cat ${{ inputs.dependency }}_ensure_file
- name: CIPD installation of ${{ inputs.dependency }} (macOS)
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
echo "ensuring ${{ inputs.dependency }}"
e d cipd ensure --root ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }} -ensure-file ${{ inputs.dependency }}_ensure_file
- name: CIPD installation of ${{ inputs.dependency }} (Windows)
if: ${{ inputs.target-platform == 'win' }}

View File

@@ -20,6 +20,7 @@ runs:
using: "composite"
steps:
- name: Fix llvm toolchain
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
rm -rf src/third_party/llvm-build
@@ -27,6 +28,7 @@ runs:
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6667681
python3 src/tools/clang/scripts/update.py --package objdump
- name: Fix esbuild
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
@@ -36,6 +38,7 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/esbuild/${platform}
- name: Fix rustc
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
rm -rf src/third_party/rust-toolchain
@@ -59,6 +62,7 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: gn/gn/windows-amd64
- name: Fix reclient
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: reclient
@@ -67,6 +71,7 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: infra/rbe/client/${platform}
- name: Configure reclient configs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
python3 src/buildtools/reclient_cfgs/configure_reclient_cfgs.py --rbe_instance "projects/rbe-chrome-untrusted/instances/default_instance" --reproxy_cfg_template reproxy.cfg.template --rewrapper_cfg_project "" --skip_remoteexec_cfg_fetch
@@ -84,6 +89,7 @@ runs:
python3 src/third_party/depot_tools/download_from_google_storage.py --no_resume --no_auth --bucket chromium-browser-clang -s $DSYM_SHA_FILE -o src/tools/clang/dsymutil/bin/dsymutil
fi
- name: Fix ninja
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: ninja
@@ -92,10 +98,20 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/ninja/${platform}
- name: Set ninja in path
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
echo "$(pwd)/src/third_party/ninja" >> $GITHUB_PATH
- name: Fix siso
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: siso
deps-file: src/DEPS
installation-dir: src/third_party/siso/cipd
target-platform: ${{ inputs.target-platform }}
package: build/siso/${platform}
- name: Fixup angle git
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/angle

View File

@@ -17,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -60,10 +62,9 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data

View File

@@ -13,8 +13,9 @@ runs:
git config --global core.fscache true
git config --global core.longpaths true
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=274cba0474f0d1e4e6adbb66c1da48556cb0add5
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -97,7 +97,7 @@ runs:
$TEMP_DIR=New-Item -ItemType Directory -Path temp-cache
$TEMP_DIR_PATH = $TEMP_DIR.FullName
C:\ProgramData\Chocolatey\bin\7z.exe -y -snld x $src_cache -o"$TEMP_DIR_PATH"
C:\ProgramData\Chocolatey\bin\7z.exe -y -snld20 x $src_cache -o"$TEMP_DIR_PATH"
- name: Move Src Cache (Windows)
if: ${{ inputs.target-platform == 'win' }}

View File

@@ -9,11 +9,11 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
- name: Setting Up Dig Site
@@ -41,7 +41,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -16,11 +16,11 @@ jobs:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020 # v4.4.0
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
@@ -73,6 +73,7 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -19,7 +19,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -41,7 +41,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -64,7 +64,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -54,7 +54,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -86,11 +86,11 @@ jobs:
# Docs Only Jobs
docs-only:
needs: setup
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
# Checkout Jobs
@@ -111,7 +111,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -124,7 +124,7 @@ jobs:
checkout-linux:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-linux}}
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
@@ -141,7 +141,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -171,7 +171,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -189,13 +189,14 @@ jobs:
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
target-platform: linux
target-archs: x64 arm arm64
@@ -224,8 +225,8 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
test-runs-on: macos-13
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
is-release: false
@@ -243,8 +244,8 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
test-runs-on: macos-14
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
is-release: false
@@ -261,6 +262,7 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test-and-nan.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-amd64-4core
@@ -281,6 +283,7 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-amd64-4core
@@ -302,6 +305,7 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
@@ -322,9 +326,10 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
test-runs-on: ubuntu-22.04-arm
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm64v8-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
@@ -383,7 +388,7 @@ jobs:
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-centralus-windows-amd64-16core
test-runs-on: electron-hosted-windows-arm64-4core
test-runs-on: windows-11-arm
target-platform: win
target-arch: arm64
is-release: false

View File

@@ -37,7 +37,7 @@ jobs:
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}

View File

@@ -31,7 +31,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -50,7 +50,6 @@ jobs:
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
@@ -66,7 +65,6 @@ jobs:
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
@@ -82,6 +80,5 @@ jobs:
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit

View File

@@ -32,7 +32,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -47,7 +47,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -62,7 +62,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -77,7 +77,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -92,7 +92,7 @@ jobs:
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -12,6 +12,9 @@ concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
env:
GCLIENT_EXTRA_ARGS: --custom-var=checkout_arm=True --custom-var=checkout_arm64=True
jobs:
docs-only:
name: Docs Only Compile
@@ -20,7 +23,23 @@ jobs:
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AKS
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -23,7 +23,7 @@ jobs:
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -48,11 +48,6 @@ on:
required: true
type: string
default: '0'
strip-binaries:
description: 'Strip the binaries before release (Linux only)'
required: false
type: boolean
default: false
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
@@ -71,6 +66,7 @@ concurrency:
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
@@ -89,12 +85,13 @@ jobs:
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -118,7 +115,7 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
cache: yarn
@@ -162,7 +159,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -176,7 +173,7 @@ jobs:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: |
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }}
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
@@ -186,9 +183,6 @@ jobs:
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Setup Number of Ninja Processes
run: |
echo "NUMBER_OF_NINJA_PROCESSES=${{ inputs.target-platform != 'macos' && '300' || '200' }}" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
@@ -201,7 +195,6 @@ jobs:
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}
is-release: '${{ inputs.is-release }}'
generate-symbols: '${{ inputs.generate-symbols }}'
strip-binaries: '${{ inputs.strip-binaries }}'
upload-to-storage: '${{ inputs.upload-to-storage }}'
is-asan: '${{ inputs.is-asan }}'
- name: Set GN_EXTRA_ARGS for MAS Build

View File

@@ -44,7 +44,7 @@ jobs:
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +111,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -68,29 +68,16 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
- name: Install Git on Windows arm64 runners
if: ${{ inputs.target-arch == 'arm64' && inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
[System.Net.ServicePointManager]::SecurityProtocol = [System.Net.ServicePointManager]::SecurityProtocol -bor 3072
iex ((New-Object System.Net.WebClient).DownloadString('https://community.chocolatey.org/install.ps1'))
choco install -y --no-progress git.install --params "'/GitAndUnixToolsOnPath'"
choco install -y --no-progress git
choco install -y --no-progress python --version 3.11.9
choco install -y --no-progress visualstudio2022-workload-vctools --package-parameters "--add Microsoft.VisualStudio.Component.VC.Tools.ARM64"
echo "C:\Program Files\Git\cmd" | Out-File -FilePath $env:GITHUB_PATH -Encoding utf8 -Append
echo "C:\Program Files\Git\bin" | Out-File -FilePath $env:GITHUB_PATH -Encoding utf8 -Append
echo "C:\Python311" | Out-File -FilePath $env:GITHUB_PATH -Encoding utf8 -Append
cp "C:\Python311\python.exe" "C:\Python311\python3.exe"
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
configure_user_tccdb () {
local values=$1
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
@@ -111,11 +98,12 @@ jobs:
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
)
for values in "${userValuesArray[@]}"; do
# Sonoma and higher have a few extra values
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
if [ "$OSTYPE" = "darwin23" ]; then
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
else
@@ -126,12 +114,21 @@ jobs:
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
- name: Set xcode to 16.4
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
@@ -156,6 +153,7 @@ jobs:
git config --global core.fscache true
git config --global core.longpaths true
git config --global core.preloadindex true
git config --global core.longpaths true
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
@@ -169,39 +167,35 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
Expand-Archive -Force chromedriver.zip -DestinationPath ./
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
run: |
sudo security authorizationdb write com.apple.trust-settings.admin allow
cd src/electron
./script/codesign/generate-identity.sh
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
run: |
cd src/electron
@@ -231,7 +225,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -268,7 +262,7 @@ jobs:
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -46,7 +46,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +61,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -100,7 +100,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +115,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}

View File

@@ -19,7 +19,10 @@ jobs:
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@51f77329afa6477de8c49fc9c7046c15b9a4e79d # v3.29.5
uses: github/codeql-action/upload-sarif@4e94bd11f71e507f7f87df81788dff88d1dacbfb # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -19,7 +19,7 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: semantic-pull-request
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
with:

View File

@@ -16,7 +16,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,7 +27,7 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
@@ -39,7 +39,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -36,7 +36,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

2
.nvmrc
View File

@@ -1 +1 @@
20
22

130
BUILD.gn
View File

@@ -44,6 +44,7 @@ if (is_mac) {
if (is_linux) {
import("//build/config/linux/pkg_config.gni")
import("//electron/build/linux/strip_binary.gni")
import("//tools/generate_stubs/rules.gni")
pkg_config("gio_unix") {
@@ -585,7 +586,13 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -654,6 +661,7 @@ source_set("electron_lib") {
"//ui/events/devices/x11",
"//ui/events/platform/x11",
"//ui/gtk:gtk_config",
"//ui/linux:display_server_utils",
"//ui/linux:linux_ui",
"//ui/linux:linux_ui_factory",
"//ui/wm",
@@ -686,7 +694,7 @@ source_set("electron_lib") {
deps += [
"//components/app_launch_prefetch",
"//components/crash/core/app:crash_export_thunks",
"//ui/native_theme:native_theme_browser",
"//third_party/libxml:xml_writer",
"//ui/wm",
"//ui/wm/public",
]
@@ -1425,6 +1433,18 @@ dist_zip("electron_dist_zip") {
":licenses",
]
if (is_linux) {
if (is_official_build) {
data_deps += [
":strip_chrome_crashpad_handler",
":strip_chrome_sandbox",
":strip_electron_binary",
":strip_libEGL_shlib",
":strip_libGLESv2_shlib",
":strip_libffmpeg_shlib",
":strip_libvk_swiftshader_shlib",
]
}
data_deps += [ "//sandbox/linux:chrome_sandbox" ]
}
deps = data_deps
@@ -1470,6 +1490,16 @@ group("electron_mksnapshot") {
dist_zip("electron_mksnapshot_zip") {
data_deps = mksnapshot_deps
if (is_linux && is_official_build) {
data_deps += [
":strip_libEGL_shlib",
":strip_libGLESv2_shlib",
":strip_libffmpeg_shlib",
":strip_libvk_swiftshader_shlib",
":strip_mksnapshot_binary",
":strip_v8_context_snapshot_generator_binary",
]
}
deps = data_deps
outputs = [ "$root_build_dir/mksnapshot.zip" ]
}
@@ -1594,3 +1624,101 @@ group("copy_node_headers") {
group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"
symbol_output = "$root_out_dir/debug/$electron_project_name.debug"
compress_debug_sections = true
deps = [ ":electron_app" ]
}
strip_binary("strip_chrome_crashpad_handler") {
binary_input = "$root_out_dir/chrome_crashpad_handler"
symbol_output = "$root_out_dir/debug/chrome_crashpad_handler.debug"
compress_debug_sections = true
deps = [ "//components/crash/core/app:chrome_crashpad_handler" ]
}
strip_binary("strip_chrome_sandbox") {
binary_input = "$root_out_dir/chrome_sandbox"
symbol_output = "$root_out_dir/debug/chrome-sandbox.debug"
compress_debug_sections = true
deps = [ "//sandbox/linux:chrome_sandbox" ]
}
strip_binary("strip_libEGL_shlib") {
binary_input = "$root_out_dir/libEGL.so"
symbol_output = "$root_out_dir/debug/libEGL.so.debug"
compress_debug_sections = true
deps = [ "//third_party/angle:libEGL" ]
}
strip_binary("strip_libGLESv2_shlib") {
binary_input = "$root_out_dir/libGLESv2.so"
symbol_output = "$root_out_dir/debug/libGLESv2.so.debug"
compress_debug_sections = true
deps = [ "//third_party/angle:libGLESv2" ]
}
strip_binary("strip_libffmpeg_shlib") {
binary_input = "$root_out_dir/libffmpeg.so"
symbol_output = "$root_out_dir/debug/libffmpeg.so.debug"
compress_debug_sections = true
deps = [ "//third_party/ffmpeg" ]
}
strip_binary("strip_libvk_swiftshader_shlib") {
binary_input = "$root_out_dir/libvk_swiftshader.so"
symbol_output = "$root_out_dir/debug/libvk_swiftshader.so.debug"
compress_debug_sections = true
deps = [ "//third_party/swiftshader/src/Vulkan:swiftshader_libvulkan" ]
}
strip_binary("strip_mksnapshot_binary") {
_binary_path = rebase_path(
get_label_info(
":v8_context_snapshot_generator($v8_snapshot_toolchain)",
"root_out_dir") + "/mksnapshot",
root_build_dir)
binary_input = "$root_out_dir/$_binary_path"
symbol_output = "$root_out_dir/debug/${_binary_path}.debug"
compress_debug_sections = true
deps = mksnapshot_deps
}
strip_binary("strip_v8_context_snapshot_generator_binary") {
_binary_path = rebase_path(
get_label_info(
":v8_context_snapshot_generator($v8_snapshot_toolchain)",
"root_out_dir") + "/v8_context_snapshot_generator",
root_build_dir)
binary_input = "$root_out_dir/$_binary_path"
symbol_output = "$root_out_dir/debug/${_binary_path}.debug"
compress_debug_sections = true
deps = mksnapshot_deps
}
}

6
DEPS
View File

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'141.0.7350.0',
'144.0.7500.0',
'node_version':
'v22.18.0',
'v24.11.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':

View File

@@ -39,7 +39,7 @@ Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 139
node_module_version = 143
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"
@@ -19,15 +19,15 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false
dawn_enable_vulkan_validation_layers = false
# Removes dxc dll's that are only used experimentally.
# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
dawn_use_built_dxc = false
# These are disabled because they cause the zip manifest to differ between
# testing and release builds.
# See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.
@@ -70,6 +70,11 @@ v8_expose_public_symbols = true
# sensitive content by enterprise users.
enterprise_cloud_content_analysis = false
# Disable siso until we are ready to use it.
# https://chromium-review.googlesource.com/c/chromium/src/+/6638830
use_siso = false
# We don't use anything from here, and it causes target collisions
enable_linux_installer = false
# Disable "Save to Drive" feature in PDF viewer
enable_pdf_save_to_drive = false
# Explictly disable use_reclient until reclient is completely removed
use_reclient = false

View File

@@ -12,7 +12,7 @@ TEMPLATE_H = """
namespace electron::snapshot_checksum {
const std::string kChecksum = "{checksum}";
inline constexpr std::string_view kChecksum = "{checksum}";
} // namespace electron::snapshot_checksum

View File

@@ -0,0 +1,70 @@
# Copyright 2021 The Chromium Authors
# Use of this source code is governed by a BSD-style license that can be
# found in the LICENSE file.
# This has been adapted from https://source.chromium.org/chromium/chromium/src/+/main:build/linux/strip_binary.gni;drc=c220a41e0422d45f1657c28146d32e99cc53640b
# The notable difference is it has an option to compress the debug sections
import("//build/config/clang/clang.gni")
import("//build/toolchain/toolchain.gni")
# Extracts symbols from a binary into a symbol file.
#
# Args:
# binary_input: Path to the binary containing symbols to extract, e.g.:
# "$root_out_dir/chrome"
# symbol_output: Desired output file for symbols, e.g.:
# "$root_out_dir/chrome.debug"
# stripped_binary_output: Desired output file for stripped file, e.g.:
# "$root_out_dir/chrome.stripped"
# compress_debug_sections: If true, compress the extracted debug sections
template("strip_binary") {
forward_variables_from(invoker,
[
"deps",
"testonly",
])
action("${target_name}") {
llvm_strip_binary = "${clang_base_path}/bin/llvm-strip"
llvm_objcopy_binary = "${clang_base_path}/bin/llvm-objcopy"
script = "//electron/build/linux/strip_binary.py"
if (defined(invoker.stripped_binary_output)) {
stripped_binary_output = invoker.stripped_binary_output
} else {
stripped_binary_output = invoker.binary_input + ".stripped"
}
if (defined(invoker.symbol_output)) {
symbol_output = invoker.symbol_output
} else {
symbol_output = invoker.binary_input + ".debug"
}
inputs = [
invoker.binary_input,
llvm_strip_binary,
llvm_objcopy_binary,
]
outputs = [
symbol_output,
stripped_binary_output,
]
args = [
"--llvm-strip-binary-path",
rebase_path(llvm_strip_binary, root_build_dir),
"--llvm-objcopy-binary-path",
rebase_path(llvm_objcopy_binary, root_build_dir),
"--symbol-output",
rebase_path(symbol_output, root_build_dir),
"--stripped-binary-output",
rebase_path(stripped_binary_output, root_build_dir),
"--binary-input",
rebase_path(invoker.binary_input, root_build_dir),
]
if (defined(invoker.compress_debug_sections) &&
invoker.compress_debug_sections) {
args += [ "--compress-debug-sections" ]
}
}
}

View File

@@ -0,0 +1,63 @@
#!/usr/bin/env python3
#
# Copyright 2021 The Chromium Authors
# Use of this source code is governed by a BSD-style license that can be
# found in the LICENSE file.
# This has been adapted from https://source.chromium.org/chromium/chromium/src/+/main:build/linux/strip_binary.py;drc=c220a41e0422d45f1657c28146d32e99cc53640b
# The notable difference is it has an option to compress the debug sections
import argparse
import subprocess
import sys
def main() -> int:
parser = argparse.ArgumentParser(description="Strip binary using LLVM tools.")
parser.add_argument("--llvm-strip-binary-path",
help="Path to llvm-strip executable.")
parser.add_argument("--llvm-objcopy-binary-path",
required=True,
help="Path to llvm-objcopy executable.")
parser.add_argument("--binary-input", help="Input ELF binary.")
parser.add_argument("--symbol-output",
help="File to write extracted debug info (.debug).")
parser.add_argument("--compress-debug-sections",
action="store_true",
help="Compress extracted debug info.")
parser.add_argument("--stripped-binary-output",
help="File to write stripped binary.")
args = parser.parse_args()
# Replicate the behavior of:
# eu-strip <binary_input> -o <stripped_binary_output> -f <symbol_output>
objcopy_args = [
"--only-keep-debug",
args.binary_input,
args.symbol_output,
]
if args.compress_debug_sections:
objcopy_args.insert(0, "--compress-debug-sections")
subprocess.check_output([args.llvm_objcopy_binary_path] + objcopy_args)
subprocess.check_output([
args.llvm_strip_binary_path,
"--strip-debug",
"--strip-unneeded",
"-o",
args.stripped_binary_output,
args.binary_input,
])
subprocess.check_output([
args.llvm_objcopy_binary_path,
f"--add-gnu-debuglink={args.symbol_output}",
args.stripped_binary_output,
])
return 0
if __name__ == "__main__":
sys.exit(main())

View File

@@ -3,7 +3,7 @@
load("@builtin//struct.star", "module")
def __platform_properties(ctx):
container_image = "docker://gcr.io/chops-public-images-prod/rbe/siso-chromium/linux@sha256:ef35d347f4a4a2d32b76fd908e66e96f59bf8ba7379fd5626548244c45343b2b"
container_image = "docker://gcr.io/chops-public-images-prod/rbe/siso-chromium/linux@sha256:d7cb1ab14a0f20aa669c23f22c15a9dead761dcac19f43985bf9dd5f41fbef3a"
return {
"default": {
"OSFamily": "Linux",

66
build/siso/main.star Normal file
View File

@@ -0,0 +1,66 @@
load("@builtin//encoding.star", "json")
load("@builtin//path.star", "path")
load("@builtin//runtime.star", "runtime")
load("@builtin//struct.star", "module")
load("@config//main.star", upstream_init = "init")
load("@config//win_sdk.star", "win_sdk")
load("@config//gn_logs.star", "gn_logs")
def init(ctx):
mod = upstream_init(ctx)
step_config = json.decode(mod.step_config)
# Buildbarn doesn't support input_root_absolute_path so disable that
for rule in step_config["rules"]:
input_root_absolute_path = rule.get("input_root_absolute_path", False)
if input_root_absolute_path:
rule.pop("input_root_absolute_path", None)
# Only wrap clang rules with a remote wrapper if not on Linux. These are currently only
# needed for X-Compile builds, which run on Windows and Mac.
if runtime.os != "linux":
for rule in step_config["rules"]:
if rule["name"].startswith("clang/") or rule["name"].startswith("clang-cl/"):
rule["remote_wrapper"] = "../../buildtools/reclient_cfgs/chromium-browser-clang/clang_remote_wrapper"
if "inputs" not in rule:
rule["inputs"] = []
rule["inputs"].append("buildtools/reclient_cfgs/chromium-browser-clang/clang_remote_wrapper")
rule["inputs"].append("third_party/llvm-build/Release+Asserts_linux/bin/clang")
if "executables" not in step_config:
step_config["executables"] = []
step_config["executables"].append("buildtools/reclient_cfgs/chromium-browser-clang/clang_remote_wrapper")
step_config["executables"].append("third_party/llvm-build/Release+Asserts_linux/bin/clang")
if runtime.os == "darwin":
# Update platforms to match our default siso config instead of reclient configs.
step_config["platforms"].update({
"clang": step_config["platforms"]["default"],
"clang_large": step_config["platforms"]["default"],
})
if runtime.os == "windows":
# Add additional Windows SDK headers needed by Electron
win_toolchain_dir = win_sdk.toolchain_dir(ctx)
if win_toolchain_dir:
sdk_version = gn_logs.read(ctx).get("windows_sdk_version")
step_config["input_deps"][win_toolchain_dir + ":headers"].extend([
# third_party/electron_node/deps/uv/include/uv/win.h includes mswsock.h
path.join(win_toolchain_dir, "Windows Kits/10/Include", sdk_version, "um/mswsock.h"),
# third_party/electron_node/src/debug_utils.cc includes lm.h
path.join(win_toolchain_dir, "Windows Kits/10/Include", sdk_version, "um/Lm.h"),
])
# Update platforms to match our default siso config instead of reclient configs.
step_config["platforms"].update({
"clang-cl": step_config["platforms"]["default"],
"clang-cl_large": step_config["platforms"]["default"],
"lld-link": step_config["platforms"]["default"],
})
return module(
"config",
step_config = json.encode(step_config),
filegroups = mod.filegroups,
handlers = mod.handlers,
)

View File

@@ -41,6 +41,8 @@ PATHS_TO_SKIP = [
'resources/inspector',
'gen/third_party/devtools-frontend/src',
'gen/ui/webui',
# Skip because these get zipped separately in script/zip-symbols.py
'debug',
]
def skip_path(dep, dist_zip, target_cpu):
@@ -80,6 +82,11 @@ def main(argv):
dep = dep.strip()
if not skip_path(dep, dist_zip, target_cpu):
dist_files.add(dep)
# On Linux, filter out any files which have a .stripped companion
if sys.platform == 'linux':
dist_files = {
dep for dep in dist_files if f"{dep.removeprefix('./')}.stripped" not in dist_files
}
if sys.platform == 'darwin' and not should_flatten:
execute(['zip', '-r', '-y', dist_zip] + list(dist_files))
else:
@@ -96,10 +103,13 @@ def main(argv):
dirname = os.path.dirname(dep)
arcname = (
os.path.join(dirname, 'chrome-sandbox')
if basename == 'chrome_sandbox'
if basename.removesuffix('.stripped') == 'chrome_sandbox'
else dep
)
name_to_write = arcname
# On Linux, strip the .stripped suffix from the name before zipping
if sys.platform == 'linux':
name_to_write = name_to_write.removesuffix('.stripped')
if should_flatten:
if flatten_relative_to:
if name_to_write.startswith(flatten_relative_to):

View File

@@ -23,6 +23,8 @@ static_library("chrome") {
"//chrome/browser/browser_process.h",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
"//chrome/browser/devtools/devtools_eye_dropper.cc",

View File

@@ -421,6 +421,7 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.
@@ -1214,6 +1215,13 @@ Disables hardware acceleration for current app.
This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently disabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.
### `app.disableDomainBlockingFor3DAPIs()`
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
@@ -1397,7 +1405,75 @@ details. Disabled by default.
This API must be called after the `ready` event is emitted.
> [!NOTE]
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
Notes:
* The array may be empty if no accessibility modes are active.
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
prefer this method for granular diagnostics or telemetry.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
// Change some app UI to better work with Screen Readers.
}
})
```
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
* `features` string[] - An array of the accessibility features to enable.
Possible values are:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
To disable all supported features, pass an empty array `[]`.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
// Enable a subset of features:
app.setAccessibilitySupportFeatures([
'screenReader',
'pdfPrinting',
'webContents'
])
// Other logic
// Some time later, disable all features:
app.setAccessibilitySupportFeatures([])
})
```
### `app.showAboutPanel()`

View File

@@ -1262,15 +1262,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1284,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -1442,15 +1442,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1463,11 +1464,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_
@@ -1570,11 +1574,18 @@ events.
Prevents the window contents from being captured by other apps.
On macOS it sets the NSWindow's [`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc) to [`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
On Windows it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
On Windows, it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
For Windows 10 version 2004 and up the window will be removed from capture entirely,
older Windows versions behave as if `WDA_MONITOR` is applied capturing a black window.
On macOS, it sets the `NSWindow`'s
[`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc)
to
[`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
Unfortunately, due to an intentional change in macOS, newer Mac applications that use
`ScreenCaptureKit` will capture your window despite `win.setContentProtection(true)`.
See [here](https://github.com/electron/electron/issues/48258#issuecomment-3269893618).
#### `win.isContentProtected()` _macOS_ _Windows_
Returns `boolean` - whether or not content protection is currently enabled.

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
On Linux, there is also a `selection` clipboard. To manipulate it
you need to pass `selection` to each method:

View File

@@ -86,7 +86,7 @@ Field trials to be forcefully enabled or disabled.
For example: `WebRTC-Audio-Red-For-Opus/Enabled/`
### --host-rules=`rules`
### --host-rules=`rules` _Deprecated_
A comma-separated list of `rules` that control how hostnames are mapped.
@@ -104,9 +104,23 @@ These mappings apply to the endpoint host in a net request (the TCP connect
and host resolver in a direct connection, and the `CONNECT` in an HTTP proxy
connection, and the endpoint host in a `SOCKS` proxy connection).
**Deprecated:** Use the `--host-resolver-rules` switch instead.
### --host-resolver-rules=`rules`
Like `--host-rules` but these `rules` only apply to the host resolver.
A comma-separated list of `rules` that control how hostnames are mapped.
For example:
* `MAP * 127.0.0.1` Forces all hostnames to be mapped to 127.0.0.1
* `MAP *.google.com proxy` Forces all google.com subdomains to be resolved to
"proxy".
* `MAP test.com [::1]:77` Forces "test.com" to resolve to IPv6 loopback. Will
also force the port of the resulting socket address to be 77.
* `MAP * baz, EXCLUDE www.google.com` Remaps everything to "baz", except for
"www.google.com".
These `rules` only apply to the host resolver.
### --ignore-certificate-errors
@@ -179,6 +193,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The following is an example of setting up Electron to automatically submit
crash reports to a remote server:

View File

@@ -102,6 +102,10 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
## Caveats
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -186,14 +186,3 @@ the one downloaded by `npm install`. Usage:
```sh
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
## Set By Electron
Electron sets some variables in your environment at runtime.
### `ORIGINAL_XDG_CURRENT_DESKTOP`
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
to affect other logic within Chromium so if you want access to the _original_ value
you should look up this environment variable instead.

View File

@@ -20,6 +20,12 @@ changes:
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `ipcRenderer` module is an [EventEmitter][event-emitter]. It provides a few
methods so you can send synchronous and asynchronous messages from the render
process (web page) to the main process. You can also receive replies from the

View File

@@ -1,3 +1,5 @@
# MenuItem
## Class: MenuItem
> Add items to native application menus and context menus.

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `nativeImage` module provides a unified interface for manipulating
system images. These can be handy if you want to provide multiple scaled
versions of the same icon or take advantage of macOS [template images][template-image].

View File

@@ -211,6 +211,10 @@ Returns `Object`:
system.
* `free` Integer - The total amount of memory not being used by applications or disk
cache.
* `fileBacked` Integer _macOS_ - The amount of memory that currently has been paged out to storage.
Includes memory for file caches, network buffers, and other system services.
* `purgeable` Integer _macOS_ - The amount of memory that is marked as "purgeable". The system can reclaim it
if memory pressure increases.
* `swapTotal` Integer _Windows_ _Linux_ - The total amount of swap memory in Kilobytes available to the
system.
* `swapFree` Integer _Windows_ _Linux_ - The free amount of swap memory in Kilobytes available to the

View File

@@ -1,11 +1,7 @@
# ServiceWorkerMain
## Class: ServiceWorkerMain
> An instance of a Service Worker representing a version of a script for a given scope.
Process: [Main](../glossary.md#main-process)
## Class: ServiceWorkerMain
Process: [Main](../glossary.md#main-process)<br />
_This class is not exported from the `'electron'` module. It is only available as a return value of other methods in the Electron API._

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session
@@ -939,14 +939,18 @@ session.fromPartition('some-partition').setPermissionRequestHandler((webContents
* `top-level-storage-access` - Allow top-level sites to request third-party cookie access on behalf of embedded content originating from another site in the same related website set using the [Storage Access API](https://developer.mozilla.org/en-US/docs/Web/API/Storage_Access_API).
* `usb` - Expose non-standard Universal Serial Bus (USB) compatible devices services to the web with the [WebUSB API](https://developer.mozilla.org/en-US/docs/Web/API/WebUSB_API).
* `deprecated-sync-clipboard-read` _Deprecated_ - Request access to run `document.execCommand("paste")`
* `fileSystem` - Access to read, write, and file management capabilities using the [File System API](https://developer.mozilla.org/en-US/docs/Web/API/File_System_API).
* `requestingOrigin` string - The origin URL of the permission check
* `details` Object - Some properties are only available on certain permission types.
* `embeddingOrigin` string (optional) - The origin of the frame embedding the frame that made the permission check. Only set for cross-origin sub frames making permission checks.
* `securityOrigin` string (optional) - The security origin of the `media` check.
* `mediaType` string (optional) - The type of media access being requested, can be `video`,
`audio` or `unknown`
`audio` or `unknown`.
* `requestingUrl` string (optional) - The last URL the requesting frame loaded. This is not provided for cross-origin sub frames making permission checks.
* `isMainFrame` boolean - Whether the frame making the request is the main frame
* `isMainFrame` boolean - Whether the frame making the request is the main frame.
* `filePath` string (optional) - The path of a `fileSystem` request.
* `isDirectory` boolean (optional) - Whether a `fileSystem` request is a directory.
* `fileAccessType` string (optional) - The access type of a `fileSystem` request. Can be `writable` or `readable`.
Sets the handler which can be used to respond to permission checks for the `session`.
Returning `true` will allow the permission and `false` will reject it. Please note that
@@ -968,6 +972,9 @@ session.fromPartition('some-partition').setPermissionCheckHandler((webContents,
})
```
> [!NOTE]
> `isMainFrame` will always be `false` for a `fileSystem` request as a result of Chromium limitations.
#### `ses.setDisplayMediaRequestHandler(handler[, opts])`
* `handler` Function | null

View File

@@ -102,9 +102,10 @@
should have rounded corners. Default is `true`. Setting this property
to `false` will prevent the window from being fullscreenable on macOS.
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
* `thickFrame` boolean (optional) - Use `WS_THICKFRAME` style for frameless windows on
Windows, which adds standard window frame. Setting it to `false` will remove
window shadow and window animations. Default is `true`.
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
frameless windows on Windows, which adds the standard window frame. Setting it
to `false` will remove window shadow and window animations, and disable window
resizing via dragging the window edges. Default is `true`.
* `vibrancy` string (optional) _macOS_ - Add a type of vibrancy effect to
the window, only on macOS. Can be `appearance-based`, `titlebar`, `selection`,
`menu`, `popover`, `sidebar`, `header`, `sheet`, `window`, `hud`, `fullscreen-ui`,

View File

@@ -2,7 +2,10 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.

View File

@@ -8,6 +8,7 @@
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` Integer - The exit code of the process, unless `reason` is
`launch-failed`, in which case `exitCode` will be a platform-specific
launch failure error code.

View File

@@ -21,7 +21,9 @@
associated with the window, making it compatible with the Chromium
OS-level sandbox and disabling the Node.js engine. This is not the same as
the `nodeIntegration` option and the APIs available to the preload script
are more limited. Read more about the option [here](../../tutorial/sandbox.md).
are more limited. Default is `true` since Electron 20. The sandbox will
automatically be disabled when `nodeIntegration` is set to `true`.
Read more about the option [here](../../tutorial/sandbox.md).
* `session` [Session](../session.md#class-session) (optional) - Sets the session used by the
page. Instead of passing the Session object directly, you can also choose to
use the `partition` option instead, which accepts a partition string. When
@@ -87,6 +89,11 @@
paint event. Defaults to `false`. See the
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
more details.
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
the specified `preload` script in a separate JavaScript context. Defaults
to `true`. The context that the `preload` script runs in will only have

View File

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
The `systemPreferences` object emits the following events:
### Event: 'accent-color-changed' _Windows_
### Event: 'accent-color-changed' _Windows_ _Linux_
Returns:
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
or global value of a `key` previously set with `setUserDefault`.
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
### `systemPreferences.getAccentColor()`
Returns `string` - The users current system wide accent color preference in RGBA
hexadecimal form.

View File

@@ -4,6 +4,12 @@
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
`webFrame` export of the Electron module is an instance of the `WebFrame`
class representing the current frame. Sub-frames can be retrieved by
certain properties and methods (e.g. `webFrame.firstChild`).
@@ -139,7 +145,7 @@ by its key, which is returned from `webFrame.insertCSS(css)`.
Inserts `text` to the focused element.
### `webFrame.executeJavaScript(code[, userGesture, callback])`
### `webFrame.executeJavaScript(code[, userGesture][, callback])`
* `code` string
* `userGesture` boolean (optional) - Default is `false`.
@@ -160,7 +166,7 @@ In the browser window some HTML APIs like `requestFullScreen` can only be
invoked by a gesture from the user. Setting `userGesture` to `true` will remove
this limitation.
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture, callback])`
### `webFrame.executeJavaScriptInIsolatedWorld(worldId, scripts[, userGesture][, callback])`
* `worldId` Integer - The ID of the world to run the javascript
in, `0` is the default main world (where content runs), `999` is the

View File

@@ -4,6 +4,12 @@
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
## Methods
The `webUtils` module has the following methods:
@@ -17,11 +23,27 @@ Returns `string` - The file system path that this `File` object points to. In th
This method superseded the previous augmentation to the `File` object with the `path` property. An example is included below.
```js @ts-nocheck
// Before
const oldPath = document.querySelector('input').files[0].path
// After
const { webUtils } = require('electron')
const newPath = webUtils.getPathForFile(document.querySelector('input').files[0])
// Before (renderer)
const oldPath = document.querySelector('input[type=file]').files[0].path
```
```js @ts-nocheck
// After
// Renderer:
const file = document.querySelector('input[type=file]').files[0]
electronApi.doSomethingWithFile(file)
// Preload script:
const { contextBridge, webUtils } = require('electron')
contextBridge.exposeInMainWorld('electronApi', {
doSomethingWithFile (file) {
const path = webUtils.getPathForFile(file)
// Do something with the path, e.g., send it over IPC to the main process.
// It's best not to expose the full file path to the web content if possible.
}
})
```

View File

@@ -39,8 +39,8 @@ consider using `webContents.setWindowOpenHandler` to customize the
BrowserWindow creation.
A subset of [`WebPreferences`](structures/web-preferences.md) can be set directly,
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `preload`,
`javascript`, `contextIsolation`, and `webviewTag`.
unnested, from the features string: `zoomFactor`, `nodeIntegration`, `javascript`,
`contextIsolation`, and `webviewTag`.
For example:

View File

@@ -14,21 +14,48 @@ This document uses the following convention to categorize breaking changes:
## Planned Breaking API Changes (39.0)
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` evironment variable
### Deprecated: `--host-rules` command line switch
The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426) in Electron 38.
Chromium is deprecating the `--host-rules` switch.
You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
You should use `--host-resolver-rules` instead.
### Behavior Changed: window.open popups are always resizable
Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
To restore previous behavior:
```js
webContents.setWindowOpenHandler((details) => {
return {
action: 'allow',
overrideBrowserWindowOptions: {
resizable: details.features.includes('resizable=yes')
}
}
})
```
### Behavior Changed: shared texture OSR `paint` event data structure
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
## Planned Breaking API Changes (38.0)
### Deprecated: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
The default value of the `--ozone-platform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
Electron now defaults to running as a native Wayland app when launched in a Wayland session (when `XDG_SESSION_TYPE=wayland`).
Users can force XWayland by passing `--ozone-platform=x11`.
This environment variable will be [removed soon](https://chromium-review.googlesource.com/c/chromium/src/+/6819616).
### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overriden and now reflects the actual desktop environment.
### Removed: macOS 11 support
@@ -53,29 +80,6 @@ The `webFrame.findFrameByRoutingId(routingId)` function will be removed.
You should use `webFrame.findFrameByToken(frameToken)` instead.
### Behavior Changed: window.open popups are always resizable
Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
To restore previous behavior:
```js
webContents.setWindowOpenHandler((details) => {
return {
action: 'allow',
overrideBrowserWindowOptions: {
resizable: details.features.includes('resizable=yes')
}
}
})
```
### Behavior Changed: shared texture OSR `paint` event data structure
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
See [here](https://www.electronjs.org/docs/latest/api/structures/offscreen-shared-texture) for more details.
## Planned Breaking API Changes (37.0)
### Utility Process unhandled rejection behavior change

View File

@@ -191,12 +191,6 @@ $ ./out/Testing/electron
### Packaging
On linux, first strip the debugging and symbol information:
```sh
$ electron/script/strip-binaries.py -d out/Release
```
To package the electron build as a distributable zip file:
```sh

View File

@@ -12,19 +12,28 @@ network problems. The best resolution is to try switching networks, or
wait a bit and try installing again.
You can also attempt to download Electron directly from
[electron/electron/releases](https://github.com/electron/electron/releases)
[GitHub Releases](https://github.com/electron/electron/releases)
if installing via `npm` is failing.
## When will Electron upgrade to latest Chrome?
If you need to install Electron through a custom mirror or proxy, see
the [Advanced Installation](./tutorial/installation.md) documentation for more details.
The Chrome version of Electron is usually bumped within one or two weeks after
a new stable Chrome version gets released. This estimate is not guaranteed and
depends on the amount of work involved with upgrading.
## How are Electron binaries downloaded?
Only the stable channel of Chrome is used. If an important fix is in beta or dev
channel, we will back-port it.
When you run `npm install electron`, the Electron binary for the corresponding version is downloaded
into your project's `node_modules` folder via npm's `postinstall` lifecycle script.
For more information, please see the [security introduction](tutorial/security.md).
This logic is handled by the [`@electron/get`](https://github.com/electron/get) utility package
under the hood.
## When will Electron upgrade to latest Chromium?
Every new major version of Electron releases with a Chromium major version upgrade. By releasing every
8 weeks, Electron is able to pull in every other major Chromium release on the very same day that it
releases upstream. Security fixes will be backported to stable release channels ahead of time.
See the [Electron Releases](./tutorial/electron-timelines.md) documentation for more details or
[releases.electronjs.org](https://releases.electronjs.org) to see our Release Status dashboard.
## When will Electron upgrade to latest Node.js?

View File

@@ -12,6 +12,15 @@ The ASAR format was created primarily to improve performance on Windows when
reading large quantities of small files (e.g. when loading your app's JavaScript
dependency tree from `node_modules`).
### ASAR integrity
ASAR integrity is an security feature that validates the contents of your app's
ASAR archives at runtime. When enabled, your Electron app will verify the
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
hashes, the app will forcefully terminate.
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
### code signing
Code signing is a process where an app developer digitally signs their code to

View File

@@ -5,7 +5,7 @@ slug: asar-integrity
hide_title: false
---
ASAR integrity is an experimental feature that validates the contents of your app's
ASAR integrity is a security feature that validates the contents of your app's
[ASAR archives](./asar-archives.md) at runtime.
## Version support
@@ -64,13 +64,10 @@ flipFuses(
)
```
:::tip Fuses in Electron Forge
With Electron Forge, you can configure your app's fuses with
[@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
in your Forge configuration file.
:::
> [!TIP]
> With Electron Forge, you can configure your app's fuses with
> [@electron-forge/plugin-fuses](https://www.electronforge.io/config/plugins/fuses)
> in your Forge configuration file.
## Providing the header hash
@@ -80,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
### Using Electron tooling
Electron Forge and Electron Packager do this setup automatically for you with no additional
configuration. The minimum required versions for ASAR integrity are:
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
* `@electron/packager@18.3.1`
* `@electron/forge@7.4.0`
@@ -109,7 +106,7 @@ Valid `algorithm` values are currently `SHA256` only. The `hash` is a hash of th
The `@electron/asar` package exposes a `getRawHeader` method whose result can then be hashed to generate this value
(e.g. using the [`node:crypto`](https://nodejs.org/api/crypto.html) module).
### Windows
#### Windows
When packaging for Windows, you must populate a valid [resource](https://learn.microsoft.com/en-us/windows/win32/menurc/resources)
entry of type `Integrity` and name `ElectronAsar`. The value of this resource should be a JSON encoded dictionary
@@ -125,9 +122,6 @@ in the form included below:
]
```
:::info
For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
in the Electron Packager code.
:::
> [!NOTE]
> For an implementation example, see [`src/resedit.ts`](https://github.com/electron/packager/blob/main/src/resedit.ts)
> in the Electron Packager code.

View File

@@ -233,10 +233,10 @@ can find [its documentation here](https://www.electron.build/code-signing).
[Azure Trusted Signing][] is Microsoft's modern cloud-based alternative to EV certificates.
It is the cheapest option for code signing on Windows, and it gets rid of SmartScreen warnings.
As of May 2025, Azure Trusted Signing is [available][trusted-signing-availability] to US and
Canada-based organizations with 3+ years of verifiable business history. Microsoft is looking
to make the program more widely available. If you're reading this at a later point, it could
make sense to check if the eligibility criteria have changed.
As of October 2025, Azure Trusted Signing is available to US and Canada-based organizations
with 3+ years of verifiable business history and to individual developers in the US and Canada.
Microsoft is looking to make the program more widely available. If you're reading this at a
later point, it could make sense to check if the eligibility criteria have changed.
#### Using Electron Forge
@@ -267,6 +267,5 @@ See the [Windows Store Guide][].
[maker-squirrel]: https://www.electronforge.io/config/makers/squirrel.windows
[maker-msi]: https://www.electronforge.io/config/makers/wix-msi
[azure trusted signing]: https://azure.microsoft.com/en-us/products/trusted-signing
[trusted-signing-availability]: https://techcommunity.microsoft.com/blog/microsoft-security-blog/trusted-signing-public-preview-update/4399713
[forge-trusted-signing]: https://www.electronforge.io/guides/code-signing/code-signing-windows#using-azure-trusted-signing
[builder-trusted-signing]: https://www.electron.build/code-signing-win#using-azure-trusted-signing-beta

View File

@@ -9,10 +9,12 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
| Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
| ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | TBD | ✅ |
| 40.0.0 | 2025-Oct-30 | 2025-Dec-03 | 2025-Oct-28 | 2026-Jun-30 | M144 | TBD | ✅ |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
| 37.0.0 | 2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | |
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
| 34.0.0 | 2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
| 33.0.0 | 2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
| 32.0.0 | 2024-Jun-14 | 2024-Jul-24 | 2024-Aug-20 | 2025-Mar-04 | M128 | v20.16 | 🚫 |
@@ -120,22 +122,3 @@ and that number is reduced to two in major version 10, the three-argument versio
continue to work until, at minimum, major version 12. Past the minimum two-version
threshold, we will attempt to support backwards compatibility beyond two versions
until the maintainers feel the maintenance burden is too high to continue doing so.
### End-of-life
When a release branch reaches the end of its support cycle, the series
will be deprecated in NPM and a final end-of-support release will be
made. This release will add a warning to inform that an unsupported
version of Electron is in use.
These steps are to help app developers learn when a branch they're
using becomes unsupported, but without being excessively intrusive
to end users.
If an application has exceptional circumstances and needs to stay
on an unsupported series of Electron, developers can silence the
end-of-support warning by omitting the final release from the app's
`package.json` `devDependencies`. For example, since the 1-6-x series
ended with an end-of-support 1.6.18 release, developers could choose
to stay in the 1-6-x series without warnings with `devDependency` of
`"electron": 1.6.0 - 1.6.17`.

View File

@@ -32,7 +32,7 @@ This table gives a general overview of where ESM is supported and which ESM load
| Main | Node.js | N/A | <ul><li> [You must use `await` generously before the app's `ready` event](#you-must-use-await-generously-before-the-apps-ready-event) </li></ul> |
| Renderer (Sandboxed) | Chromium | Unsupported | <ul><li> [Sandboxed preload scripts can't use ESM imports](#sandboxed-preload-scripts-cant-use-esm-imports) </li></ul> |
| Renderer (Unsandboxed & Context Isolated) | Chromium | Node.js | <ul><li> [Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content) </li> <li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li><li>[ESM preload scripts must be context isolated to use dynamic Node.js ESM imports](#esm-preload-scripts-must-be-context-isolated-to-use-dynamic-nodejs-esm-imports)</li></ul> |
| Renderer (Unsandboxed & Non Context Isolated) | Chromium | Node.js | <ul><li>[Unsandboxed ESM preload scripts will run after page load on pages with no content](#unsandboxed-esm-preload-scripts-will-run-after-page-load-on-pages-with-no-content)</li><li>[ESM Preload Scripts must have the `.mjs` extension](#esm-preload-scripts-must-have-the-mjs-extension)</li></ul> |
## Main process

View File

@@ -4,11 +4,24 @@
## What are fuses?
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
From a security perspective, it makes sense to disable certain unused Electron features
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
subset of "living off the land" attacks.
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
We also don't want Electron consumers forking to achieve this goal, as building from source and
maintaining a fork is a massive technical challenge and costs a lot of time and money.
## Current Fuses
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
Because they are flipped at package time before you code sign your app, the OS becomes responsible
for ensuring those bits aren't flipped back via OS-level code signing validation
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
on Windows).
## Current fuses
### `runAsNode`
@@ -16,7 +29,11 @@ Fuses are the solution to this problem, at a high level they are "magic bits" in
**@electron/fuses:** `FuseV1Options.RunAsNode`
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
as expected, as it depends on this environment variable to function. Instead, we recommend that you
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
standalone Node.js process (e.g. a SQLite server process).
### `cookieEncryption`
@@ -24,7 +41,12 @@ The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variab
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
### `nodeOptions`
@@ -32,7 +54,11 @@ The cookieEncryption fuse toggles whether the cookie store on disk is encrypted
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
Most apps can safely disable this fuse.
### `nodeCliInspect`
@@ -40,7 +66,9 @@ The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
inspector. Most apps can safely disable this fuse.
### `embeddedAsarIntegrityValidation`
@@ -48,9 +76,12 @@ The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. f
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
Most apps can safely enable this fuse.
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
### `onlyLoadAppFromAsar`
@@ -58,7 +89,15 @@ For more information on how to use asar integrity validation please read the [As
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
By default, Electron will search for this code in the following order:
1. `app.asar`
1. `app`
1. `default_app.asar`
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
it is impossible to load non-validated code.
### `loadBrowserProcessSpecificV8Snapshot`
@@ -66,11 +105,17 @@ The onlyLoadAppFromAsar fuse changes the search system that Electron uses to loc
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
initialized heaps and then load them back in to avoid the cost of initializing the heap.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
Other processes will use the V8 snapshot file that they normally do.
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
Using separate snapshots for renderer processes and the main process can improve security, especially
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
### `grantFileProtocolExtraPrivileges`
@@ -78,19 +123,25 @@ Using separate snapshots for renderer processes and the main process can improve
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
are given privileges beyond what they would receive in a traditional web browser. This behavior was
core to Electron apps in original versions of Electron, but is no longer required as apps should be
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
If you aren't serving pages from `file://`, you should disable this fuse.
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
* `file://` protocol pages can use `fetch` to load other assets over `file://`
* `file://` protocol pages can use service workers
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
* `file://` protocol pages have universal access granted to child frames also running on `file://`
protocols regardless of sandbox settings
## How do I flip the fuses?
## How do I flip fuses?
### The easy way
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
```js @ts-nocheck
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -106,29 +157,37 @@ flipFuses(
)
```
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
app using the `@electron/fuses` CLI.
```bash
npx @electron/fuses read --app /Applications/Foo.app
```
>[!NOTE]
> If you are using Electron Forge to distribute your application, you can flip fuses using
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
> which comes pre-installed with all templates.
### The hard way
#### Quick Glossary
> [!IMPORTANT]
> Glossary:
>
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
> * **Fuse Schema**: The format/allowed values for the fuse wire
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
* **Fuse Schema**: The format / allowed values for the fuse wire
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
sequence of bytes that represent the state of the fuses you want.
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
```text
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
```
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -136,6 +195,6 @@ Somewhere in the Electron binary there will be a sequence of bytes that look lik
* "1" (0x31) indicates the fuse is enabled
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

View File

@@ -26,12 +26,12 @@ any dependencies in your app will not be installed.
## Customization
If you want to change the architecture that is downloaded (e.g., `ia32` on an
`x64` machine), you can use the `--arch` flag with npm install or set the
If you want to change the architecture that is downloaded (e.g., `x64` on an
`arm64` machine), you can use the `--arch` flag with npm install or set the
`npm_config_arch` environment variable:
```shell
npm install --arch=ia32 electron
npm install --arch=x64 electron
```
In addition to changing the architecture, you can also specify the platform
@@ -60,7 +60,7 @@ where `$VERSION` is the exact version of Electron).
If you are unable to access GitHub or you need to provide a custom build, you
can do so by either providing a mirror or an existing cache directory.
#### Mirror
### Mirror
You can use environment variables to override the base URL, the path at which to
look for Electron binaries, and the binary filename. The URL used by `@electron/get`
@@ -95,7 +95,7 @@ Electron release you may have to set `electron_use_remote_checksums=1` directly,
or configure it in a `.npmrc` file, to force Electron to use the remote `SHASUMS256.txt`
file to verify the checksum instead of the embedded checksums.
#### Cache
### Cache
Alternatively, you can override the local cache. `@electron/get` will cache
downloaded binaries in a local directory to not stress your network. You can use
@@ -120,7 +120,7 @@ The cache contains the version's official zip file as well as a checksum, and is
│ └── electron-v15.3.1-darwin-x64.zip
```
## Skip binary download
## Postinstall script
Under the hood, Electron's JavaScript API binds to a binary that contains its
implementations. Because this binary is crucial to the function of any Electron app,

View File

@@ -2,15 +2,15 @@
## Overview
[Online and offline event](https://developer.mozilla.org/en-US/docs/Online_and_offline_events)
detection can be implemented in the Renderer process using the
[`navigator.onLine`](http://html5index.org/Offline%20-%20NavigatorOnLine.html)
attribute, part of standard HTML5 API.
Online and offline event detection can be implemented in both the main and renderer processes:
- **Renderer process**: Use the [`navigator.onLine`](http://html5index.org/Offline%20-%20NavigatorOnLine.html) attribute and [online/offline events](https://developer.mozilla.org/en-US/docs/Online_and_offline_events), part of standard HTML5 API.
- **Main process**: Use the [`net.isOnline()`](../api/net.md#netisonline) method or the [`net.online`](../api/net.md#netonline-readonly) property.
The `navigator.onLine` attribute returns:
* `false` if all network requests are guaranteed to fail (e.g. when disconnected from the network).
* `true` in all other cases.
- `false` if all network requests are guaranteed to fail (e.g. when disconnected from the network).
- `true` in all other cases.
Since many cases return `true`, you should treat with care situations of
getting false positives, as we cannot always assume that `true` value means
@@ -19,7 +19,27 @@ is running a virtualization software that has virtual Ethernet adapters in "alwa
connected" state. Therefore, if you want to determine the Internet access
status of Electron, you should develop additional means for this check.
## Example
## Main Process Detection
In the main process, you can use the `net` module to detect online/offline status:
```js
const { net } = require('electron')
// Method 1: Using net.isOnline()
const isOnline = net.isOnline()
console.log('Online status:', isOnline)
// Method 2: Using net.online property
console.log('Online status:', net.online)
```
Both `net.isOnline()` and `net.online` return the same boolean value with the same reliability characteristics as `navigator.onLine` - they provide a strong indicator when offline (`false`), but a `true` value doesn't guarantee successful internet connectivity.
> [!NOTE]
> The `net` module is only available after the app emits the `ready` event.
## Renderer Process Example
Starting with an HTML file `index.html`, this example will demonstrate how the `navigator.onLine` API can be used to build a connection status indicator.
@@ -84,4 +104,4 @@ After launching the Electron application, you should see the notification:
![Connection status](../images/connection-status.png)
> [!NOTE]
> If you need to communicate the connection status to the main process, use the [IPC renderer](../api/ipc-renderer.md) API.
> If you need to check the connection status in the main process, you can use [`net.isOnline()`](../api/net.md#netisonline) directly instead of communicating from the renderer process via [IPC](../api/ipc-renderer.md).

View File

@@ -13,7 +13,13 @@ the GPU service and the network service.
See Chromium's [Sandbox design document][sandbox] for more information.
Starting from Electron 20, the sandbox is enabled for renderer processes without any
further configuration. If you want to disable the sandbox for a process, see the
further configuration.
Sandboxing is tied to Node.js integration. _Enabling Node.js integration_ for a
renderer process by setting `nodeIntegration: true` _disables the sandbox_ for the
process.
If you want to disable the sandbox for a process, see the
[Disabling the sandbox for a single process](#disabling-the-sandbox-for-a-single-process)
section.
@@ -98,7 +104,8 @@ app.whenReady().then(() => {
```
Sandboxing is also disabled whenever Node.js integration is enabled in the renderer.
This can be done through the BrowserWindow constructor with the `nodeIntegration: true` flag.
This can be done through the BrowserWindow constructor with the `nodeIntegration: true` flag
or by providing the respective HTML boolean attribute for a `webview`.
```js title='main.js'
app.whenReady().then(() => {
@@ -111,6 +118,10 @@ app.whenReady().then(() => {
})
```
```html title='index.html (Renderer Process)'
<webview nodeIntegration src="page.html"></webview>
```
### Enabling the sandbox globally
If you want to force sandboxing for all renderers, you can also use the

View File

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
You should at least follow these steps to improve the security of your application:
1. [Only load secure content](#1-only-load-secure-content)
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
4. [Enable process sandboxing](#4-enable-process-sandboxing)
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -244,6 +244,10 @@ to enable this behavior.
Even when `nodeIntegration: false` is used, to truly enforce strong isolation
and prevent the use of Node primitives `contextIsolation` **must** also be used.
Beware that _disabling context isolation_ for a renderer process by setting
`nodeIntegration: true` _also disables process sandboxing_ for that process.
See section below.
:::info
For more information on what `contextIsolation` is and how to enable it please
see our dedicated [Context Isolation](context-isolation.md) document.
@@ -251,6 +255,16 @@ see our dedicated [Context Isolation](context-isolation.md) document.
### 4. Enable process sandboxing
:::info
This recommendation is the default behavior in Electron since 20.0.0.
Additionally, process sandboxing can be enforced for all renderer processes
application wide: [Enabling the sandbox globally](sandbox.md#enabling-the-sandbox-globally)
_Disabling context isolation_ (see above) _also disables process sandboxing_,
regardless of the default, `sandbox: false` or globally enabled sandboxing!
:::
[Sandboxing](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/design/sandbox.md)
is a Chromium feature that uses the operating system to
significantly limit what renderer processes have access to. You should enable
@@ -285,7 +299,7 @@ const { session } = require('electron')
const { URL } = require('node:url')
session
.fromPartition('some-partition')
.defaultSession
.setPermissionRequestHandler((webContents, permission, callback) => {
const parsedUrl = new URL(webContents.getURL())
@@ -302,6 +316,8 @@ session
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
### 6. Do not disable `webSecurity`
:::info
@@ -392,6 +408,8 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
#### CSP meta tag
CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
@@ -804,10 +822,10 @@ that your application might have the rights for.
#### How?
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
flipping these fuses easy. Check out the README of that module for more details on usage and
potential error cases, and refer to
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
### 20. Do not expose Electron APIs to untrusted web content

View File

@@ -55,14 +55,27 @@ There are a few rules to follow for the purposes of this tutorial:
- _author_, _license_, and _description_ can be any value, but will be necessary for
[packaging][packaging] later on.
:::caution Install dependencies with a regular `node_modules` folder
Electron's packaging toolchain requires the `node_modules` folder to be physically on disk in the
way that npm installs Node dependencies. By default, [Yarn Berry](https://yarnpkg.com/) and
[pnpm](http://pnpm.io/) both use alternative installation strategies.
Therefore, you must set [`nodeLinker: node-modules`](https://yarnpkg.com/configuration/yarnrc#nodeLinker)
in Yarn or [`nodeLinker: hoisted`](https://pnpm.io/settings#nodelinker) in pnpm if you are using
those package managers.
:::
Then, install Electron into your app's **devDependencies**, which is the list of external
development-only package dependencies not required in production.
:::info Why is Electron a devDependency?
:::info Why is Electron a dev dependency?
This may seem counter-intuitive since your production code is running Electron APIs.
However, packaged apps will come bundled with the Electron binary, eliminating the need to specify
it as a production dependency.
This may seem counter-intuitive since your production code is running Electron APIs. Under the hood,
Electron's JavaScript API binds to a binary that contains its implementations. The packaging step for
Electron handles the bundling of this binary, eliminating the need to specify it as a production
dependency.
:::
@@ -70,6 +83,17 @@ it as a production dependency.
npm install electron --save-dev
```
:::warning
In order to correctly install Electron, you need to ensure that its `postinstall` lifecycle
script is able to run. This means avoiding the `--ignore-scripts` flag on npm and allowlisting
`electron` to run build scripts on other package managers.
This is likely to change in a future version of Electron. See
[electron/rfcs#22](https://github.com/electron/rfcs/pull/22) for more details.
:::
Your package.json file should look something like this after initializing your package
and installing Electron. You should also now have a `node_modules` folder containing
the Electron executable, as well as a `package-lock.json` lockfile that specifies

View File

@@ -629,8 +629,6 @@ filenames = {
"shell/common/gin_converters/usb_device_info_converter.h",
"shell/common/gin_converters/value_converter.cc",
"shell/common/gin_converters/value_converter.h",
"shell/common/gin_helper/arguments.cc",
"shell/common/gin_helper/arguments.h",
"shell/common/gin_helper/callback.cc",
"shell/common/gin_helper/callback.h",
"shell/common/gin_helper/cleaned_up_at_exit.cc",

View File

@@ -217,6 +217,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
"//third_party/libc++/src/include/__atomic/contention_t.h",
"//third_party/libc++/src/include/__atomic/fence.h",
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
"//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -840,7 +841,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cmath",
"//third_party/libc++/src/include/__cxx03/codecvt",
"//third_party/libc++/src/include/__cxx03/complex",
"//third_party/libc++/src/include/__cxx03/complex.h",
"//third_party/libc++/src/include/__cxx03/condition_variable",
"//third_party/libc++/src/include/__cxx03/csetjmp",
"//third_party/libc++/src/include/__cxx03/csignal",
@@ -853,25 +853,20 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cstring",
"//third_party/libc++/src/include/__cxx03/ctgmath",
"//third_party/libc++/src/include/__cxx03/ctime",
"//third_party/libc++/src/include/__cxx03/ctype.h",
"//third_party/libc++/src/include/__cxx03/cuchar",
"//third_party/libc++/src/include/__cxx03/cwchar",
"//third_party/libc++/src/include/__cxx03/cwctype",
"//third_party/libc++/src/include/__cxx03/deque",
"//third_party/libc++/src/include/__cxx03/errno.h",
"//third_party/libc++/src/include/__cxx03/exception",
"//third_party/libc++/src/include/__cxx03/experimental/__config",
"//third_party/libc++/src/include/__cxx03/experimental/utility",
"//third_party/libc++/src/include/__cxx03/ext/__hash",
"//third_party/libc++/src/include/__cxx03/ext/hash_map",
"//third_party/libc++/src/include/__cxx03/ext/hash_set",
"//third_party/libc++/src/include/__cxx03/fenv.h",
"//third_party/libc++/src/include/__cxx03/float.h",
"//third_party/libc++/src/include/__cxx03/forward_list",
"//third_party/libc++/src/include/__cxx03/fstream",
"//third_party/libc++/src/include/__cxx03/functional",
"//third_party/libc++/src/include/__cxx03/future",
"//third_party/libc++/src/include/__cxx03/inttypes.h",
"//third_party/libc++/src/include/__cxx03/iomanip",
"//third_party/libc++/src/include/__cxx03/ios",
"//third_party/libc++/src/include/__cxx03/iosfwd",
@@ -898,11 +893,8 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/sstream",
"//third_party/libc++/src/include/__cxx03/stack",
"//third_party/libc++/src/include/__cxx03/stdatomic.h",
"//third_party/libc++/src/include/__cxx03/stdbool.h",
"//third_party/libc++/src/include/__cxx03/stddef.h",
"//third_party/libc++/src/include/__cxx03/stdexcept",
"//third_party/libc++/src/include/__cxx03/stdint.h",
"//third_party/libc++/src/include/__cxx03/stdio.h",
"//third_party/libc++/src/include/__cxx03/stdlib.h",
"//third_party/libc++/src/include/__cxx03/streambuf",
"//third_party/libc++/src/include/__cxx03/string",
@@ -910,7 +902,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/string_view",
"//third_party/libc++/src/include/__cxx03/strstream",
"//third_party/libc++/src/include/__cxx03/system_error",
"//third_party/libc++/src/include/__cxx03/tgmath.h",
"//third_party/libc++/src/include/__cxx03/thread",
"//third_party/libc++/src/include/__cxx03/type_traits",
"//third_party/libc++/src/include/__cxx03/typeindex",
@@ -923,7 +914,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/vector",
"//third_party/libc++/src/include/__cxx03/version",
"//third_party/libc++/src/include/__cxx03/wchar.h",
"//third_party/libc++/src/include/__cxx03/wctype.h",
"//third_party/libc++/src/include/__debug_utils/randomize_range.h",
"//third_party/libc++/src/include/__debug_utils/sanitizers.h",
"//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
@@ -1034,14 +1024,12 @@ libcxx_headers = [
"//third_party/libc++/src/include/__fwd/get.h",
"//third_party/libc++/src/include/__fwd/ios.h",
"//third_party/libc++/src/include/__fwd/istream.h",
"//third_party/libc++/src/include/__fwd/map.h",
"//third_party/libc++/src/include/__fwd/mdspan.h",
"//third_party/libc++/src/include/__fwd/memory.h",
"//third_party/libc++/src/include/__fwd/memory_resource.h",
"//third_party/libc++/src/include/__fwd/ostream.h",
"//third_party/libc++/src/include/__fwd/pair.h",
"//third_party/libc++/src/include/__fwd/queue.h",
"//third_party/libc++/src/include/__fwd/set.h",
"//third_party/libc++/src/include/__fwd/span.h",
"//third_party/libc++/src/include/__fwd/sstream.h",
"//third_party/libc++/src/include/__fwd/stack.h",
@@ -1367,11 +1355,9 @@ libcxx_headers = [
"//third_party/libc++/src/include/__tree",
"//third_party/libc++/src/include/__tuple/find_index.h",
"//third_party/libc++/src/include/__tuple/ignore.h",
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
"//third_party/libc++/src/include/__tuple/tuple_element.h",
"//third_party/libc++/src/include/__tuple/tuple_like.h",
"//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
"//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
"//third_party/libc++/src/include/__tuple/tuple_size.h",
"//third_party/libc++/src/include/__tuple/tuple_types.h",
@@ -1381,7 +1367,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/aligned_storage.h",
"//third_party/libc++/src/include/__type_traits/aligned_union.h",
"//third_party/libc++/src/include/__type_traits/alignment_of.h",
"//third_party/libc++/src/include/__type_traits/can_extract_key.h",
"//third_party/libc++/src/include/__type_traits/common_reference.h",
"//third_party/libc++/src/include/__type_traits/common_type.h",
"//third_party/libc++/src/include/__type_traits/conditional.h",
@@ -1429,6 +1414,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
"//third_party/libc++/src/include/__type_traits/is_function.h",
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
"//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1462,6 +1448,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_trivially_relocatable.h",
"//third_party/libc++/src/include/__type_traits/is_unbounded_array.h",
"//third_party/libc++/src/include/__type_traits/is_union.h",
"//third_party/libc++/src/include/__type_traits/is_unqualified.h",
"//third_party/libc++/src/include/__type_traits/is_unsigned.h",
"//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
"//third_party/libc++/src/include/__type_traits/is_void.h",
@@ -1470,6 +1457,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
"//third_party/libc++/src/include/__type_traits/make_signed.h",
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
"//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1501,6 +1489,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/cmp.h",
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
"//third_party/libc++/src/include/__utility/declval.h",
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/element_count.h",
"//third_party/libc++/src/include/__utility/empty.h",
"//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1511,6 +1500,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/integer_sequence.h",
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
"//third_party/libc++/src/include/__utility/is_valid_range.h",
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/move.h",
"//third_party/libc++/src/include/__utility/no_destroy.h",
"//third_party/libc++/src/include/__utility/pair.h",
@@ -1522,6 +1512,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/small_buffer.h",
"//third_party/libc++/src/include/__utility/swap.h",
"//third_party/libc++/src/include/__utility/to_underlying.h",
"//third_party/libc++/src/include/__utility/try_key_extraction.h",
"//third_party/libc++/src/include/__utility/unreachable.h",
"//third_party/libc++/src/include/__variant/monostate.h",
"//third_party/libc++/src/include/__vector/comparison.h",

View File

@@ -1,11 +1,14 @@
import { Menu } from 'electron/main';
import { EventEmitter } from 'events';
import * as fs from 'fs';
const bindings = process._linkedBinding('electron_browser_app');
const commandLine = process._linkedBinding('electron_common_command_line');
const { app } = bindings;
Object.setPrototypeOf(app, EventEmitter.prototype);
// Only one app object permitted.
export default app;

View File

@@ -199,7 +199,14 @@ BrowserWindow.prototype.setBackgroundThrottling = function (allowed: boolean) {
};
BrowserWindow.prototype.addBrowserView = function (browserView: BrowserView) {
if (browserView.ownerWindow) { browserView.ownerWindow.removeBrowserView(browserView); }
if (this._browserViews.includes(browserView)) {
return;
}
const ownerWindow = browserView.ownerWindow;
if (ownerWindow && ownerWindow !== this) {
ownerWindow.removeBrowserView(browserView);
}
this.contentView.addChildView(browserView.webContentsView);
browserView.ownerWindow = this;
browserView.webContents._setOwnerWindow(this);

View File

@@ -25,13 +25,32 @@ Menu.prototype._isCommandIdChecked = function (id) {
};
Menu.prototype._isCommandIdEnabled = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].enabled : false;
const item = this.commandsMap[id];
if (!item) return false;
const focusedWindow = BaseWindow.getFocusedWindow();
if (item.role === 'minimize' && focusedWindow) {
return focusedWindow.isMinimizable();
}
if (item.role === 'togglefullscreen' && focusedWindow) {
return focusedWindow.isFullScreenable();
}
if (item.role === 'close' && focusedWindow) {
return focusedWindow.isClosable();
}
return item.enabled;
};
Menu.prototype._shouldCommandIdWorkWhenHidden = function (id) {
return this.commandsMap[id] ? !!this.commandsMap[id].acceleratorWorksWhenHidden : false;
return this.commandsMap[id]?.acceleratorWorksWhenHidden ?? false;
};
Menu.prototype._isCommandIdVisible = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].visible : false;
return this.commandsMap[id]?.visible ?? false;
};
Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator) {
@@ -42,12 +61,12 @@ Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator
};
Menu.prototype._shouldRegisterAcceleratorForCommandId = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].registerAccelerator : false;
return this.commandsMap[id]?.registerAccelerator ?? false;
};
if (process.platform === 'darwin') {
Menu.prototype._getSharingItemForCommandId = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].sharingItem : null;
return this.commandsMap[id]?.sharingItem ?? null;
};
}

View File

@@ -119,7 +119,10 @@ export function fetchWithSession (input: RequestInfo, init: (RequestInit & {bypa
p.reject(err);
});
if (!req.body?.pipeTo(Writable.toWeb(r as unknown as Writable)).then(() => r.end())) { r.end(); }
// pipeTo expects a WritableStream<Uint8Array>. Node.js' Writable.toWeb returns WritableStream<any>,
// which causes a TS structural mismatch.
const writable = Writable.toWeb(r as unknown as Writable) as unknown as WritableStream<Uint8Array>;
if (!req.body?.pipeTo(writable).then(() => r.end())) { r.end(); }
return p.promise;
}

View File

@@ -4,6 +4,8 @@ import { createReadStream } from 'fs';
import { Readable } from 'stream';
import { ReadableStream } from 'stream/web';
import type { ReadableStreamDefaultReader } from 'stream/web';
// Global protocol APIs.
const { registerSchemesAsPrivileged, getStandardSchemes, Protocol } = process._linkedBinding('electron_browser_protocol');
@@ -12,7 +14,7 @@ const ERR_UNEXPECTED = -9;
const isBuiltInScheme = (scheme: string) => ['http', 'https', 'file'].includes(scheme);
function makeStreamFromPipe (pipe: any): ReadableStream {
function makeStreamFromPipe (pipe: any): ReadableStream<Uint8Array> {
const buf = new Uint8Array(1024 * 1024 /* 1 MB */);
return new ReadableStream({
async pull (controller) {
@@ -38,21 +40,26 @@ function makeStreamFromFileInfo ({
filePath: string;
offset?: number;
length?: number;
}): ReadableStream {
}): ReadableStream<Uint8Array> {
// Node's Readable.toWeb produces a WHATWG ReadableStream whose chunks are Uint8Array.
return Readable.toWeb(createReadStream(filePath, {
start: offset,
end: length >= 0 ? offset + length : undefined
}));
})) as ReadableStream<Uint8Array>;
}
function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): RequestInit['body'] {
if (!uploadData) return null;
// Optimization: skip creating a stream if the request is just a single buffer.
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') return uploadData[0].bytes;
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') {
return uploadData[0].bytes as any;
}
const chunks = [...uploadData] as any[]; // TODO: types are wrong
let current: ReadableStreamDefaultReader | null = null;
return new ReadableStream({
const chunks = [...uploadData] as any[]; // TODO: refine ProtocolRequest types
// Use Node's web stream types explicitly to avoid DOM lib vs Node lib structural mismatches.
// Generic <Uint8Array> ensures reader.read() returns value?: Uint8Array consistent with enqueue.
let current: ReadableStreamDefaultReader<Uint8Array> | null = null;
return new ReadableStream<Uint8Array>({
async pull (controller) {
if (current) {
const { done, value } = await current.read();
@@ -67,7 +74,7 @@ function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): Reque
if (!chunks.length) { return controller.close(); }
const chunk = chunks.shift()!;
if (chunk.type === 'rawData') {
controller.enqueue(chunk.bytes);
controller.enqueue(chunk.bytes as Uint8Array);
} else if (chunk.type === 'file') {
current = makeStreamFromFileInfo(chunk).getReader();
return this.pull!(controller);

View File

@@ -882,7 +882,7 @@ export function create (options = {}): Electron.WebContents {
return new (WebContents as any)(options);
}
export function fromId (id: string) {
export function fromId (id: number) {
return binding.fromId(id);
}

View File

@@ -40,7 +40,7 @@ process.on('uncaughtException', function (error) {
// Emit 'exit' event on quit.
const { app } = require('electron');
app.on('quit', (_event, exitCode) => {
app.on('quit', (_event: any, exitCode: number) => {
process.emit('exit', exitCode);
});
@@ -162,27 +162,6 @@ require('@electron/internal/browser/api/web-contents-view');
// Set main startup script of the app.
const mainStartupScript = packageJson.main || 'index.js';
const KNOWN_XDG_DESKTOP_VALUES = new Set(['Pantheon', 'Unity:Unity7', 'pop:GNOME']);
function currentPlatformSupportsAppIndicator () {
if (process.platform !== 'linux') return false;
const currentDesktop = process.env.XDG_CURRENT_DESKTOP;
if (!currentDesktop) return false;
if (KNOWN_XDG_DESKTOP_VALUES.has(currentDesktop)) return true;
// ubuntu based or derived session (default ubuntu one, communitheme…) supports
// indicator too.
if (/ubuntu/ig.test(currentDesktop)) return true;
return false;
}
// Workaround for electron/electron#5050 and electron/electron#9046
process.env.ORIGINAL_XDG_CURRENT_DESKTOP = process.env.XDG_CURRENT_DESKTOP;
if (currentPlatformSupportsAppIndicator()) {
process.env.XDG_CURRENT_DESKTOP = 'Unity';
}
// Quit when all windows are closed and no other one is listening to this.
app.on('window-all-closed', () => {
if (app.listenerCount('window-all-closed') === 1) {

View File

@@ -746,7 +746,7 @@ export const wrapFsWithAsar = (fs: Record<string, any>) => {
context.readdirResults.push(dirent);
if (dirent!.isDirectory() || stat === 1) {
context.pathsQueue.push(path.join(dirent!.path, dirent!.name));
context.pathsQueue.push(path.join(dirent!.parentPath, dirent!.name));
}
}
}

View File

@@ -5,7 +5,9 @@ const proc = require('child_process');
const electron = require('./');
const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
let childClosed = false;
child.on('close', function (code, signal) {
childClosed = true;
if (code === null) {
console.error(electron, 'exited with signal', signal);
process.exit(1);
@@ -15,7 +17,7 @@ child.on('close', function (code, signal) {
const handleTerminationSignal = function (signal) {
process.on(signal, function signalHandler () {
if (!child.killed) {
if (!childClosed) {
child.kill(signal);
}
});
@@ -23,3 +25,4 @@ const handleTerminationSignal = function (signal) {
handleTerminationSignal('SIGINT');
handleTerminationSignal('SIGTERM');
handleTerminationSignal('SIGUSR2');

View File

@@ -44,7 +44,7 @@ downloadArtifact({
artifactName: 'electron',
force: process.env.force_no_cache === 'true',
cacheRoot: process.env.electron_config_cache,
checksums: process.env.electron_use_remote_checksums ?? process.env.npm_config_electron_use_remote_checksums ? undefined : require('./checksums.json'),
checksums: (process.env.electron_use_remote_checksums || process.env.npm_config_electron_use_remote_checksums) ? undefined : require('./checksums.json'),
platform,
arch
}).then(extractFile).catch(err => {

View File

@@ -9,7 +9,7 @@
},
"dependencies": {
"@electron/get": "^2.0.0",
"@types/node": "^22.7.7",
"@types/node": "^24.9.0",
"extract-zip": "^2.0.1"
},
"engines": {

View File

@@ -10,16 +10,17 @@
"@electron/fiddle-core": "^1.3.4",
"@electron/github-app-auth": "^2.2.1",
"@electron/lint-roller": "^3.1.2",
"@electron/typescript-definitions": "^9.1.2",
"@electron/typescript-definitions": "^9.1.5",
"@octokit/rest": "^20.1.2",
"@primer/octicons": "^10.0.0",
"@types/minimist": "^1.2.5",
"@types/node": "^22.7.7",
"@types/node": "^24.9.0",
"@types/semver": "^7.5.8",
"@types/stream-json": "^1.7.7",
"@types/stream-json": "^1.7.8",
"@types/temp": "^0.9.4",
"@typescript-eslint/eslint-plugin": "^8.32.1",
"@typescript-eslint/parser": "^8.7.0",
"@xmldom/xmldom": "^0.8.11",
"buffer": "^6.0.3",
"chalk": "^4.1.0",
"check-for-leaks": "^1.2.1",
@@ -45,16 +46,16 @@
"remark-cli": "^12.0.1",
"remark-preset-lint-markdown-style-guide": "^6.0.1",
"semver": "^7.6.3",
"stream-json": "^1.8.0",
"stream-json": "^1.9.1",
"tap-xunit": "^2.4.1",
"temp": "^0.9.4",
"timers-browserify": "1.4.2",
"ts-loader": "^8.0.2",
"ts-node": "6.2.0",
"typescript": "^5.6.2",
"typescript": "^5.8.3",
"url": "^0.11.4",
"webpack": "^5.95.0",
"webpack-cli": "^5.1.4",
"webpack-cli": "^6.0.1",
"wrapper-webpack-plugin": "^2.2.0"
},
"private": true,

View File

@@ -10,10 +10,10 @@ this patch is required to provide ripemd160 support in the nodejs crypto
module.
diff --git a/crypto/digest/digest_extra.cc b/crypto/digest/digest_extra.cc
index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d27388be99 100644
index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47b9e3034f 100644
--- a/crypto/digest/digest_extra.cc
+++ b/crypto/digest/digest_extra.cc
@@ -46,6 +46,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
@@ -47,6 +47,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
{NID_sha512, EVP_sha512, SN_sha512, LN_sha512},
{NID_sha512_256, EVP_sha512_256, SN_sha512_256, LN_sha512_256},
{NID_md5_sha1, EVP_md5_sha1, SN_md5_sha1, LN_md5_sha1},
@@ -22,7 +22,7 @@ index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d2
// hash function when given a signature OID. To avoid unintended lax parsing
// of hash OIDs, this is no longer supported for lookup by OID or NID.
diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
--- a/crypto/fipsmodule/digest/digests.cc.inc
+++ b/crypto/fipsmodule/digest/digests.cc.inc
@@ -18,6 +18,7 @@
@@ -62,27 +62,27 @@ index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d2
+
#undef CHECK
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
index e04b80cd6a1a215fc87f8fd8d750c3d258c3974f..8fdf1c624794f568bfc77b7b6b0c510b23905a4d 100644
index feaf17c72cecb8099bc11ac10747fbad719ddca9..891a73f229e3f0838cb2fa99b8fb24fdeac1962b 100644
--- a/decrepit/evp/evp_do_all.cc
+++ b/decrepit/evp/evp_do_all.cc
@@ -79,6 +79,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
callback(EVP_sha384(), "SHA384", NULL, arg);
callback(EVP_sha512(), "SHA512", NULL, arg);
callback(EVP_sha512_256(), "SHA512-256", NULL, arg);
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
callback(EVP_sha384(), "SHA384", nullptr, arg);
callback(EVP_sha512(), "SHA512", nullptr, arg);
callback(EVP_sha512_256(), "SHA512-256", nullptr, arg);
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
callback(EVP_md4(), "md4", NULL, arg);
callback(EVP_md5(), "md5", NULL, arg);
callback(EVP_md4(), "md4", nullptr, arg);
callback(EVP_md5(), "md5", nullptr, arg);
@@ -88,6 +89,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
callback(EVP_sha384(), "sha384", NULL, arg);
callback(EVP_sha512(), "sha512", NULL, arg);
callback(EVP_sha512_256(), "sha512-256", NULL, arg);
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
callback(EVP_sha384(), "sha384", nullptr, arg);
callback(EVP_sha512(), "sha512", nullptr, arg);
callback(EVP_sha512_256(), "sha512-256", nullptr, arg);
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
}
void EVP_MD_do_all(void (*callback)(const EVP_MD *cipher, const char *name,
diff --git a/include/openssl/digest.h b/include/openssl/digest.h
index 710c6e6d110378d1db10d8c2ae57b2d844c603b9..dbb1e0cd5e9480d1ac7a86cbca6fae29d6a8dca4 100644
index a86c18926e7798a3b0aae70c53870e03b5acd0ab..f4f27f9e803533d8db50d89e7a0125384a025a46 100644
--- a/include/openssl/digest.h
+++ b/include/openssl/digest.h
@@ -48,6 +48,9 @@ OPENSSL_EXPORT const EVP_MD *EVP_blake2b256(void);

View File

@@ -28,7 +28,7 @@ RC2 Ciphers: rc2-40-cbc
It's unclear whether this would be accepted upstream. We should try regardless.
diff --git a/crypto/cipher/get_cipher.cc b/crypto/cipher/get_cipher.cc
index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f825851b634 100644
index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da0229687f 100644
--- a/crypto/cipher/get_cipher.cc
+++ b/crypto/cipher/get_cipher.cc
@@ -31,6 +31,7 @@ static const struct {
@@ -64,64 +64,64 @@ index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f82
const EVP_CIPHER *EVP_get_cipherbynid(int nid) {
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
index 8fdf1c624794f568bfc77b7b6b0c510b23905a4d..2e40c031e8c681fe921331b26dbf63f4df2fcf71 100644
index 891a73f229e3f0838cb2fa99b8fb24fdeac1962b..f7d0c5dc66f016eb9338c15e7f5ef59e6de2969d 100644
--- a/decrepit/evp/evp_do_all.cc
+++ b/decrepit/evp/evp_do_all.cc
@@ -20,8 +20,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
const char *unused, void *arg),
void *arg) {
callback(EVP_aes_128_cbc(), "AES-128-CBC", NULL, arg);
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", NULL, arg);
callback(EVP_aes_192_cbc(), "AES-192-CBC", NULL, arg);
callback(EVP_aes_256_cbc(), "AES-256-CBC", NULL, arg);
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", NULL, arg);
callback(EVP_aes_128_ctr(), "AES-128-CTR", NULL, arg);
callback(EVP_aes_192_ctr(), "AES-192-CTR", NULL, arg);
callback(EVP_aes_256_ctr(), "AES-256-CTR", NULL, arg);
callback(EVP_aes_128_cbc(), "AES-128-CBC", nullptr, arg);
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", nullptr, arg);
callback(EVP_aes_192_cbc(), "AES-192-CBC", nullptr, arg);
callback(EVP_aes_256_cbc(), "AES-256-CBC", nullptr, arg);
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", nullptr, arg);
callback(EVP_aes_128_ctr(), "AES-128-CTR", nullptr, arg);
callback(EVP_aes_192_ctr(), "AES-192-CTR", nullptr, arg);
callback(EVP_aes_256_ctr(), "AES-256-CTR", nullptr, arg);
@@ -34,9 +36,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
callback(EVP_aes_128_gcm(), "AES-128-GCM", NULL, arg);
callback(EVP_aes_192_gcm(), "AES-192-GCM", NULL, arg);
callback(EVP_aes_256_gcm(), "AES-256-GCM", NULL, arg);
+ callback(EVP_bf_cbc(), "BF-CBC", NULL, arg);
+ callback(EVP_bf_cfb(), "BF-CFB", NULL, arg);
+ callback(EVP_bf_ecb(), "BF-ECB", NULL, arg);
callback(EVP_des_cbc(), "DES-CBC", NULL, arg);
callback(EVP_des_ecb(), "DES-ECB", NULL, arg);
callback(EVP_des_ede(), "DES-EDE", NULL, arg);
+ callback(EVP_des_ede3(), "DES-EDE3", NULL, arg);
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", NULL, arg);
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", NULL, arg);
callback(EVP_rc2_cbc(), "RC2-CBC", NULL, arg);
callback(EVP_aes_128_gcm(), "AES-128-GCM", nullptr, arg);
callback(EVP_aes_192_gcm(), "AES-192-GCM", nullptr, arg);
callback(EVP_aes_256_gcm(), "AES-256-GCM", nullptr, arg);
+ callback(EVP_bf_cbc(), "BF-CBC", nullptr, arg);
+ callback(EVP_bf_cfb(), "BF-CFB", nullptr, arg);
+ callback(EVP_bf_ecb(), "BF-ECB", nullptr, arg);
callback(EVP_des_cbc(), "DES-CBC", nullptr, arg);
callback(EVP_des_ecb(), "DES-ECB", nullptr, arg);
callback(EVP_des_ede(), "DES-EDE", nullptr, arg);
+ callback(EVP_des_ede3(), "DES-EDE3", nullptr, arg);
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", nullptr, arg);
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", nullptr, arg);
callback(EVP_rc2_cbc(), "RC2-CBC", nullptr, arg);
@@ -44,8 +50,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
// OpenSSL returns everything twice, the second time in lower case.
callback(EVP_aes_128_cbc(), "aes-128-cbc", NULL, arg);
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", NULL, arg);
callback(EVP_aes_192_cbc(), "aes-192-cbc", NULL, arg);
callback(EVP_aes_256_cbc(), "aes-256-cbc", NULL, arg);
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", NULL, arg);
callback(EVP_aes_128_ctr(), "aes-128-ctr", NULL, arg);
callback(EVP_aes_192_ctr(), "aes-192-ctr", NULL, arg);
callback(EVP_aes_256_ctr(), "aes-256-ctr", NULL, arg);
callback(EVP_aes_128_cbc(), "aes-128-cbc", nullptr, arg);
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", nullptr, arg);
callback(EVP_aes_192_cbc(), "aes-192-cbc", nullptr, arg);
callback(EVP_aes_256_cbc(), "aes-256-cbc", nullptr, arg);
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", nullptr, arg);
callback(EVP_aes_128_ctr(), "aes-128-ctr", nullptr, arg);
callback(EVP_aes_192_ctr(), "aes-192-ctr", nullptr, arg);
callback(EVP_aes_256_ctr(), "aes-256-ctr", nullptr, arg);
@@ -58,9 +66,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
callback(EVP_aes_128_gcm(), "aes-128-gcm", NULL, arg);
callback(EVP_aes_192_gcm(), "aes-192-gcm", NULL, arg);
callback(EVP_aes_256_gcm(), "aes-256-gcm", NULL, arg);
+ callback(EVP_bf_cbc(), "bf-cbc", NULL, arg);
+ callback(EVP_bf_cfb(), "bf-cfb", NULL, arg);
+ callback(EVP_bf_ecb(), "bf-ecb", NULL, arg);
callback(EVP_des_cbc(), "des-cbc", NULL, arg);
callback(EVP_des_ecb(), "des-ecb", NULL, arg);
callback(EVP_des_ede(), "des-ede", NULL, arg);
+ callback(EVP_des_ede3(), "des-ede3", NULL, arg);
callback(EVP_des_ede_cbc(), "des-ede-cbc", NULL, arg);
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", NULL, arg);
callback(EVP_rc2_cbc(), "rc2-cbc", NULL, arg);
callback(EVP_aes_128_gcm(), "aes-128-gcm", nullptr, arg);
callback(EVP_aes_192_gcm(), "aes-192-gcm", nullptr, arg);
callback(EVP_aes_256_gcm(), "aes-256-gcm", nullptr, arg);
+ callback(EVP_bf_cbc(), "bf-cbc", nullptr, arg);
+ callback(EVP_bf_cfb(), "bf-cfb", nullptr, arg);
+ callback(EVP_bf_ecb(), "bf-ecb", nullptr, arg);
callback(EVP_des_cbc(), "des-cbc", nullptr, arg);
callback(EVP_des_ecb(), "des-ecb", nullptr, arg);
callback(EVP_des_ede(), "des-ede", nullptr, arg);
+ callback(EVP_des_ede3(), "des-ede3", nullptr, arg);
callback(EVP_des_ede_cbc(), "des-ede-cbc", nullptr, arg);
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", nullptr, arg);
callback(EVP_rc2_cbc(), "rc2-cbc", nullptr, arg);
diff --git a/include/openssl/cipher.h b/include/openssl/cipher.h
index 13e68ad20ac08a462bb577d7f99e2c6f167579fa..4960d0eeb8f31bec4347ed2a1b63beba530de700 100644
index a5533caf45eaacc4baef4a73d97e9bc2b6e3a942..35f24c1b22ea2c6b4766c0d87e75b6fc6b459f79 100644
--- a/include/openssl/cipher.h
+++ b/include/openssl/cipher.h
@@ -448,6 +448,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
@@ -461,6 +461,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
// EVP_aes_128_cfb128 is only available in decrepit.
OPENSSL_EXPORT const EVP_CIPHER *EVP_aes_128_cfb128(void);

View File

@@ -8,7 +8,7 @@ This reverts commit ebd8b8965c74ab06bb91f7a00b23822e1f1f26ca.
It is causing significant TLS failures in Node.js.
diff --git a/ssl/ssl_buffer.cc b/ssl/ssl_buffer.cc
index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a02124b80f9ef 100644
index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad1655500d33 100644
--- a/ssl/ssl_buffer.cc
+++ b/ssl/ssl_buffer.cc
@@ -230,7 +230,6 @@ int ssl_handle_open_record(SSL *ssl, bool *out_retry, ssl_open_record_t ret,
@@ -20,10 +20,10 @@ index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a0212
case ssl_open_record_error:
diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f8431434e42 100644
index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e517ea6ae2 100644
--- a/ssl/ssl_lib.cc
+++ b/ssl/ssl_lib.cc
@@ -1206,7 +1206,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
}
if (ret_code == 0) {
@@ -32,7 +32,7 @@ index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f84
return SSL_ERROR_ZERO_RETURN;
}
// An EOF was observed which violates the protocol, and the underlying
@@ -2567,13 +2567,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
return CRYPTO_get_ex_data(&ctx->ex_data, idx);
}

View File

@@ -110,7 +110,6 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
refactor_expose_file_system_access_blocklist.patch
feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
fix_font_face_resolution_when_renderer_is_blocked.patch
feat_enable_passing_exit_code_on_service_process_crash.patch
chore_remove_reference_to_chrome_browser_themes.patch
feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
@@ -132,9 +131,16 @@ chore_grandfather_in_electron_views_and_delegates.patch
refactor_patch_electron_permissiontypes_into_blink.patch
revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
revert_update_siso-chromium_image.patch
build_set_mac_sdk_minimum_to_10.patch
fix_add_macos_memory_query_fallback_to_avoid_crash.patch
fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
chore_restore_some_deprecated_wrapper_utility_in_gin.patch
feat_add_support_for_embedder_snapshot_validation.patch
chore_restore_some_deprecated_wrapper_utility_in_gin.patch
chore_add_electron_objects_to_wrappablepointertag.patch
chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
revert_partial_remove_unused_prehandlemouseevent.patch
allow_electron_to_depend_on_components_os_crypt_sync.patch
expose_referrerscriptinfo_hostdefinedoptionsindex.patch
chore_disable_protocol_handler_dcheck.patch
fix_check_for_file_existence_before_setting_mtime.patch
revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch
fix_release_mouse_buttons_on_focus_loss_on_wayland.patch

View File

@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
}
diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
--- a/ui/base/accelerators/accelerator.h
+++ b/ui/base/accelerators/accelerator.h
@@ -18,6 +18,7 @@
#include <vector>
#include "base/component_export.h"
+#include "third_party/abseil-cpp/absl/types/optional.h"
@@ -21,6 +21,7 @@
#include "base/time/time.h"
#include "build/blink_buildflags.h"
#include "build/build_config.h"
@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
return interrupted_by_mouse_event_;
+#include "third_party/abseil-cpp/absl/types/optional.h"
#include "ui/events/event_constants.h"
#include "ui/events/keycodes/keyboard_codes.h"
@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
<< 18); // masked to 6 bits
}
+ absl::optional<char16_t> shifted_char;

View File

@@ -10,10 +10,10 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
This should be upstreamed.
diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
index 6f8e8dd8e7ddb9e3d4c142493f249f616520d613..f89b2e5b846b3b96c99dea2a3b49bc9823ab51e5 100644
index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
--- a/content/gpu/gpu_main.cc
+++ b/content/gpu/gpu_main.cc
@@ -271,6 +271,10 @@ int GpuMain(MainFunctionParams parameters) {
@@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {
// to the GpuProcessHost once the GpuServiceImpl has started.
viz::GpuLogMessageManager::GetInstance()->InstallPreInitializeLogHandler();
@@ -24,7 +24,7 @@ index 6f8e8dd8e7ddb9e3d4c142493f249f616520d613..f89b2e5b846b3b96c99dea2a3b49bc98
// We are experiencing what appear to be memory-stomp issues in the GPU
// process. These issues seem to be impacting the task executor and listeners
// registered to it. Create the task executor on the heap to guard against
@@ -380,7 +384,6 @@ int GpuMain(MainFunctionParams parameters) {
@@ -381,7 +385,6 @@ int GpuMain(MainFunctionParams parameters) {
#endif
const bool dead_on_arrival = !init_success;

View File

@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
context, which can cause some preload scripts to trip.
diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e90be3d39b 100644
index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
--- a/content/public/renderer/render_frame_observer.h
+++ b/content/public/renderer/render_frame_observer.h
@@ -138,6 +138,8 @@ class CONTENT_EXPORT RenderFrameObserver {
@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
virtual void DidHandleOnloadEvents() {}
virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
int32_t world_id) {}
@@ -23,10 +23,10 @@ index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e9
int32_t world_id) {}
virtual void DidClearWindowObject() {}
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
index 7dc7f4d0ae5c553e757ca2df68a9f6121b009778..5ef55881665aae1190336ddd686de7f0f9fc6a4e 100644
index 298387873e7ded5f96c788bc53ad7256a8f5b13e..7e64e34a2ebd9738d33bfc9cc7fd827b8757037d 100644
--- a/content/renderer/render_frame_impl.cc
+++ b/content/renderer/render_frame_impl.cc
@@ -4676,6 +4676,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
@@ -4659,6 +4659,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
observer.DidCreateScriptContext(context, world_id);
}
@@ -40,7 +40,7 @@ index 7dc7f4d0ae5c553e757ca2df68a9f6121b009778..5ef55881665aae1190336ddd686de7f0
int world_id) {
for (auto& observer : observers_)
diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa56dbfa2dc 100644
index b6acf7101932961b4a81738e1fcda07efc714edc..32dfed04e2fd7cd2e60c7cf145d182f4163feb68 100644
--- a/content/renderer/render_frame_impl.h
+++ b/content/renderer/render_frame_impl.h
@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
@@ -53,10 +53,10 @@ index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa5
int world_id) override;
void DidChangeScrollOffset() override;
diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00bf366e92d 100644
index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
--- a/third_party/blink/public/web/web_local_frame_client.h
+++ b/third_party/blink/public/web/web_local_frame_client.h
@@ -662,6 +662,9 @@ class BLINK_EXPORT WebLocalFrameClient {
@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
virtual void DidCreateScriptContext(v8::Local<v8::Context>,
int32_t world_id) {}
@@ -67,10 +67,10 @@ index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00b
virtual void WillReleaseScriptContext(v8::Local<v8::Context>,
int32_t world_id) {}
diff --git a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
index b963abd8c4bf6ffaea1930a8d1f647a8a8c266bc..2e8653654686f4fc775288f059ff27daa38e02d5 100644
index 3ce1ef340780075951fb8c1b65f2ec90569f34ef..898d7caac98727210ac5780b576526a71ec5a5aa 100644
--- a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
+++ b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
@@ -216,6 +216,7 @@ void LocalWindowProxy::Initialize() {
@@ -217,6 +217,7 @@ void LocalWindowProxy::Initialize() {
}
InstallConditionalFeatures();
@@ -92,11 +92,11 @@ index 36baf908d3be8aed44ff60b8de2cffe2eee15efe..8d73ddb12013ce195026b9f63050cf33
int32_t world_id) = 0;
virtual bool AllowScriptExtensions() = 0;
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
index 114cbd9c806572b664b9d9af75955231fa68cc50..03a0b2f762a2d9677212c89e63bb2d2691fac2b7 100644
index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9ae8d3379f 100644
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
@@ -295,6 +295,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
web_frame_->Client()->DidCreateScriptContext(context, world_id);
@@ -300,6 +300,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
}
}
+void LocalFrameClientImpl::DidInstallConditionalFeatures(
@@ -110,7 +110,7 @@ index 114cbd9c806572b664b9d9af75955231fa68cc50..03a0b2f762a2d9677212c89e63bb2d26
v8::Local<v8::Context> context,
int32_t world_id) {
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.h b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf30267fddf7c4 100644
index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e5844349c0b5 100644
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.h
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
@@ -81,6 +81,8 @@ class CORE_EXPORT LocalFrameClientImpl final : public LocalFrameClient {
@@ -123,10 +123,10 @@ index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf3026
int32_t world_id) override;
diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
--- a/third_party/blink/renderer/core/loader/empty_clients.h
+++ b/third_party/blink/renderer/core/loader/empty_clients.h
@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
void DidCreateScriptContext(v8::Local<v8::Context>,
int32_t world_id) override {}

View File

@@ -7,12 +7,12 @@ Ensure that licenses for the dependencies introduced by Electron
are included in `LICENSES.chromium.html`
diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
index 514be069768cc1bbd39f2b261cefb1a9f267f89f..0a1ab64914cfaa087e4000fb81bfafd18aa1b98b 100755
--- a/tools/licenses/licenses.py
+++ b/tools/licenses/licenses.py
@@ -337,6 +337,31 @@ SPECIAL_CASES = {
@@ -357,6 +357,31 @@ SPECIAL_CASES = {
"License": "Apache 2.0",
"License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
"License File": ["//third_party/sample3/the_license"],
},
+ os.path.join('third_party', 'electron_node'): {
+ "Name": "Node.js",

View File

@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
--- a/ui/base/clipboard/scoped_clipboard_writer.cc
+++ b/ui/base/clipboard/scoped_clipboard_writer.cc
@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
}
}
@@ -29,10 +29,10 @@ index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464e
objects_.clear();
raw_objects_.clear();
diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
--- a/ui/base/clipboard/scoped_clipboard_writer.h
+++ b/ui/base/clipboard/scoped_clipboard_writer.h
@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
// This is only used to write custom format data.
void WriteData(std::u16string_view format, mojo_base::BigBuffer data);

View File

@@ -8,7 +8,7 @@ accessing Blink internals. Its inverse, which already exists, is used in
Android WebView.
diff --git a/third_party/blink/public/web/web_message_port_converter.h b/third_party/blink/public/web/web_message_port_converter.h
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e7521cb71b8 100644
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211a29548aa 100644
--- a/third_party/blink/public/web/web_message_port_converter.h
+++ b/third_party/blink/public/web/web_message_port_converter.h
@@ -13,6 +13,7 @@
@@ -19,18 +19,20 @@ index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e75
} // namespace v8
namespace blink {
@@ -25,6 +26,9 @@ class BLINK_EXPORT WebMessagePortConverter {
@@ -25,6 +26,11 @@ class BLINK_EXPORT WebMessagePortConverter {
// neutered, it will return nullopt.
static std::optional<MessagePortChannel>
DisentangleAndExtractMessagePortChannel(v8::Isolate*, v8::Local<v8::Value>);
+
+ BLINK_EXPORT static v8::Local<v8::Value>
+ EntangleAndInjectMessagePortChannel(v8::Local<v8::Context>, MessagePortChannel);
+ EntangleAndInjectMessagePortChannel(v8::Isolate*,
+ v8::Local<v8::Context>,
+ MessagePortChannel);
};
} // namespace blink
diff --git a/third_party/blink/renderer/core/exported/web_message_port_converter.cc b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef732225d6 100644
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d84213eba 100644
--- a/third_party/blink/renderer/core/exported/web_message_port_converter.cc
+++ b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
@@ -6,6 +6,7 @@
@@ -41,19 +43,20 @@ index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef
#include "third_party/blink/renderer/bindings/core/v8/v8_message_port.h"
#include "third_party/blink/renderer/core/messaging/message_port.h"
@@ -21,4 +22,15 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
@@ -21,4 +22,16 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
return port->Disentangle();
}
+v8::Local<v8::Value>
+WebMessagePortConverter::EntangleAndInjectMessagePortChannel(
+ v8::Isolate* isolate,
+ v8::Local<v8::Context> context,
+ MessagePortChannel port_channel) {
+ auto* execution_context = ToExecutionContext(context);
+ CHECK(execution_context);
+ auto* port = MakeGarbageCollected<MessagePort>(*execution_context);
+ port->Entangle(std::move(port_channel));
+ return port->ToV8(context->GetIsolate(), context->Global());
+ return port->ToV8(isolate, context->Global());
+}
+
} // namespace blink

View File

@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
WindowList.
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aabbba621cb 100644
index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da2967073016 100644
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
@@ -48,6 +48,7 @@
@@ -19,9 +19,9 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
#include "content/public/browser/web_ui_data_source.h"
+#include "electron/shell/browser/electron_browser_context.h"
#include "ui/accessibility/accessibility_features.h"
#include "ui/accessibility/ax_mode.h"
#include "ui/accessibility/ax_updates_and_events.h"
#include "ui/accessibility/platform/ax_platform.h"
@@ -173,7 +174,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
@@ -178,7 +179,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
rvh->GetRoutingID(), accessibility_mode);
}
@@ -30,7 +30,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
base::Value::Dict BuildTargetDescriptor(Browser* browser) {
base::Value::Dict target_data;
target_data.Set(kSessionIdField, browser->session_id().id());
@@ -197,7 +198,7 @@ void HandleAccessibilityRequestCallback(
@@ -224,7 +225,7 @@ void HandleAccessibilityRequestCallback(
auto& browser_accessibility_state =
*content::BrowserAccessibilityState::GetInstance();
base::Value::Dict data;
@@ -39,7 +39,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
ui::AXMode mode = browser_accessibility_state.GetAccessibilityMode();
bool native = mode.has_mode(ui::AXMode::kNativeAPIs);
bool web = mode.has_mode(ui::AXMode::kWebContents);
@@ -258,7 +259,7 @@ void HandleAccessibilityRequestCallback(
@@ -285,7 +286,7 @@ void HandleAccessibilityRequestCallback(
data.Set(kIsScreenReaderActive, is_screen_reader_active);
std::string pref_api_type =
@@ -48,7 +48,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
bool pref_api_type_supported = false;
std::vector<ui::AXApiType::Type> supported_api_types =
@@ -326,11 +327,11 @@ void HandleAccessibilityRequestCallback(
@@ -353,11 +354,11 @@ void HandleAccessibilityRequestCallback(
data.Set(kPagesField, std::move(page_list));
base::Value::List browser_list;
@@ -61,8 +61,8 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
+#endif
data.Set(kBrowsersField, std::move(browser_list));
std::string json_string;
@@ -804,7 +805,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
#if BUILDFLAG(IS_WIN)
@@ -844,7 +845,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
const std::string value = CheckJSValue(data.FindString(kValueField));
if (string_name == kApiTypeField) {
@@ -72,7 +72,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
pref->SetString(prefs::kShownAccessibilityApiType, value);
}
}
@@ -858,7 +860,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
@@ -898,7 +900,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
AXPropertyFilter::ALLOW_EMPTY);
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
@@ -82,7 +82,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
ui::AXApiType::Type api_type =
ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
std::string accessibility_contents =
@@ -885,6 +888,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
@@ -925,6 +928,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
AXPropertyFilter::ALLOW_EMPTY);
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
@@ -90,7 +90,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
for (Browser* browser : *BrowserList::GetInstance()) {
if (browser->session_id().id() == session_id) {
base::Value::Dict result = BuildTargetDescriptor(browser);
@@ -897,6 +901,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
@@ -937,6 +941,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
return;
}
}
@@ -98,7 +98,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
#endif // !BUILDFLAG(IS_ANDROID)
// No browser with the specified |session_id| was found.
base::Value::Dict result;
@@ -940,11 +945,13 @@ void AccessibilityUIMessageHandler::StopRecording(
@@ -980,11 +985,13 @@ void AccessibilityUIMessageHandler::StopRecording(
}
ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
@@ -115,7 +115,7 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
// Check to see if it is in the supported types list.
if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
supported_types.end()) {
@@ -1014,8 +1021,11 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
@@ -1054,10 +1061,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
// static
void AccessibilityUIMessageHandler::RegisterProfilePrefs(
user_prefs::PrefRegistrySyncable* registry) {
@@ -127,11 +127,13 @@ index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aab
+ registry->RegisterBooleanPref(prefs::kShowInternalAccessibilityTree, false);
+#endif
}
void AccessibilityUIMessageHandler::OnVisibilityChanged(
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.h b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7f1648148 100644
index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83c1d1fa0a 100644
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.h
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
@@ -27,6 +27,8 @@ namespace content {
@@ -28,6 +28,8 @@ namespace content {
class WebContents;
} // namespace content
@@ -140,7 +142,7 @@ index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7
namespace user_prefs {
class PrefRegistrySyncable;
} // namespace user_prefs
@@ -77,6 +79,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler {
@@ -79,6 +81,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler,
static void RegisterProfilePrefs(user_prefs::PrefRegistrySyncable* registry);
private:

Some files were not shown because too many files have changed in this diff Show More