mirror of
https://github.com/electron/electron.git
synced 2026-04-10 03:01:51 -04:00
Compare commits
231 Commits
v41.0.0-ni
...
v38.8.5
| Author | SHA1 | Date | |
|---|---|---|---|
|
|
ab7f97e887 | ||
|
|
4d0e13b87c | ||
|
|
50c0081e05 | ||
|
|
1079f3bbfa | ||
|
|
d91adea56f | ||
|
|
b2b584a320 | ||
|
|
1778a26c46 | ||
|
|
9fed98cee5 | ||
|
|
d4d1596d2f | ||
|
|
356bba8060 | ||
|
|
ecbe8ee08a | ||
|
|
8fb777dab0 | ||
|
|
c8af46e054 | ||
|
|
e342216d9e | ||
|
|
90b4003ad5 | ||
|
|
ab3292cf81 | ||
|
|
75ee26902b | ||
|
|
a586dd3045 | ||
|
|
bd1561a5b5 | ||
|
|
bc8ecdf96f | ||
|
|
2515880814 | ||
|
|
4c06de632e | ||
|
|
6b2861d063 | ||
|
|
9692c9ea58 | ||
|
|
ecb6b6c1c1 | ||
|
|
269a5393c0 | ||
|
|
822fb2cd4d | ||
|
|
32fcfe4505 | ||
|
|
933f0d50d1 | ||
|
|
4bd6182e83 | ||
|
|
3e6dd7f771 | ||
|
|
9b89d19b1b | ||
|
|
38cb7ab080 | ||
|
|
f6f0843536 | ||
|
|
4cc7821d01 | ||
|
|
17c909924c | ||
|
|
40d65d5a9f | ||
|
|
b32853b8aa | ||
|
|
5e9c442b2a | ||
|
|
c550d938c4 | ||
|
|
9f19d58510 | ||
|
|
41bcdd71fe | ||
|
|
ca1b9e1c2e | ||
|
|
a9ce0cdf52 | ||
|
|
3e77a1a359 | ||
|
|
074cedd561 | ||
|
|
6140359cd3 | ||
|
|
a924f1a629 | ||
|
|
3d5f13a44a | ||
|
|
88a4d1c593 | ||
|
|
fea4fadeda | ||
|
|
60ff1a18ac | ||
|
|
4b13582af0 | ||
|
|
3083fab4e4 | ||
|
|
112489328c | ||
|
|
8f23e5a426 | ||
|
|
e308928159 | ||
|
|
c1eb83c659 | ||
|
|
16099b6cf5 | ||
|
|
74952bd7b4 | ||
|
|
3d59235245 | ||
|
|
370a737ced | ||
|
|
6b98259971 | ||
|
|
c1097edd15 | ||
|
|
a0be2f521d | ||
|
|
d14320748d | ||
|
|
e840a3f13f | ||
|
|
9008cf70f5 | ||
|
|
c9c048196a | ||
|
|
955afdd92b | ||
|
|
5e29e21a60 | ||
|
|
d0db2ec333 | ||
|
|
4a2f733d0a | ||
|
|
be4805afdd | ||
|
|
41721fc82e | ||
|
|
5bc759e08d | ||
|
|
91899aa9af | ||
|
|
4f0b4c7fa8 | ||
|
|
5b32b7b4f3 | ||
|
|
e03891eec7 | ||
|
|
af55e45ce8 | ||
|
|
d1c2d06bae | ||
|
|
2af34b7353 | ||
|
|
54e2de4397 | ||
|
|
d9e9ed3141 | ||
|
|
f8479ece3d | ||
|
|
cc4712affa | ||
|
|
4622f09cae | ||
|
|
ad5e60274a | ||
|
|
6ee299c9ee | ||
|
|
4e4c156ab3 | ||
|
|
9c81f56f40 | ||
|
|
347fd37dfb | ||
|
|
f6238586d4 | ||
|
|
6dc3923b93 | ||
|
|
074d0e19fb | ||
|
|
7e089f65c1 | ||
|
|
ad8686f7d7 | ||
|
|
48c0f561ff | ||
|
|
81db417caa | ||
|
|
5dfeee6b55 | ||
|
|
2982cd77f0 | ||
|
|
3179f61bc1 | ||
|
|
526dfe2577 | ||
|
|
cf9d0448be | ||
|
|
99feff3965 | ||
|
|
d60ae17998 | ||
|
|
f43348e75c | ||
|
|
5e51c882ee | ||
|
|
8cd29d24b1 | ||
|
|
35639ad801 | ||
|
|
2d397883a5 | ||
|
|
79433861fe | ||
|
|
a7335142a4 | ||
|
|
d5907878bc | ||
|
|
0098160f2a | ||
|
|
207f64fec8 | ||
|
|
441cff700b | ||
|
|
9eede35fc1 | ||
|
|
6812b13161 | ||
|
|
a64175ff1c | ||
|
|
b34e618285 | ||
|
|
818743493d | ||
|
|
9e631b62d8 | ||
|
|
f28d08ad86 | ||
|
|
0c2271a515 | ||
|
|
cc67728226 | ||
|
|
1a38293926 | ||
|
|
2cb262b280 | ||
|
|
20a563c27d | ||
|
|
aa022ce30e | ||
|
|
fead821311 | ||
|
|
37b5a62daa | ||
|
|
3e0378340e | ||
|
|
2e5a0b7220 | ||
|
|
a6b0d27bb7 | ||
|
|
114a3b3971 | ||
|
|
641f60619f | ||
|
|
a130d4ebfe | ||
|
|
cea5034019 | ||
|
|
095ae30f6d | ||
|
|
35b3d25ee1 | ||
|
|
03a14844b1 | ||
|
|
fffe214702 | ||
|
|
bc56c6987f | ||
|
|
e3f358a45a | ||
|
|
89d5b6cd5b | ||
|
|
4fff74b73e | ||
|
|
74ad696f98 | ||
|
|
d05f99ff4c | ||
|
|
f6a2c13740 | ||
|
|
433f9f5e8c | ||
|
|
a7b6145f3b | ||
|
|
f3774d578d | ||
|
|
33f4808182 | ||
|
|
eb02db5185 | ||
|
|
c3f64712de | ||
|
|
df6ad9c970 | ||
|
|
729a67d0d7 | ||
|
|
ecf905decb | ||
|
|
4fea51017f | ||
|
|
d3059897ed | ||
|
|
f2d14ca29d | ||
|
|
9b1dfe90f4 | ||
|
|
a41ca28b63 | ||
|
|
8841e4be83 | ||
|
|
5c83e2b00c | ||
|
|
7930f4a20c | ||
|
|
3fefa06d34 | ||
|
|
e1e12318e2 | ||
|
|
edccb0a7ea | ||
|
|
83373c3679 | ||
|
|
9c4d783d1f | ||
|
|
139ab00d8c | ||
|
|
124bfd25f8 | ||
|
|
d5ce459cea | ||
|
|
ea0773c7c7 | ||
|
|
d426b92326 | ||
|
|
673ec5d39e | ||
|
|
bfdc318d56 | ||
|
|
41093c5ba6 | ||
|
|
22d6210c3c | ||
|
|
b20e91d86f | ||
|
|
658d52ecf1 | ||
|
|
53c17ea4f5 | ||
|
|
71af3e452f | ||
|
|
5081fbe830 | ||
|
|
a4a12fb35a | ||
|
|
564698e27f | ||
|
|
280f643862 | ||
|
|
e2689400aa | ||
|
|
f37f8d41c0 | ||
|
|
7d83554d0e | ||
|
|
8924d682be | ||
|
|
d6c5642155 | ||
|
|
789b4b026a | ||
|
|
44bd560068 | ||
|
|
2783f76f1f | ||
|
|
96957aebf3 | ||
|
|
e8c3b6fe66 | ||
|
|
58e0a96d21 | ||
|
|
b136dbc4cc | ||
|
|
2efd448a87 | ||
|
|
31e6800314 | ||
|
|
f1fef462c0 | ||
|
|
e08f057e91 | ||
|
|
f97bee6f04 | ||
|
|
0b77096f2a | ||
|
|
130f00dfcd | ||
|
|
3a6d7e0c22 | ||
|
|
7907443448 | ||
|
|
a425ddd08e | ||
|
|
9184541193 | ||
|
|
5edb807cff | ||
|
|
c65bfc1e5c | ||
|
|
85a8bfaa31 | ||
|
|
f6d054f0fb | ||
|
|
66a89ec38f | ||
|
|
6d3eeb46e4 | ||
|
|
34dcfb5422 | ||
|
|
e84f0e164e | ||
|
|
68c769de94 | ||
|
|
3eabf175b8 | ||
|
|
9c0ef6f9c6 | ||
|
|
c150a1e004 | ||
|
|
a8b8ad9ca9 | ||
|
|
4268bf91e4 | ||
|
|
79d6160bdc | ||
|
|
41ebb49703 | ||
|
|
c30eae3216 | ||
|
|
b89810f374 |
@@ -2,7 +2,7 @@ version: '3'
|
||||
|
||||
services:
|
||||
buildtools:
|
||||
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
|
||||
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
|
||||
|
||||
volumes:
|
||||
- ..:/workspaces/gclient/src/electron:cached
|
||||
|
||||
10
.github/ISSUE_TEMPLATE/bug_report.yml
vendored
10
.github/ISSUE_TEMPLATE/bug_report.yml
vendored
@@ -58,16 +58,6 @@ body:
|
||||
label: Last Known Working Electron version
|
||||
description: What is the last version of Electron this worked in, if applicable?
|
||||
placeholder: 16.0.0
|
||||
- type: dropdown
|
||||
attributes:
|
||||
label: Does the issue also appear in Chromium / Google Chrome?
|
||||
description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
|
||||
options:
|
||||
- I don't know how to test
|
||||
- "Yes"
|
||||
- "No"
|
||||
validations:
|
||||
required: true
|
||||
- type: textarea
|
||||
attributes:
|
||||
label: Expected Behavior
|
||||
|
||||
22
.github/actions/build-electron/action.yml
vendored
22
.github/actions/build-electron/action.yml
vendored
@@ -70,11 +70,7 @@ runs:
|
||||
|
||||
# Upload build stats to Datadog
|
||||
if ! [ -z $DD_API_KEY ]; then
|
||||
if [ "$TARGET_PLATFORM" = "win" ]; then
|
||||
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
|
||||
else
|
||||
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
|
||||
fi
|
||||
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
|
||||
else
|
||||
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
|
||||
fi
|
||||
@@ -136,14 +132,6 @@ runs:
|
||||
run: |
|
||||
cd src
|
||||
e build --target electron:electron_chromedriver_zip
|
||||
|
||||
if [ "${{ inputs.is-asan }}" != "true" ]; then
|
||||
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
|
||||
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
|
||||
target_os="${target_os}_mas"
|
||||
fi
|
||||
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
|
||||
fi
|
||||
- name: Create installed_software.json ${{ inputs.step-suffix }}
|
||||
shell: powershell
|
||||
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
|
||||
@@ -188,10 +176,11 @@ runs:
|
||||
shell: bash
|
||||
run: |
|
||||
cd src/electron
|
||||
node script/yarn create-typescript-definitions
|
||||
node script/yarn.js create-typescript-definitions
|
||||
- name: Publish Electron Dist ${{ inputs.step-suffix }}
|
||||
if: ${{ inputs.is-release == 'true' }}
|
||||
shell: bash
|
||||
id: github-upload
|
||||
run: |
|
||||
rm -rf src/out/Default/obj
|
||||
cd src/electron
|
||||
@@ -202,6 +191,11 @@ runs:
|
||||
echo 'Uploading Electron release distribution to GitHub releases'
|
||||
script/release/uploaders/upload.py --verbose
|
||||
fi
|
||||
- name: Generate artifact attestation
|
||||
if: ${{ inputs.is-release == 'true' }}
|
||||
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
|
||||
with:
|
||||
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
|
||||
- name: Generate siso report
|
||||
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
|
||||
shell: bash
|
||||
|
||||
6
.github/actions/checkout/action.yml
vendored
6
.github/actions/checkout/action.yml
vendored
@@ -143,16 +143,17 @@ runs:
|
||||
echo "No changes to patches detected"
|
||||
fi
|
||||
fi
|
||||
- name: Remove patch conflict problem matcher
|
||||
- name: Remove patch conflict problem matchers
|
||||
shell: bash
|
||||
run: |
|
||||
echo "::remove-matcher owner=merge-conflict::"
|
||||
echo "::remove-matcher owner=patch-conflict::"
|
||||
echo "::remove-matcher owner=patch-needs-update::"
|
||||
- name: Upload patches stats
|
||||
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
|
||||
shell: bash
|
||||
run: |
|
||||
npx node src/electron/script/patches-stats.mjs --upload-stats || true
|
||||
node src/electron/script/patches-stats.mjs --upload-stats || true
|
||||
# delete all .git directories under src/ except for
|
||||
# third_party/angle/ and third_party/dawn/ because of build time generation of files
|
||||
# gen/angle/commit.h depends on third_party/angle/.git/HEAD
|
||||
@@ -172,6 +173,7 @@ runs:
|
||||
run: |
|
||||
rm -rf src/android_webview
|
||||
rm -rf src/ios/chrome
|
||||
rm -rf src/third_party/blink/web_tests
|
||||
rm -rf src/third_party/blink/perf_tests
|
||||
rm -rf src/chrome/test/data/xr/webvr_info
|
||||
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src
|
||||
|
||||
48
.github/actions/free-space-macos/action.yml
vendored
48
.github/actions/free-space-macos/action.yml
vendored
@@ -6,8 +6,6 @@ runs:
|
||||
- name: Free Space on MacOS
|
||||
shell: bash
|
||||
run: |
|
||||
echo "Disk usage before cleanup:"
|
||||
df -h
|
||||
sudo mkdir -p $TMPDIR/del-target
|
||||
|
||||
tmpify() {
|
||||
@@ -17,30 +15,28 @@ runs:
|
||||
}
|
||||
|
||||
strip_universal_deep() {
|
||||
if [ -d "$1" ]; then
|
||||
opwd=$(pwd)
|
||||
cd $1
|
||||
f=$(find . -perm +111 -type f)
|
||||
for fp in $f
|
||||
do
|
||||
if [[ $(file "$fp") == *"universal binary"* ]]; then
|
||||
if [ "`arch`" == "arm64" ]; then
|
||||
if [[ $(file "$fp") == *"x86_64"* ]]; then
|
||||
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
else
|
||||
if [[ $(file "$fp") == *"arm64e)"* ]]; then
|
||||
sudo lipo -remove arm64e "$fp" -o "$fp" || true
|
||||
fi
|
||||
if [[ $(file "$fp") == *"arm64)"* ]]; then
|
||||
sudo lipo -remove arm64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
opwd=$(pwd)
|
||||
cd $1
|
||||
f=$(find . -perm +111 -type f)
|
||||
for fp in $f
|
||||
do
|
||||
if [[ $(file "$fp") == *"universal binary"* ]]; then
|
||||
if [ "`arch`" == "arm64" ]; then
|
||||
if [[ $(file "$fp") == *"x86_64"* ]]; then
|
||||
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
else
|
||||
if [[ $(file "$fp") == *"arm64e)"* ]]; then
|
||||
sudo lipo -remove arm64e "$fp" -o "$fp" || true
|
||||
fi
|
||||
if [[ $(file "$fp") == *"arm64)"* ]]; then
|
||||
sudo lipo -remove arm64 "$fp" -o "$fp" || true
|
||||
fi
|
||||
fi
|
||||
done
|
||||
fi
|
||||
done
|
||||
|
||||
cd $opwd
|
||||
fi
|
||||
cd $opwd
|
||||
}
|
||||
|
||||
tmpify /Library/Developer/CoreSimulator
|
||||
@@ -62,9 +58,10 @@ runs:
|
||||
|
||||
sudo rm -rf /Applications/Safari.app
|
||||
sudo rm -rf /Applications/Xcode_16.1.app
|
||||
sudo rm -rf /Applications/Xcode_16.2.app
|
||||
sudo rm -rf /Applications/Xcode_16.3.app
|
||||
sudo rm -rf /Applications/Xcode_16.2.app
|
||||
sudo rm -rf /Applications/Google Chrome.app
|
||||
sudo rm -rf /Applications/Xcode_16.4.app
|
||||
sudo rm -rf /Applications/Google Chrome for Testing.app
|
||||
sudo rm -rf /Applications/Firefox.app
|
||||
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
|
||||
@@ -76,5 +73,4 @@ runs:
|
||||
|
||||
# lipo off some huge binaries arm64 versions to save space
|
||||
strip_universal_deep $(xcode-select -p)/../SharedFrameworks
|
||||
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
|
||||
sudo mdutil -a -i off
|
||||
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
|
||||
14
.github/actions/generate-types/action.yml
vendored
14
.github/actions/generate-types/action.yml
vendored
@@ -13,12 +13,16 @@ runs:
|
||||
- name: Generating Types for SHA in ${{ inputs.sha-file }}
|
||||
shell: bash
|
||||
run: |
|
||||
git checkout $(cat ${{ inputs.sha-file }})
|
||||
rm -rf node_modules
|
||||
yarn install --frozen-lockfile --ignore-scripts
|
||||
export ELECTRON_DIR=$(pwd)
|
||||
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
|
||||
cd /tmp
|
||||
git clone https://github.com/electron/electron.git
|
||||
cd electron
|
||||
fi
|
||||
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
|
||||
node script/yarn.js install --immutable
|
||||
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
|
||||
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
|
||||
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
|
||||
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
|
||||
git checkout .
|
||||
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
|
||||
working-directory: ./electron
|
||||
|
||||
@@ -15,7 +15,7 @@ runs:
|
||||
git config --global core.preloadindex true
|
||||
git config --global core.longpaths true
|
||||
fi
|
||||
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
|
||||
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
|
||||
npm i -g @electron/build-tools
|
||||
# Update depot_tools to ensure python
|
||||
e d update_depot_tools
|
||||
|
||||
14
.github/actions/install-dependencies/action.yml
vendored
14
.github/actions/install-dependencies/action.yml
vendored
@@ -6,7 +6,7 @@ runs:
|
||||
- name: Get yarn cache directory path
|
||||
shell: bash
|
||||
id: yarn-cache-dir-path
|
||||
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
|
||||
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
|
||||
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
|
||||
id: yarn-cache
|
||||
with:
|
||||
@@ -18,4 +18,14 @@ runs:
|
||||
shell: bash
|
||||
run: |
|
||||
cd src/electron
|
||||
node script/yarn install --frozen-lockfile --prefer-offline
|
||||
if [ "$TARGET_ARCH" = "x86" ]; then
|
||||
export npm_config_arch="ia32"
|
||||
fi
|
||||
# if running on linux arm skip yarn Builds
|
||||
ARCH=$(uname -m)
|
||||
if [ "$ARCH" = "armv7l" ]; then
|
||||
echo "Skipping yarn build on linux arm"
|
||||
node script/yarn.js install --immutable --mode=skip-build
|
||||
else
|
||||
node script/yarn.js install --immutable
|
||||
fi
|
||||
|
||||
122
.github/copilot-instructions.md
vendored
Normal file
122
.github/copilot-instructions.md
vendored
Normal file
@@ -0,0 +1,122 @@
|
||||
# Copilot Instructions for Electron
|
||||
|
||||
## Build System
|
||||
|
||||
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
|
||||
|
||||
```bash
|
||||
e sync # Fetch sources and apply patches
|
||||
e build # Build Electron (GN + Ninja)
|
||||
e build -k 999 # Build, continuing through errors
|
||||
e start # Run built Electron
|
||||
e start --version # Verify Electron launches
|
||||
e test # Run full test suite
|
||||
e debug # Run in debugger (lldb on macOS, gdb on Linux)
|
||||
```
|
||||
|
||||
### Linting
|
||||
|
||||
```bash
|
||||
npm run lint # Run all linters (JS, C++, Python, GN, docs)
|
||||
npm run lint:js # JavaScript/TypeScript only
|
||||
npm run lint:clang-format # C++ formatting only
|
||||
npm run lint:cpp # C++ linting only
|
||||
npm run lint:docs # Documentation only
|
||||
```
|
||||
|
||||
### Running a Single Test
|
||||
|
||||
```bash
|
||||
npm run test -- -g "pattern" # Run tests matching a regex pattern
|
||||
# Example: npm run test -- -g "ipc"
|
||||
```
|
||||
|
||||
### Running a Single Node.js Test
|
||||
|
||||
```bash
|
||||
node script/node-spec-runner.js parallel/test-crypto-keygen
|
||||
```
|
||||
|
||||
## Architecture
|
||||
|
||||
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
|
||||
|
||||
### Process Model
|
||||
|
||||
Electron has two primary process types, mirroring Chromium:
|
||||
|
||||
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
|
||||
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
|
||||
|
||||
### Native ↔ JavaScript Bridge
|
||||
|
||||
Each API is implemented as a C++/JS pair:
|
||||
|
||||
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
|
||||
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
|
||||
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
|
||||
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
|
||||
|
||||
### Patches System
|
||||
|
||||
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
|
||||
|
||||
```text
|
||||
patches/{target}/*.patch → [e sync] → target repo commits
|
||||
← [e patches] ←
|
||||
```
|
||||
|
||||
Key rules:
|
||||
|
||||
- Fix existing patches rather than creating new ones
|
||||
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
|
||||
- Each patch commit message must explain why the patch exists
|
||||
- After modifying patches, run `e patches {target}` to export
|
||||
|
||||
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
|
||||
|
||||
## Conventions
|
||||
|
||||
### File Naming
|
||||
|
||||
- JS/TS files: kebab-case (`file-name.ts`)
|
||||
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
|
||||
- Test files: `api-{module-name}-spec.ts` in `spec/`
|
||||
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
|
||||
|
||||
### JavaScript/TypeScript
|
||||
|
||||
- Semicolons required (`"semi": ["error", "always"]`)
|
||||
- `const` and `let` only (no `var`)
|
||||
- Arrow functions preferred
|
||||
- Import order enforced: `@electron/internal` → `@electron` → `electron` → external → builtin → relative
|
||||
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
|
||||
- Prefer getters/setters over jQuery-style `.text([text])` patterns
|
||||
|
||||
### C++
|
||||
|
||||
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
|
||||
- Uses Chromium abstractions (`base::`, `content::`, etc.)
|
||||
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
|
||||
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
|
||||
|
||||
### Testing
|
||||
|
||||
- Framework: Mocha + Chai + Sinon
|
||||
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
|
||||
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
|
||||
- Tests import from `electron/main` or `electron/renderer`
|
||||
|
||||
### Documentation
|
||||
|
||||
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
|
||||
- API history tracked via YAML blocks in HTML comments within doc files
|
||||
- Docs must pass `npm run lint:docs`
|
||||
|
||||
### Build Configuration
|
||||
|
||||
- `BUILD.gn`: Main GN build config
|
||||
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
|
||||
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
|
||||
- `DEPS`: Dependency versions and checkout paths
|
||||
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)
|
||||
10
.github/problem-matchers/patch-conflict.json
vendored
10
.github/problem-matchers/patch-conflict.json
vendored
@@ -19,6 +19,16 @@
|
||||
"line": 3
|
||||
}
|
||||
]
|
||||
},
|
||||
{
|
||||
"owner": "patch-needs-update",
|
||||
"pattern": [
|
||||
{
|
||||
"regexp": "^((patches\/.*): needs update)$",
|
||||
"message": 1,
|
||||
"file": 2
|
||||
}
|
||||
]
|
||||
}
|
||||
]
|
||||
}
|
||||
|
||||
10
.github/workflows/archaeologist-dig.yml
vendored
10
.github/workflows/archaeologist-dig.yml
vendored
@@ -3,17 +3,21 @@ name: Archaeologist
|
||||
on:
|
||||
pull_request:
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
archaeologist-dig:
|
||||
name: Archaeologist Dig
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
contents: read
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
|
||||
with:
|
||||
fetch-depth: 0
|
||||
- name: Setup Node.js/npm
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
- name: Setting Up Dig Site
|
||||
@@ -41,7 +45,7 @@ jobs:
|
||||
sha-file: .dig-old
|
||||
filename: electron.old.d.ts
|
||||
- name: Upload artifacts
|
||||
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
|
||||
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
|
||||
with:
|
||||
name: artifacts
|
||||
path: electron/artifacts
|
||||
|
||||
15
.github/workflows/audit-branch-ci.yml
vendored
15
.github/workflows/audit-branch-ci.yml
vendored
@@ -15,12 +15,8 @@ jobs:
|
||||
permissions:
|
||||
contents: read
|
||||
steps:
|
||||
- name: Setup Node.js
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
|
||||
with:
|
||||
node-version: 22.17.x
|
||||
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
|
||||
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
|
||||
- run: npm install @actions/cache @electron/fiddle-core
|
||||
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
|
||||
id: audit-errors
|
||||
with:
|
||||
github-token: ${{ secrets.GITHUB_TOKEN }}
|
||||
@@ -33,7 +29,7 @@ jobs:
|
||||
// Only want the most recent workflow run that wasn't skipped or cancelled
|
||||
const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
|
||||
|
||||
const versions = await ElectronVersions.create({ ignoreCache: true });
|
||||
const versions = await ElectronVersions.create(undefined, { ignoreCache: true });
|
||||
const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
|
||||
|
||||
for (const branch of ["main", ...branches]) {
|
||||
@@ -73,7 +69,6 @@ jobs:
|
||||
annotation_level === "failure" &&
|
||||
!message.startsWith("Process completed with exit code") &&
|
||||
!message.startsWith("Response status code does not indicate success") &&
|
||||
!message.startsWith("The hosted runner lost communication with the server") &&
|
||||
!/Unable to make request/.test(message) &&
|
||||
!/The requested URL returned error/.test(message),
|
||||
)
|
||||
@@ -106,6 +101,7 @@ jobs:
|
||||
}
|
||||
|
||||
if (runsWithErrors.length > 0) {
|
||||
core.setOutput('errorsFound', true);
|
||||
core.summary.addHeading('⚠️ Runs with Errors');
|
||||
core.summary.addTable([
|
||||
[
|
||||
@@ -132,7 +128,6 @@ jobs:
|
||||
|
||||
// Set this as failed so it's easy to scan runs to find failures
|
||||
if (runsWithErrors.find((run) => !run.isStale)) {
|
||||
core.setOutput('errorsFound', true);
|
||||
process.exitCode = 1;
|
||||
}
|
||||
} else {
|
||||
@@ -142,7 +137,7 @@ jobs:
|
||||
await core.summary.write();
|
||||
- name: Send Slack message if errors
|
||||
if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
|
||||
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
|
||||
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
|
||||
with:
|
||||
payload: |
|
||||
link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"
|
||||
|
||||
2
.github/workflows/branch-created.yml
vendored
2
.github/workflows/branch-created.yml
vendored
@@ -75,7 +75,7 @@ jobs:
|
||||
org: electron
|
||||
- name: Generate Release Project Board Metadata
|
||||
if: ${{ steps.check-major-version.outputs.MAJOR }}
|
||||
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
|
||||
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
|
||||
id: generate-project-metadata
|
||||
with:
|
||||
script: |
|
||||
|
||||
20
.github/workflows/build-git-cache.yml
vendored
20
.github/workflows/build-git-cache.yml
vendored
@@ -6,11 +6,15 @@ on:
|
||||
schedule:
|
||||
- cron: "0 0 * * *"
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
build-git-cache-linux:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
|
||||
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
|
||||
options: --user root
|
||||
volumes:
|
||||
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
|
||||
@@ -19,7 +23,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -30,8 +34,10 @@ jobs:
|
||||
|
||||
build-git-cache-windows:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
|
||||
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
|
||||
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
|
||||
volumes:
|
||||
- /mnt/win-cache:/mnt/win-cache
|
||||
@@ -41,7 +47,7 @@ jobs:
|
||||
TARGET_OS: 'win'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -52,10 +58,12 @@ jobs:
|
||||
|
||||
build-git-cache-macos:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
# This job updates the same git cache as linux, so it needs to run after the linux one.
|
||||
needs: build-git-cache-linux
|
||||
container:
|
||||
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
|
||||
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
|
||||
options: --user root
|
||||
volumes:
|
||||
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
|
||||
@@ -64,7 +72,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
49
.github/workflows/build.yml
vendored
49
.github/workflows/build.yml
vendored
@@ -6,7 +6,7 @@ on:
|
||||
build-image-sha:
|
||||
type: string
|
||||
description: 'SHA for electron/build image'
|
||||
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
|
||||
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
|
||||
required: true
|
||||
skip-macos:
|
||||
type: boolean
|
||||
@@ -43,10 +43,13 @@ defaults:
|
||||
run:
|
||||
shell: bash
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
setup:
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
contents: read
|
||||
pull-requests: read
|
||||
outputs:
|
||||
docs: ${{ steps.filter.outputs.docs }}
|
||||
@@ -54,7 +57,7 @@ jobs:
|
||||
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
|
||||
docs-only: ${{ steps.set-output.outputs.docs-only }}
|
||||
steps:
|
||||
- uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
|
||||
with:
|
||||
ref: ${{ github.event.pull_request.head.sha }}
|
||||
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
|
||||
@@ -63,13 +66,17 @@ jobs:
|
||||
filters: |
|
||||
docs:
|
||||
- 'docs/**'
|
||||
- README.md
|
||||
- SECURITY.md
|
||||
- CONTRIBUTING.md
|
||||
- CODE_OF_CONDUCT.md
|
||||
src:
|
||||
- '!docs/**'
|
||||
- name: Set Outputs for Build Image SHA & Docs Only
|
||||
id: set-output
|
||||
run: |
|
||||
if [ -z "${{ inputs.build-image-sha }}" ]; then
|
||||
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
|
||||
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
|
||||
else
|
||||
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
|
||||
fi
|
||||
@@ -80,6 +87,8 @@ jobs:
|
||||
needs: setup
|
||||
if: ${{ !inputs.skip-lint }}
|
||||
uses: ./.github/workflows/pipeline-electron-lint.yml
|
||||
permissions:
|
||||
contents: read
|
||||
with:
|
||||
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
|
||||
secrets: inherit
|
||||
@@ -89,6 +98,8 @@ jobs:
|
||||
needs: [setup, checkout-linux]
|
||||
if: ${{ needs.setup.outputs.docs-only == 'true' }}
|
||||
uses: ./.github/workflows/pipeline-electron-docs-only.yml
|
||||
permissions:
|
||||
contents: read
|
||||
with:
|
||||
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
|
||||
secrets: inherit
|
||||
@@ -98,6 +109,8 @@ jobs:
|
||||
needs: setup
|
||||
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
|
||||
options: --user root
|
||||
@@ -111,7 +124,7 @@ jobs:
|
||||
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -126,6 +139,8 @@ jobs:
|
||||
needs: setup
|
||||
if: ${{ !inputs.skip-linux}}
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
|
||||
options: --user root
|
||||
@@ -141,7 +156,7 @@ jobs:
|
||||
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -155,6 +170,8 @@ jobs:
|
||||
needs: setup
|
||||
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
|
||||
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
|
||||
@@ -171,7 +188,7 @@ jobs:
|
||||
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -185,16 +202,20 @@ jobs:
|
||||
# GN Check Jobs
|
||||
macos-gn-check:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
|
||||
permissions:
|
||||
contents: read
|
||||
needs: checkout-macos
|
||||
with:
|
||||
target-platform: macos
|
||||
target-archs: x64 arm64
|
||||
check-runs-on: macos-15
|
||||
check-runs-on: macos-14
|
||||
gn-build-type: testing
|
||||
secrets: inherit
|
||||
|
||||
linux-gn-check:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
|
||||
permissions:
|
||||
contents: read
|
||||
needs: checkout-linux
|
||||
if: ${{ needs.setup.outputs.src == 'true' }}
|
||||
with:
|
||||
@@ -207,6 +228,8 @@ jobs:
|
||||
|
||||
windows-gn-check:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
|
||||
permissions:
|
||||
contents: read
|
||||
needs: checkout-windows
|
||||
with:
|
||||
target-platform: win
|
||||
@@ -225,8 +248,8 @@ jobs:
|
||||
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
|
||||
needs: checkout-macos
|
||||
with:
|
||||
build-runs-on: macos-15-xlarge
|
||||
test-runs-on: macos-15-large
|
||||
build-runs-on: macos-14-xlarge
|
||||
test-runs-on: macos-14-large
|
||||
target-platform: macos
|
||||
target-arch: x64
|
||||
is-release: false
|
||||
@@ -244,8 +267,8 @@ jobs:
|
||||
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
|
||||
needs: checkout-macos
|
||||
with:
|
||||
build-runs-on: macos-15-xlarge
|
||||
test-runs-on: macos-15
|
||||
build-runs-on: macos-14-xlarge
|
||||
test-runs-on: macos-14
|
||||
target-platform: macos
|
||||
target-arch: arm64
|
||||
is-release: false
|
||||
@@ -310,7 +333,7 @@ jobs:
|
||||
build-runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
test-runs-on: electron-arc-centralus-linux-arm64-4core
|
||||
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
|
||||
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
|
||||
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
|
||||
target-platform: linux
|
||||
target-arch: arm
|
||||
is-release: false
|
||||
@@ -400,6 +423,8 @@ jobs:
|
||||
gha-done:
|
||||
name: GitHub Actions Completed
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
contents: read
|
||||
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
|
||||
if: always() && !contains(needs.*.result, 'failure')
|
||||
steps:
|
||||
|
||||
10
.github/workflows/clean-src-cache.yml
vendored
10
.github/workflows/clean-src-cache.yml
vendored
@@ -1,16 +1,20 @@
|
||||
name: Clean Source Cache
|
||||
|
||||
description: |
|
||||
This workflow cleans up the source cache on the cross-instance cache volume
|
||||
to free up space. It runs daily at midnight and clears files older than 15 days.
|
||||
# Description:
|
||||
# This workflow cleans up the source cache on the cross-instance cache volume
|
||||
# to free up space. It runs daily at midnight and clears files older than 15 days.
|
||||
|
||||
on:
|
||||
schedule:
|
||||
- cron: "0 0 * * *"
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
clean-src-cache:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
|
||||
options: --user root
|
||||
|
||||
11
.github/workflows/issue-commented.yml
vendored
11
.github/workflows/issue-commented.yml
vendored
@@ -10,24 +10,15 @@ permissions: {}
|
||||
jobs:
|
||||
issue-commented:
|
||||
name: Remove blocked/{need-info,need-repro} on comment
|
||||
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
|
||||
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Get author association
|
||||
id: get-author-association
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
run: |
|
||||
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
|
||||
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
|
||||
id: generate-token
|
||||
with:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- name: Remove label
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
|
||||
ISSUE_URL: ${{ github.event.issue.html_url }}
|
||||
|
||||
9
.github/workflows/issue-labeled.yml
vendored
9
.github/workflows/issue-labeled.yml
vendored
@@ -4,14 +4,15 @@ on:
|
||||
issues:
|
||||
types: [labeled]
|
||||
|
||||
permissions: # added using https://github.com/step-security/secure-workflows
|
||||
contents: read
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
issue-labeled-with-status:
|
||||
name: status/{confirmed,reviewed} label added
|
||||
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
contents: read
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
@@ -31,6 +32,8 @@ jobs:
|
||||
name: blocked/* label added
|
||||
if: startsWith(github.event.label.name, 'blocked/')
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
contents: read
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
@@ -72,7 +75,7 @@ jobs:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- name: Create comment
|
||||
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
|
||||
uses: actions-cool/issues-helper@564cd9b1baacd7a9cd634e8039a149901ee5f600 # v3.7.1
|
||||
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
|
||||
with:
|
||||
actions: 'create-comment'
|
||||
token: ${{ steps.generate-token.outputs.token }}
|
||||
|
||||
6
.github/workflows/issue-opened.yml
vendored
6
.github/workflows/issue-opened.yml
vendored
@@ -11,6 +11,7 @@ jobs:
|
||||
add-to-issue-triage:
|
||||
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
@@ -28,6 +29,7 @@ jobs:
|
||||
set-labels:
|
||||
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
@@ -37,7 +39,7 @@ jobs:
|
||||
org: electron
|
||||
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
|
||||
- name: Add labels
|
||||
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
|
||||
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
|
||||
id: add-labels
|
||||
env:
|
||||
ISSUE_BODY: ${{ github.event.issue.body }}
|
||||
@@ -134,7 +136,7 @@ jobs:
|
||||
}
|
||||
- name: Create unsupported major comment
|
||||
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
|
||||
uses: actions-cool/issues-helper@564cd9b1baacd7a9cd634e8039a149901ee5f600 # v3.7.1
|
||||
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
|
||||
with:
|
||||
actions: 'create-comment'
|
||||
token: ${{ steps.generate-token.outputs.token }}
|
||||
|
||||
1
.github/workflows/issue-transferred.yml
vendored
1
.github/workflows/issue-transferred.yml
vendored
@@ -10,6 +10,7 @@ jobs:
|
||||
issue-transferred:
|
||||
name: Issue Transferred
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
if: ${{ !github.event.changes.new_repository.private }}
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
|
||||
5
.github/workflows/issue-unlabeled.yml
vendored
5
.github/workflows/issue-unlabeled.yml
vendored
@@ -4,14 +4,15 @@ on:
|
||||
issues:
|
||||
types: [unlabeled]
|
||||
|
||||
permissions:
|
||||
contents: read
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
issue-unlabeled-blocked:
|
||||
name: All blocked/* labels removed
|
||||
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
|
||||
runs-on: ubuntu-latest
|
||||
permissions:
|
||||
contents: read
|
||||
steps:
|
||||
- name: Check for any blocked labels
|
||||
id: check-for-blocked-labels
|
||||
|
||||
29
.github/workflows/linux-publish.yml
vendored
29
.github/workflows/linux-publish.yml
vendored
@@ -6,7 +6,7 @@ on:
|
||||
build-image-sha:
|
||||
type: string
|
||||
description: 'SHA for electron/build image'
|
||||
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
|
||||
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
|
||||
upload-to-storage:
|
||||
description: 'Uploads to Azure storage'
|
||||
required: false
|
||||
@@ -17,9 +17,13 @@ on:
|
||||
type: boolean
|
||||
default: false
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
checkout-linux:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
|
||||
options: --user root
|
||||
@@ -31,7 +35,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -39,7 +43,12 @@ jobs:
|
||||
uses: ./src/electron/.github/actions/checkout
|
||||
|
||||
publish-x64:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-linux
|
||||
with:
|
||||
environment: production-release
|
||||
@@ -54,7 +63,12 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-arm:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-linux
|
||||
with:
|
||||
environment: production-release
|
||||
@@ -69,7 +83,12 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-arm64:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-linux
|
||||
with:
|
||||
environment: production-release
|
||||
|
||||
44
.github/workflows/macos-publish.yml
vendored
44
.github/workflows/macos-publish.yml
vendored
@@ -6,7 +6,7 @@ on:
|
||||
build-image-sha:
|
||||
type: string
|
||||
description: 'SHA for electron/build image'
|
||||
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
|
||||
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
|
||||
required: true
|
||||
upload-to-storage:
|
||||
description: 'Uploads to Azure storage'
|
||||
@@ -18,9 +18,13 @@ on:
|
||||
type: boolean
|
||||
default: false
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
checkout-macos:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
|
||||
options: --user root
|
||||
@@ -32,7 +36,7 @@ jobs:
|
||||
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -43,11 +47,16 @@ jobs:
|
||||
target-platform: macos
|
||||
|
||||
publish-x64-darwin:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: x64
|
||||
target-variant: darwin
|
||||
@@ -58,11 +67,16 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-x64-mas:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: x64
|
||||
target-variant: mas
|
||||
@@ -73,11 +87,16 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-arm64-darwin:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: arm64
|
||||
target-variant: darwin
|
||||
@@ -88,11 +107,16 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-arm64-mas:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-macos
|
||||
with:
|
||||
environment: production-release
|
||||
build-runs-on: macos-15-xlarge
|
||||
build-runs-on: macos-14-xlarge
|
||||
target-platform: macos
|
||||
target-arch: arm64
|
||||
target-variant: mas
|
||||
|
||||
@@ -7,28 +7,22 @@ on:
|
||||
- 'spec/yarn.lock'
|
||||
- '.github/workflows/**'
|
||||
- '.github/actions/**'
|
||||
- '.yarn/**'
|
||||
- '.yarnrc.yml'
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
check-for-non-maintainer-dependency-change:
|
||||
name: Check for disallowed non-maintainer change
|
||||
if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.pull_request.author_association) && github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
|
||||
permissions:
|
||||
contents: read
|
||||
pull-requests: write
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: Get author association
|
||||
id: get-author-association
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
run: |
|
||||
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
|
||||
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
|
||||
- name: Check for existing review
|
||||
id: check-for-review
|
||||
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
PR_URL: ${{ github.event.pull_request.html_url }}
|
||||
|
||||
@@ -55,6 +55,8 @@ on:
|
||||
type: boolean
|
||||
default: false
|
||||
|
||||
permissions: {}
|
||||
|
||||
concurrency:
|
||||
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
@@ -62,6 +64,8 @@ concurrency:
|
||||
jobs:
|
||||
build:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
permissions:
|
||||
contents: read
|
||||
with:
|
||||
build-runs-on: ${{ inputs.build-runs-on }}
|
||||
build-container: ${{ inputs.build-container }}
|
||||
@@ -74,6 +78,10 @@ jobs:
|
||||
secrets: inherit
|
||||
test:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-test.yml
|
||||
permissions:
|
||||
contents: read
|
||||
issues: read
|
||||
pull-requests: read
|
||||
needs: build
|
||||
with:
|
||||
target-arch: ${{ inputs.target-arch }}
|
||||
@@ -83,6 +91,8 @@ jobs:
|
||||
secrets: inherit
|
||||
nn-test:
|
||||
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
|
||||
permissions:
|
||||
contents: read
|
||||
needs: build
|
||||
with:
|
||||
target-arch: ${{ inputs.target-arch }}
|
||||
|
||||
@@ -64,14 +64,13 @@ concurrency:
|
||||
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
|
||||
permissions:
|
||||
contents: read
|
||||
issues: read
|
||||
pull-requests: read
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
build:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
permissions:
|
||||
contents: read
|
||||
with:
|
||||
build-runs-on: ${{ inputs.build-runs-on }}
|
||||
build-container: ${{ inputs.build-container }}
|
||||
@@ -86,6 +85,10 @@ jobs:
|
||||
secrets: inherit
|
||||
test:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-test.yml
|
||||
permissions:
|
||||
contents: read
|
||||
issues: read
|
||||
pull-requests: read
|
||||
needs: build
|
||||
with:
|
||||
target-arch: ${{ inputs.target-arch }}
|
||||
|
||||
@@ -8,6 +8,8 @@ on:
|
||||
description: 'Container to run the docs-only ts compile in'
|
||||
type: string
|
||||
|
||||
permissions: {}
|
||||
|
||||
concurrency:
|
||||
group: electron-docs-only-${{ github.ref }}
|
||||
cancel-in-progress: true
|
||||
@@ -19,11 +21,13 @@ jobs:
|
||||
docs-only:
|
||||
name: Docs Only Compile
|
||||
runs-on: electron-arc-centralus-linux-amd64-4core
|
||||
permissions:
|
||||
contents: read
|
||||
timeout-minutes: 20
|
||||
container: ${{ fromJSON(inputs.container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -39,7 +43,7 @@ jobs:
|
||||
with:
|
||||
target-platform: linux
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -50,12 +54,12 @@ jobs:
|
||||
shell: bash
|
||||
run: |
|
||||
cd src/electron
|
||||
node script/yarn create-typescript-definitions
|
||||
node script/yarn tsc -p tsconfig.default_app.json --noEmit
|
||||
node script/yarn.js create-typescript-definitions
|
||||
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
|
||||
for f in build/webpack/*.js
|
||||
do
|
||||
out="${f:29}"
|
||||
if [ "$out" != "base.js" ]; then
|
||||
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
|
||||
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
|
||||
fi
|
||||
done
|
||||
|
||||
22
.github/workflows/pipeline-electron-lint.yml
vendored
22
.github/workflows/pipeline-electron-lint.yml
vendored
@@ -8,6 +8,8 @@ on:
|
||||
description: 'Container to run lint in'
|
||||
type: string
|
||||
|
||||
permissions: {}
|
||||
|
||||
concurrency:
|
||||
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
@@ -19,11 +21,13 @@ jobs:
|
||||
lint:
|
||||
name: Lint
|
||||
runs-on: electron-arc-centralus-linux-amd64-4core
|
||||
permissions:
|
||||
contents: read
|
||||
timeout-minutes: 20
|
||||
container: ${{ fromJSON(inputs.container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -42,7 +46,7 @@ jobs:
|
||||
shell: bash
|
||||
run: |
|
||||
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
|
||||
gn_version="$(curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
|
||||
gn_version="$(curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
|
||||
|
||||
cipd ensure -ensure-file - -root . <<-CIPD
|
||||
\$ServiceURL https://chrome-infra-packages.appspot.com/
|
||||
@@ -58,7 +62,7 @@ jobs:
|
||||
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
|
||||
|
||||
mkdir -p src/buildtools
|
||||
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
|
||||
curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
|
||||
|
||||
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
|
||||
- name: Add ESLint problem matcher
|
||||
@@ -74,11 +78,15 @@ jobs:
|
||||
# but then we would lint its contents (at least gn format), and it doesn't pass it.
|
||||
|
||||
cd src/electron
|
||||
node script/yarn install --frozen-lockfile
|
||||
node script/yarn lint
|
||||
node script/yarn.js install --immutable
|
||||
node script/yarn.js lint
|
||||
- name: Run Script Typechecker
|
||||
shell: bash
|
||||
run: |
|
||||
cd src/electron
|
||||
node script/yarn tsc -p tsconfig.script.json
|
||||
|
||||
node script/yarn.js tsc -p tsconfig.script.json
|
||||
- name: Check GHA Workflows
|
||||
shell: bash
|
||||
run: |
|
||||
cd src/electron
|
||||
node script/copy-pipeline-segment-publish.js --check
|
||||
|
||||
@@ -59,6 +59,8 @@ on:
|
||||
type: boolean
|
||||
default: false
|
||||
|
||||
permissions: {}
|
||||
|
||||
concurrency:
|
||||
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
@@ -81,6 +83,8 @@ jobs:
|
||||
run:
|
||||
shell: bash
|
||||
runs-on: ${{ inputs.build-runs-on }}
|
||||
permissions:
|
||||
contents: read
|
||||
container: ${{ fromJSON(inputs.build-container) }}
|
||||
environment: ${{ inputs.environment }}
|
||||
env:
|
||||
@@ -91,7 +95,7 @@ jobs:
|
||||
run: |
|
||||
mkdir src
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -115,7 +119,7 @@ jobs:
|
||||
run: df -h
|
||||
- name: Setup Node.js/npm
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
cache: yarn
|
||||
@@ -159,7 +163,7 @@ jobs:
|
||||
if: ${{ inputs.target-platform == 'linux' }}
|
||||
uses: ./src/electron/.github/actions/restore-cache-aks
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
@@ -26,6 +26,8 @@ on:
|
||||
type: string
|
||||
default: testing
|
||||
|
||||
permissions: {}
|
||||
|
||||
concurrency:
|
||||
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
|
||||
cancel-in-progress: true
|
||||
@@ -41,10 +43,12 @@ jobs:
|
||||
run:
|
||||
shell: bash
|
||||
runs-on: ${{ inputs.check-runs-on }}
|
||||
permissions:
|
||||
contents: read
|
||||
container: ${{ fromJSON(inputs.check-container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -111,7 +115,7 @@ jobs:
|
||||
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
|
||||
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
|
||||
237
.github/workflows/pipeline-segment-electron-publish.yml
vendored
Normal file
237
.github/workflows/pipeline-segment-electron-publish.yml
vendored
Normal file
@@ -0,0 +1,237 @@
|
||||
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
|
||||
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
|
||||
|
||||
name: Pipeline Segment - Electron Build
|
||||
on:
|
||||
workflow_call:
|
||||
inputs:
|
||||
environment:
|
||||
description: using the production or testing environment
|
||||
required: false
|
||||
type: string
|
||||
target-platform:
|
||||
type: string
|
||||
description: Platform to run on, can be macos, win or linux
|
||||
required: true
|
||||
target-arch:
|
||||
type: string
|
||||
description: Arch to build for, can be x64, arm64, ia32 or arm
|
||||
required: true
|
||||
target-variant:
|
||||
type: string
|
||||
description: Variant to build for, no effect on non-macOS target platforms. Can
|
||||
be darwin, mas or all.
|
||||
default: all
|
||||
build-runs-on:
|
||||
type: string
|
||||
description: What host to run the build
|
||||
required: true
|
||||
build-container:
|
||||
type: string
|
||||
description: JSON container information for aks runs-on
|
||||
required: false
|
||||
default: '{"image":null}'
|
||||
is-release:
|
||||
description: Whether this build job is a release job
|
||||
required: true
|
||||
type: boolean
|
||||
default: false
|
||||
gn-build-type:
|
||||
description: The gn build type - testing or release
|
||||
required: true
|
||||
type: string
|
||||
default: testing
|
||||
generate-symbols:
|
||||
description: Whether or not to generate symbols
|
||||
required: true
|
||||
type: boolean
|
||||
default: false
|
||||
upload-to-storage:
|
||||
description: Whether or not to upload build artifacts to external storage
|
||||
required: true
|
||||
type: string
|
||||
default: "0"
|
||||
is-asan:
|
||||
description: Building the Address Sanitizer (ASan) Linux build
|
||||
required: false
|
||||
type: boolean
|
||||
default: false
|
||||
enable-ssh:
|
||||
description: Enable SSH debugging
|
||||
required: false
|
||||
type: boolean
|
||||
default: false
|
||||
permissions: {}
|
||||
concurrency:
|
||||
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
|
||||
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
|
||||
github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
env:
|
||||
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
|
||||
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
|
||||
DD_API_KEY: ${{ secrets.DD_API_KEY }}
|
||||
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
|
||||
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
|
||||
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
|
||||
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
|
||||
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
|
||||
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
|
||||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
|
||||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
|
||||
ELECTRON_OUT_DIR: Default
|
||||
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
|
||||
jobs:
|
||||
build:
|
||||
defaults:
|
||||
run:
|
||||
shell: bash
|
||||
runs-on: ${{ inputs.build-runs-on }}
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
container: ${{ fromJSON(inputs.build-container) }}
|
||||
environment: ${{ inputs.environment }}
|
||||
env:
|
||||
TARGET_ARCH: ${{ inputs.target-arch }}
|
||||
TARGET_PLATFORM: ${{ inputs.target-platform }}
|
||||
steps:
|
||||
- name: Create src dir
|
||||
run: |
|
||||
mkdir src
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
ref: ${{ github.event.pull_request.head.sha }}
|
||||
- name: Setup SSH Debugging
|
||||
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
|
||||
env.ACTIONS_STEP_DEBUG == 'true') }}
|
||||
uses: ./src/electron/.github/actions/ssh-debug
|
||||
with:
|
||||
tunnel: "true"
|
||||
env:
|
||||
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
|
||||
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
|
||||
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
|
||||
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
- name: Free up space (macOS)
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
uses: ./src/electron/.github/actions/free-space-macos
|
||||
- name: Check disk space after freeing up space
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: df -h
|
||||
- name: Setup Node.js/npm
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
cache: yarn
|
||||
cache-dependency-path: src/electron/yarn.lock
|
||||
- name: Install Dependencies
|
||||
uses: ./src/electron/.github/actions/install-dependencies
|
||||
- name: Install AZCopy
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: brew install azcopy
|
||||
- name: Set GN_EXTRA_ARGS for Linux
|
||||
if: ${{ inputs.target-platform == 'linux' }}
|
||||
run: >
|
||||
if [ "${{ inputs.target-arch }}" = "arm" ]; then
|
||||
if [ "${{ inputs.is-release }}" = true ]; then
|
||||
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
|
||||
else
|
||||
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
|
||||
fi
|
||||
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
|
||||
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
|
||||
elif [ "${{ inputs.is-asan }}" = true ]; then
|
||||
GN_EXTRA_ARGS='is_asan=true'
|
||||
fi
|
||||
|
||||
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
|
||||
- name: Set Chromium Git Cookie
|
||||
uses: ./src/electron/.github/actions/set-chromium-cookie
|
||||
- name: Install Build Tools
|
||||
uses: ./src/electron/.github/actions/install-build-tools
|
||||
- name: Generate DEPS Hash
|
||||
run: |
|
||||
node src/electron/script/generate-deps-hash.js
|
||||
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
|
||||
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
|
||||
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
|
||||
- name: Restore src cache via AZCopy
|
||||
if: ${{ inputs.target-platform != 'linux' }}
|
||||
uses: ./src/electron/.github/actions/restore-cache-azcopy
|
||||
with:
|
||||
target-platform: ${{ inputs.target-platform }}
|
||||
- name: Restore src cache via AKS
|
||||
if: ${{ inputs.target-platform == 'linux' }}
|
||||
uses: ./src/electron/.github/actions/restore-cache-aks
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
ref: ${{ github.event.pull_request.head.sha }}
|
||||
- name: Fix Sync
|
||||
if: ${{ inputs.target-platform != 'linux' }}
|
||||
uses: ./src/electron/.github/actions/fix-sync
|
||||
with:
|
||||
target-platform: ${{ inputs.target-platform }}
|
||||
env:
|
||||
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
|
||||
- name: Init Build Tools
|
||||
run: >
|
||||
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
|
||||
--import ${{ inputs.gn-build-type }} --target-cpu ${{
|
||||
inputs.target-arch }} --remote-build siso
|
||||
- name: Run Electron Only Hooks
|
||||
run: |
|
||||
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
|
||||
- name: Regenerate DEPS Hash
|
||||
run: >
|
||||
(cd src/electron && git checkout .) && node
|
||||
src/electron/script/generate-deps-hash.js
|
||||
|
||||
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
|
||||
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
|
||||
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
|
||||
- name: Free up space (macOS)
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
uses: ./src/electron/.github/actions/free-space-macos
|
||||
- name: Build Electron
|
||||
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
|
||||
inputs.target-variant == 'darwin') }}
|
||||
uses: ./src/electron/.github/actions/build-electron
|
||||
with:
|
||||
target-arch: ${{ inputs.target-arch }}
|
||||
target-platform: ${{ inputs.target-platform }}
|
||||
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
|
||||
inputs.target-platform }}
|
||||
is-release: ${{ inputs.is-release }}
|
||||
generate-symbols: ${{ inputs.generate-symbols }}
|
||||
upload-to-storage: ${{ inputs.upload-to-storage }}
|
||||
is-asan: ${{ inputs.is-asan }}
|
||||
- name: Set GN_EXTRA_ARGS for MAS Build
|
||||
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
|
||||
inputs.target-variant == 'mas') }}
|
||||
run: |
|
||||
echo "MAS_BUILD=true" >> $GITHUB_ENV
|
||||
GN_EXTRA_ARGS='is_mas_build=true'
|
||||
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
|
||||
- name: Build Electron (MAS)
|
||||
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
|
||||
inputs.target-variant == 'mas') }}
|
||||
uses: ./src/electron/.github/actions/build-electron
|
||||
with:
|
||||
target-arch: ${{ inputs.target-arch }}
|
||||
target-platform: ${{ inputs.target-platform }}
|
||||
artifact-platform: mas
|
||||
is-release: ${{ inputs.is-release }}
|
||||
generate-symbols: ${{ inputs.generate-symbols }}
|
||||
upload-to-storage: ${{ inputs.upload-to-storage }}
|
||||
step-suffix: (mas)
|
||||
@@ -35,10 +35,7 @@ concurrency:
|
||||
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
|
||||
permissions:
|
||||
contents: read
|
||||
issues: read
|
||||
pull-requests: read
|
||||
permissions: {}
|
||||
|
||||
env:
|
||||
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
|
||||
@@ -53,6 +50,10 @@ jobs:
|
||||
run:
|
||||
shell: bash
|
||||
runs-on: ${{ inputs.test-runs-on }}
|
||||
permissions:
|
||||
contents: read
|
||||
issues: read
|
||||
pull-requests: read
|
||||
container: ${{ fromJSON(inputs.test-container) }}
|
||||
strategy:
|
||||
fail-fast: false
|
||||
@@ -68,16 +69,14 @@ jobs:
|
||||
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
|
||||
run: |
|
||||
cp $(which node) /mnt/runner-externals/node20/bin/
|
||||
cp $(which node) /mnt/runner-externals/node24/bin/
|
||||
- name: Setup Node.js/npm
|
||||
if: ${{ inputs.target-platform == 'win' }}
|
||||
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
|
||||
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
|
||||
with:
|
||||
node-version: 20.19.x
|
||||
- name: Add TCC permissions on macOS
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: |
|
||||
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
|
||||
configure_user_tccdb () {
|
||||
local values=$1
|
||||
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
|
||||
@@ -96,14 +95,11 @@ jobs:
|
||||
"'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
|
||||
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
|
||||
)
|
||||
for values in "${userValuesArray[@]}"; do
|
||||
# Sonoma and higher have a few extra values
|
||||
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
|
||||
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
|
||||
if [ "$OSTYPE" = "darwin23" ]; then
|
||||
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
|
||||
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
|
||||
else
|
||||
@@ -114,21 +110,12 @@ jobs:
|
||||
- name: Turn off the unexpectedly quit dialog on macOS
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: defaults write com.apple.CrashReporter DialogType server
|
||||
- name: Set xcode to 16.4
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
ref: ${{ github.event.pull_request.head.sha }}
|
||||
- name: Turn off screenshot nag on macOS
|
||||
if: ${{ inputs.target-platform == 'macos' }}
|
||||
run: |
|
||||
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
|
||||
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
|
||||
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
|
||||
- name: Setup SSH Debugging
|
||||
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
|
||||
uses: ./src/electron/.github/actions/ssh-debug
|
||||
@@ -167,12 +154,12 @@ jobs:
|
||||
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
|
||||
echo "IS_ASAN=true" >> $GITHUB_ENV
|
||||
- name: Download Generated Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
|
||||
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
|
||||
- name: Download Src Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: src_artifacts_${{ env.ARTIFACT_KEY }}
|
||||
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
|
||||
@@ -190,16 +177,12 @@ jobs:
|
||||
run: |
|
||||
cd src/out/Default
|
||||
unzip -:o dist.zip
|
||||
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
|
||||
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
|
||||
# run: |
|
||||
# sudo security authorizationdb write com.apple.trust-settings.admin allow
|
||||
# cd src/electron
|
||||
# ./script/codesign/generate-identity.sh
|
||||
- name: Install Datadog CLI
|
||||
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
|
||||
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
|
||||
run: |
|
||||
sudo security authorizationdb write com.apple.trust-settings.admin allow
|
||||
cd src/electron
|
||||
node script/yarn global add @datadog/datadog-ci
|
||||
./script/codesign/generate-identity.sh
|
||||
- name: Run Electron Tests
|
||||
shell: bash
|
||||
env:
|
||||
@@ -225,7 +208,7 @@ jobs:
|
||||
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
|
||||
fi
|
||||
fi
|
||||
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
|
||||
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
|
||||
else
|
||||
chown :builduser .. && chmod g+w ..
|
||||
chown -R :builduser . && chmod -R g+w .
|
||||
@@ -242,9 +225,14 @@ jobs:
|
||||
export MOCHA_TIMEOUT=180000
|
||||
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
|
||||
cd electron
|
||||
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
|
||||
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
|
||||
else
|
||||
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
|
||||
if [ "${{ inputs.target-arch }}" = "arm" ]; then
|
||||
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
|
||||
else
|
||||
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
|
||||
fi
|
||||
|
||||
fi
|
||||
fi
|
||||
- name: Upload Test results to Datadog
|
||||
@@ -256,13 +244,14 @@ jobs:
|
||||
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
|
||||
run: |
|
||||
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
|
||||
export DATADOG_PATH=`node src/electron/script/yarn global bin`
|
||||
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
|
||||
fi
|
||||
cd src/electron
|
||||
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
|
||||
$DATADOG_PATH junit upload junit/test-results-main.xml
|
||||
fi
|
||||
if: always() && !cancelled()
|
||||
- name: Upload Test Artifacts
|
||||
if: always() && !cancelled()
|
||||
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
|
||||
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
|
||||
with:
|
||||
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
|
||||
path: src/electron/spec/artifacts
|
||||
|
||||
@@ -26,6 +26,8 @@ on:
|
||||
type: string
|
||||
default: testing
|
||||
|
||||
permissions: {}
|
||||
|
||||
concurrency:
|
||||
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
|
||||
cancel-in-progress: ${{ github.ref_protected != true }}
|
||||
@@ -39,6 +41,8 @@ jobs:
|
||||
node-tests:
|
||||
name: Run Node.js Tests
|
||||
runs-on: electron-arc-centralus-linux-amd64-8core
|
||||
permissions:
|
||||
contents: read
|
||||
timeout-minutes: 30
|
||||
env:
|
||||
TARGET_ARCH: ${{ inputs.target-arch }}
|
||||
@@ -46,7 +50,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.test-container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -61,12 +65,12 @@ jobs:
|
||||
- name: Install Dependencies
|
||||
uses: ./src/electron/.github/actions/install-dependencies
|
||||
- name: Download Generated Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
- name: Download Src Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
@@ -93,6 +97,8 @@ jobs:
|
||||
nan-tests:
|
||||
name: Run Nan Tests
|
||||
runs-on: electron-arc-centralus-linux-amd64-4core
|
||||
permissions:
|
||||
contents: read
|
||||
timeout-minutes: 30
|
||||
env:
|
||||
TARGET_ARCH: ${{ inputs.target-arch }}
|
||||
@@ -100,7 +106,7 @@ jobs:
|
||||
container: ${{ fromJSON(inputs.test-container) }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -115,12 +121,12 @@ jobs:
|
||||
- name: Install Dependencies
|
||||
uses: ./src/electron/.github/actions/install-dependencies
|
||||
- name: Download Generated Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
|
||||
- name: Download Src Artifacts
|
||||
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
|
||||
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
|
||||
with:
|
||||
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
|
||||
@@ -132,10 +138,16 @@ jobs:
|
||||
unzip -:o dist.zip
|
||||
- name: Setup Linux for Headless Testing
|
||||
run: sh -e /etc/init.d/xvfb start
|
||||
- name: Add Clang problem matcher
|
||||
shell: bash
|
||||
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
|
||||
- name: Run Nan Tests
|
||||
run: |
|
||||
cd src
|
||||
node electron/script/nan-spec-runner.js
|
||||
- name: Remove Clang problem matcher
|
||||
shell: bash
|
||||
run: echo "::remove-matcher owner=clang::"
|
||||
- name: Wait for active SSH sessions
|
||||
shell: bash
|
||||
if: always() && !cancelled()
|
||||
|
||||
4
.github/workflows/pull-request-labeled.yml
vendored
4
.github/workflows/pull-request-labeled.yml
vendored
@@ -11,9 +11,10 @@ jobs:
|
||||
name: backport/requested label added
|
||||
if: github.event.label.name == 'backport/requested 🗳'
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
steps:
|
||||
- name: Trigger Slack workflow
|
||||
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
|
||||
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
|
||||
with:
|
||||
webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
|
||||
webhook-type: webhook-trigger
|
||||
@@ -28,6 +29,7 @@ jobs:
|
||||
name: deprecation-review/complete label added
|
||||
if: github.event.label.name == 'deprecation-review/complete ✅'
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
|
||||
8
.github/workflows/scorecards.yml
vendored
8
.github/workflows/scorecards.yml
vendored
@@ -22,13 +22,13 @@ jobs:
|
||||
|
||||
steps:
|
||||
- name: "Checkout code"
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
|
||||
with:
|
||||
persist-credentials: false
|
||||
|
||||
# This is a pre-submit / pre-release.
|
||||
- name: "Run analysis"
|
||||
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
|
||||
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
|
||||
with:
|
||||
results_file: results.sarif
|
||||
results_format: sarif
|
||||
@@ -42,7 +42,7 @@ jobs:
|
||||
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
|
||||
# format to the repository Actions tab.
|
||||
- name: "Upload artifact"
|
||||
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
|
||||
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
|
||||
with:
|
||||
name: SARIF file
|
||||
path: results.sarif
|
||||
@@ -50,6 +50,6 @@ jobs:
|
||||
|
||||
# Upload the results to GitHub's code scanning dashboard.
|
||||
- name: "Upload to code-scanning"
|
||||
uses: github/codeql-action/upload-sarif@0499de31b99561a6d14a36a5f662c2a54f91beee # v3.29.5
|
||||
uses: github/codeql-action/upload-sarif@ce28f5bb42b7a9f2c824e633a3f6ee835bab6858 # v3.29.0
|
||||
with:
|
||||
sarif_file: results.sarif
|
||||
|
||||
5
.github/workflows/semantic.yml
vendored
5
.github/workflows/semantic.yml
vendored
@@ -7,8 +7,7 @@ on:
|
||||
- edited
|
||||
- synchronize
|
||||
|
||||
permissions:
|
||||
contents: read
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
main:
|
||||
@@ -19,7 +18,7 @@ jobs:
|
||||
runs-on: ubuntu-latest
|
||||
steps:
|
||||
- name: semantic-pull-request
|
||||
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
|
||||
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
|
||||
env:
|
||||
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
|
||||
with:
|
||||
|
||||
1
.github/workflows/stable-prep-items.yml
vendored
1
.github/workflows/stable-prep-items.yml
vendored
@@ -11,6 +11,7 @@ jobs:
|
||||
check-stable-prep-items:
|
||||
name: Check Stable Prep Items
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
|
||||
8
.github/workflows/stale.yml
vendored
8
.github/workflows/stale.yml
vendored
@@ -10,13 +10,14 @@ permissions: {}
|
||||
jobs:
|
||||
stale:
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
steps:
|
||||
- name: Generate GitHub App token
|
||||
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
|
||||
id: generate-token
|
||||
with:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
|
||||
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
|
||||
with:
|
||||
repo-token: ${{ steps.generate-token.outputs.token }}
|
||||
days-before-stale: 90
|
||||
@@ -27,10 +28,11 @@ jobs:
|
||||
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
|
||||
close-issue-message: >
|
||||
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
|
||||
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
|
||||
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
|
||||
only-pr-labels: not-a-real-label
|
||||
pending-repro:
|
||||
runs-on: ubuntu-latest
|
||||
permissions: {}
|
||||
if: ${{ always() }}
|
||||
needs: stale
|
||||
steps:
|
||||
@@ -39,7 +41,7 @@ jobs:
|
||||
id: generate-token
|
||||
with:
|
||||
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
|
||||
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
|
||||
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
|
||||
with:
|
||||
repo-token: ${{ steps.generate-token.outputs.token }}
|
||||
days-before-stale: -1
|
||||
|
||||
29
.github/workflows/windows-publish.yml
vendored
29
.github/workflows/windows-publish.yml
vendored
@@ -6,7 +6,7 @@ on:
|
||||
build-image-sha:
|
||||
type: string
|
||||
description: 'SHA for electron/build image'
|
||||
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
|
||||
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
|
||||
required: true
|
||||
upload-to-storage:
|
||||
description: 'Uploads to Azure storage'
|
||||
@@ -18,9 +18,13 @@ on:
|
||||
type: boolean
|
||||
default: false
|
||||
|
||||
permissions: {}
|
||||
|
||||
jobs:
|
||||
checkout-windows:
|
||||
runs-on: electron-arc-centralus-linux-amd64-32core
|
||||
permissions:
|
||||
contents: read
|
||||
container:
|
||||
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
|
||||
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
|
||||
@@ -36,7 +40,7 @@ jobs:
|
||||
build-image-sha: ${{ inputs.build-image-sha }}
|
||||
steps:
|
||||
- name: Checkout Electron
|
||||
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
|
||||
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
|
||||
with:
|
||||
path: src/electron
|
||||
fetch-depth: 0
|
||||
@@ -47,7 +51,12 @@ jobs:
|
||||
target-platform: win
|
||||
|
||||
publish-x64-win:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-windows
|
||||
with:
|
||||
environment: production-release
|
||||
@@ -61,7 +70,12 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-arm64-win:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-windows
|
||||
with:
|
||||
environment: production-release
|
||||
@@ -75,7 +89,12 @@ jobs:
|
||||
secrets: inherit
|
||||
|
||||
publish-x86-win:
|
||||
uses: ./.github/workflows/pipeline-segment-electron-build.yml
|
||||
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
|
||||
permissions:
|
||||
artifact-metadata: write
|
||||
attestations: write
|
||||
contents: read
|
||||
id-token: write
|
||||
needs: checkout-windows
|
||||
with:
|
||||
environment: production-release
|
||||
|
||||
2
.gitignore
vendored
2
.gitignore
vendored
@@ -53,3 +53,5 @@ ts-gen
|
||||
patches/mtime-cache.json
|
||||
|
||||
spec/fixtures/logo.png
|
||||
|
||||
.yarn/install-state.gz
|
||||
942
.yarn/releases/yarn-4.12.0.cjs
vendored
Executable file
942
.yarn/releases/yarn-4.12.0.cjs
vendored
Executable file
File diff suppressed because one or more lines are too long
12
.yarnrc.yml
Normal file
12
.yarnrc.yml
Normal file
@@ -0,0 +1,12 @@
|
||||
enableScripts: false
|
||||
|
||||
nmHoistingLimits: workspaces
|
||||
|
||||
nodeLinker: node-modules
|
||||
|
||||
npmMinimalAgeGate: 10080
|
||||
|
||||
npmPreapprovedPackages:
|
||||
- "@electron/*"
|
||||
|
||||
yarnPath: .yarn/releases/yarn-4.12.0.cjs
|
||||
13
BUILD.gn
13
BUILD.gn
@@ -586,13 +586,7 @@ source_set("electron_lib") {
|
||||
}
|
||||
|
||||
if (is_mac) {
|
||||
# Disable C++ modules to resolve linking error when including MacOS SDK
|
||||
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
|
||||
# TODO(samuelmaddock): consider revisiting this in the future
|
||||
use_libcxx_modules = false
|
||||
|
||||
deps += [
|
||||
"//components/os_crypt/common:keychain_password_mac",
|
||||
"//components/remote_cocoa/app_shim",
|
||||
"//components/remote_cocoa/browser",
|
||||
"//content/browser:mac_helpers",
|
||||
@@ -695,6 +689,7 @@ source_set("electron_lib") {
|
||||
"//components/app_launch_prefetch",
|
||||
"//components/crash/core/app:crash_export_thunks",
|
||||
"//third_party/libxml:xml_writer",
|
||||
"//ui/native_theme:native_theme_browser",
|
||||
"//ui/wm",
|
||||
"//ui/wm/public",
|
||||
]
|
||||
@@ -786,13 +781,9 @@ source_set("electron_lib") {
|
||||
|
||||
action("mksnapshot_checksum_gen") {
|
||||
script = "build/checksum_header.py"
|
||||
|
||||
outputs = [ "$target_gen_dir/snapshot_checksum.h" ]
|
||||
inputs = [ "$root_out_dir/$v8_context_snapshot_filename" ]
|
||||
args = rebase_path(inputs)
|
||||
|
||||
args += rebase_path(outputs)
|
||||
|
||||
args = rebase_path(inputs) + rebase_path(outputs)
|
||||
deps = [ "//tools/v8_context_snapshot" ]
|
||||
}
|
||||
|
||||
|
||||
11
DEPS
11
DEPS
@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
|
||||
|
||||
vars = {
|
||||
'chromium_version':
|
||||
'144.0.7506.0',
|
||||
'140.0.7339.249',
|
||||
'node_version':
|
||||
'v24.11.0',
|
||||
'v22.22.0',
|
||||
'nan_version':
|
||||
'675cefebca42410733da8a454c8d9391fcebfbc2',
|
||||
'e14bdcd1f72d62bca1d541b66da43130384ec213',
|
||||
'squirrel.mac_version':
|
||||
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
|
||||
'reactiveobjc_version':
|
||||
@@ -30,9 +30,6 @@ vars = {
|
||||
# The path of the sysroots.json file.
|
||||
'sysroots_json_path': 'electron/script/sysroots.json',
|
||||
|
||||
# KEEP IN SYNC WITH utils.js FILE
|
||||
'yarn_version': '1.22.22',
|
||||
|
||||
# To be able to build clean Chromium from sources.
|
||||
'apply_patches': True,
|
||||
|
||||
@@ -155,7 +152,7 @@ hooks = [
|
||||
'action': [
|
||||
'python3',
|
||||
'-c',
|
||||
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
|
||||
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
|
||||
],
|
||||
},
|
||||
{
|
||||
|
||||
@@ -8,12 +8,6 @@ The Electron team will send a response indicating the next steps in handling you
|
||||
|
||||
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
|
||||
|
||||
## Escalation
|
||||
|
||||
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
|
||||
|
||||
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
|
||||
|
||||
## The Electron Security Notification Process
|
||||
|
||||
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.
|
||||
|
||||
@@ -2,7 +2,7 @@ is_electron_build = true
|
||||
root_extra_deps = [ "//electron" ]
|
||||
|
||||
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
|
||||
node_module_version = 143
|
||||
node_module_version = 139
|
||||
|
||||
v8_promise_internal_field_count = 1
|
||||
v8_embedder_string = "-electron.0"
|
||||
@@ -19,10 +19,6 @@ proprietary_codecs = true
|
||||
|
||||
enable_printing = true
|
||||
|
||||
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
|
||||
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
|
||||
use_clang_modules = false
|
||||
|
||||
# Removes DLLs from the build, which are only meant to be used for Chromium development.
|
||||
# See https://github.com/electron/electron/pull/17985
|
||||
angle_enable_vulkan_validation_layers = false
|
||||
|
||||
@@ -12,7 +12,7 @@ TEMPLATE_H = """
|
||||
|
||||
namespace electron::snapshot_checksum {
|
||||
|
||||
inline constexpr std::string_view kChecksum = "{checksum}";
|
||||
const std::string kChecksum = "{checksum}";
|
||||
|
||||
} // namespace electron::snapshot_checksum
|
||||
|
||||
|
||||
@@ -67,6 +67,10 @@ template("mac_xib_bundle_data") {
|
||||
ibtool_flags = [
|
||||
"--minimum-deployment-target",
|
||||
mac_deployment_target,
|
||||
|
||||
# TODO(rsesek): Enable this once all the bots are on Xcode 7+.
|
||||
# "--target-device",
|
||||
# "mac",
|
||||
]
|
||||
}
|
||||
|
||||
|
||||
@@ -23,8 +23,6 @@ static_library("chrome") {
|
||||
"//chrome/browser/browser_process.h",
|
||||
"//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
|
||||
"//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
|
||||
"//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
|
||||
"//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
|
||||
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
|
||||
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
|
||||
"//chrome/browser/devtools/devtools_eye_dropper.cc",
|
||||
@@ -144,6 +142,8 @@ static_library("chrome") {
|
||||
"//chrome/browser/ui/views/overlay/toggle_camera_button.h",
|
||||
"//chrome/browser/ui/views/overlay/toggle_microphone_button.cc",
|
||||
"//chrome/browser/ui/views/overlay/toggle_microphone_button.h",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_views.cc",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_views.h",
|
||||
"//chrome/browser/ui/views/picture_in_picture/picture_in_picture_bounds_change_animation.cc",
|
||||
@@ -280,8 +280,6 @@ static_library("chrome") {
|
||||
"//chrome/browser/process_singleton_mac.mm",
|
||||
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.h",
|
||||
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.mm",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
|
||||
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
|
||||
]
|
||||
deps += [ ":system_media_capture_permissions_mac_conflict" ]
|
||||
}
|
||||
@@ -504,17 +502,15 @@ source_set("chrome_spellchecker") {
|
||||
]
|
||||
}
|
||||
|
||||
if (is_mac) {
|
||||
# These sources create an object file conflict with one in |:chrome|, so they
|
||||
# must live in a separate target.
|
||||
# Conflicting sources:
|
||||
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
|
||||
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
|
||||
source_set("system_media_capture_permissions_mac_conflict") {
|
||||
sources = [
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
|
||||
]
|
||||
deps = [ "//chrome/common" ]
|
||||
}
|
||||
# These sources create an object file conflict with one in |:chrome|, so they
|
||||
# must live in a separate target.
|
||||
# Conflicting sources:
|
||||
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
|
||||
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
|
||||
source_set("system_media_capture_permissions_mac_conflict") {
|
||||
sources = [
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
|
||||
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
|
||||
]
|
||||
deps = [ "//chrome/common" ]
|
||||
}
|
||||
|
||||
@@ -421,7 +421,6 @@ Returns:
|
||||
* `oom` - Process ran out of memory
|
||||
* `launch-failed` - Process never successfully launched
|
||||
* `integrity-failure` - Windows code integrity checks failed
|
||||
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
|
||||
* `exitCode` number - The exit code for the process
|
||||
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
|
||||
* `serviceName` string (optional) - The non-localized name of the process.
|
||||
@@ -565,9 +564,8 @@ and subscribing to the `ready` event if the app is not ready yet.
|
||||
* `steal` boolean _macOS_ - Make the receiver the active app even if another app is
|
||||
currently active.
|
||||
|
||||
On macOS, makes the application the active app. On Windows, focuses on the application's
|
||||
first window. On Linux, either focuses on the first visible window (X11) or requests
|
||||
focus but may instead show a notification or flash the app icon (Wayland).
|
||||
On Linux, focuses on the first visible window. On macOS, makes the application
|
||||
the active app. On Windows, focuses on the application's first window.
|
||||
|
||||
You should seek to use the `steal` option as sparingly as possible.
|
||||
|
||||
|
||||
@@ -140,10 +140,6 @@ state is `hidden` in order to minimize power consumption.
|
||||
move.
|
||||
* On Linux the type of modal windows will be changed to `dialog`.
|
||||
* On Linux many desktop environments do not support hiding a modal window.
|
||||
* On Wayland (Linux) it is generally not possible to programmatically resize windows
|
||||
after creation, or to position, move, focus, or blur windows without user input.
|
||||
If your app needs these capabilities, run it in Xwayland by appending the flag
|
||||
`--ozone-platform=x11`.
|
||||
|
||||
## Class: BrowserWindow extends `BaseWindow`
|
||||
|
||||
@@ -660,15 +656,10 @@ the [close event](#event-close).
|
||||
|
||||
Focuses on the window.
|
||||
|
||||
On Wayland (Linux), the desktop environment may show a notification or flash
|
||||
the app icon if the window or app is not already focused.
|
||||
|
||||
#### `win.blur()`
|
||||
|
||||
Removes focus from the window.
|
||||
|
||||
Not supported on Wayland (Linux).
|
||||
|
||||
#### `win.isFocused()`
|
||||
|
||||
Returns `boolean` - Whether the window is focused.
|
||||
@@ -685,8 +676,6 @@ Shows and gives focus to the window.
|
||||
|
||||
Shows the window but doesn't focus on it.
|
||||
|
||||
Not supported on Wayland (Linux).
|
||||
|
||||
#### `win.hide()`
|
||||
|
||||
Hides the window.
|
||||
@@ -835,8 +824,6 @@ Closes the currently open [Quick Look][quick-look] panel.
|
||||
|
||||
Resizes and moves the window to the supplied bounds. Any properties that are not supplied will default to their current values.
|
||||
|
||||
On Wayland (Linux), has the same limitations as `setSize` and `setPosition`.
|
||||
|
||||
```js
|
||||
const { BrowserWindow } = require('electron')
|
||||
|
||||
@@ -879,8 +866,6 @@ See [Setting `backgroundColor`](#setting-the-backgroundcolor-property).
|
||||
Resizes and moves the window's client area (e.g. the web page) to
|
||||
the supplied bounds.
|
||||
|
||||
On Wayland (Linux), has the same limitations as `setContentSize` and `setPosition`.
|
||||
|
||||
#### `win.getContentBounds()`
|
||||
|
||||
Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window's client area as `Object`.
|
||||
@@ -910,8 +895,6 @@ Returns `boolean` - whether the window is enabled.
|
||||
|
||||
Resizes the window to `width` and `height`. If `width` or `height` are below any set minimum size constraints the window will snap to its minimum size.
|
||||
|
||||
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
|
||||
|
||||
#### `win.getSize()`
|
||||
|
||||
Returns `Integer[]` - Contains the window's width and height.
|
||||
@@ -924,8 +907,6 @@ Returns `Integer[]` - Contains the window's width and height.
|
||||
|
||||
Resizes the window's client area (e.g. the web page) to `width` and `height`.
|
||||
|
||||
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
|
||||
|
||||
#### `win.getContentSize()`
|
||||
|
||||
Returns `Integer[]` - Contains the window's client area's width and height.
|
||||
@@ -1063,16 +1044,12 @@ this method throws an error.
|
||||
|
||||
#### `win.moveTop()`
|
||||
|
||||
Moves window to top(z-order) regardless of focus.
|
||||
|
||||
Not supported on Wayland (Linux).
|
||||
Moves window to top(z-order) regardless of focus
|
||||
|
||||
#### `win.center()`
|
||||
|
||||
Moves window to the center of the screen.
|
||||
|
||||
Not supported on Wayland (Linux).
|
||||
|
||||
#### `win.setPosition(x, y[, animate])`
|
||||
|
||||
* `x` Integer
|
||||
@@ -1081,8 +1058,6 @@ Not supported on Wayland (Linux).
|
||||
|
||||
Moves window to `x` and `y`.
|
||||
|
||||
Not supported on Wayland (Linux).
|
||||
|
||||
#### `win.getPosition()`
|
||||
|
||||
Returns `Integer[]` - Contains the window's current position.
|
||||
|
||||
@@ -25,6 +25,11 @@ following properties:
|
||||
with which the request is associated. Defaults to the empty string. The
|
||||
`session` option supersedes `partition`. Thus if a `session` is explicitly
|
||||
specified, `partition` is ignored.
|
||||
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
|
||||
custom protocol handlers registered for the request's URL scheme will not be
|
||||
called. This allows forwarding an intercepted request to the built-in
|
||||
handler. [webRequest](web-request.md) handlers will still be triggered
|
||||
when bypassing custom protocols. Defaults to `false`.
|
||||
* `credentials` string (optional) - Can be `include`, `omit` or
|
||||
`same-origin`. Whether to send
|
||||
[credentials](https://fetch.spec.whatwg.org/#credentials) with this
|
||||
|
||||
@@ -86,7 +86,7 @@ Field trials to be forcefully enabled or disabled.
|
||||
|
||||
For example: `WebRTC-Audio-Red-For-Opus/Enabled/`
|
||||
|
||||
### --host-rules=`rules` _Deprecated_
|
||||
### --host-rules=`rules`
|
||||
|
||||
A comma-separated list of `rules` that control how hostnames are mapped.
|
||||
|
||||
@@ -104,23 +104,9 @@ These mappings apply to the endpoint host in a net request (the TCP connect
|
||||
and host resolver in a direct connection, and the `CONNECT` in an HTTP proxy
|
||||
connection, and the endpoint host in a `SOCKS` proxy connection).
|
||||
|
||||
**Deprecated:** Use the `--host-resolver-rules` switch instead.
|
||||
|
||||
### --host-resolver-rules=`rules`
|
||||
|
||||
A comma-separated list of `rules` that control how hostnames are mapped.
|
||||
|
||||
For example:
|
||||
|
||||
* `MAP * 127.0.0.1` Forces all hostnames to be mapped to 127.0.0.1
|
||||
* `MAP *.google.com proxy` Forces all google.com subdomains to be resolved to
|
||||
"proxy".
|
||||
* `MAP test.com [::1]:77` Forces "test.com" to resolve to IPv6 loopback. Will
|
||||
also force the port of the resulting socket address to be 77.
|
||||
* `MAP * baz, EXCLUDE www.google.com` Remaps everything to "baz", except for
|
||||
"www.google.com".
|
||||
|
||||
These `rules` only apply to the host resolver.
|
||||
Like `--host-rules` but these `rules` only apply to the host resolver.
|
||||
|
||||
### --ignore-certificate-errors
|
||||
|
||||
@@ -193,11 +179,6 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
|
||||
Forces renderer process and Chromium helper processes to run un-sandboxed.
|
||||
Should only be used for testing.
|
||||
|
||||
### --no-stdio-init
|
||||
|
||||
Disable stdio initialization during node initialization.
|
||||
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
|
||||
|
||||
### --proxy-bypass-list=`hosts`
|
||||
|
||||
Instructs Electron to bypass the proxy server for the given semi-colon-separated
|
||||
@@ -350,22 +331,6 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
|
||||
|
||||
Disable exposition of [Navigator API][] on the global scope from Node.js.
|
||||
|
||||
## Chromium Flags
|
||||
|
||||
There isn't a documented list of all Chromium switches, but there are a few ways to find them.
|
||||
|
||||
The easiest way is through Chromium's flags page, which you can access at `about://flags`. These flags don't directly match switch names, but they show up in the process's command-line arguments.
|
||||
|
||||
To see these arguments, enable a flag in `about://flags`, then go to `about://version` in Chromium. You'll find a list of command-line arguments, including `--flag-switches-begin --your --list --flag-switches-end`, which contains the list of your flag enabled switches.
|
||||
|
||||
Most flags are included as part of `--enable-features=`, but some are standalone switches, like `--enable-experimental-web-platform-features`.
|
||||
|
||||
A complete list of flags exists in [Chromium's flag metadata page](https://source.chromium.org/chromium/chromium/src/+/main:chrome/browser/flag-metadata.json), but this list includes platform, environment and GPU specific, expired and potentially non-functional flags, so many of them might not always work in every situation.
|
||||
|
||||
Keep in mind that standalone switches can sometimes be split into individual features, so there's no fully complete list of switches.
|
||||
|
||||
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
|
||||
|
||||
[app]: app.md
|
||||
[append-switch]: command-line.md#commandlineappendswitchswitch-value
|
||||
[debugging-main-process]: ../tutorial/debugging-main-process.md
|
||||
|
||||
@@ -157,7 +157,6 @@ has been included below for completeness:
|
||||
| [Cloneable Types](https://developer.mozilla.org/en-US/docs/Web/API/Web_Workers_API/Structured_clone_algorithm) | Simple | ✅ | ✅ | See the linked document on cloneable types |
|
||||
| `Element` | Complex | ✅ | ✅ | Prototype modifications are dropped. Sending custom elements will not work. |
|
||||
| `Blob` | Complex | ✅ | ✅ | N/A |
|
||||
| `VideoFrame` | Complex | ✅ | ✅ | N/A |
|
||||
| `Symbol` | N/A | ❌ | ❌ | Symbols cannot be copied across contexts so they are dropped |
|
||||
|
||||
If the type you care about is not in the above table, it is probably not supported.
|
||||
|
||||
@@ -102,10 +102,6 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
|
||||
|
||||
## Caveats
|
||||
|
||||
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
|
||||
|
||||
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
|
||||
|
||||
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
|
||||
|
||||
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.
|
||||
|
||||
@@ -202,7 +202,8 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
|
||||
Returns `NativeImage`
|
||||
|
||||
Creates a new `NativeImage` instance from the `NSImage` that maps to the
|
||||
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
|
||||
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
|
||||
documentation for a list of possible values.
|
||||
|
||||
The `hslShift` is applied to the image with the following rules:
|
||||
|
||||
|
||||
@@ -66,7 +66,7 @@ The `session` module has the following properties:
|
||||
|
||||
### `session.defaultSession`
|
||||
|
||||
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
|
||||
A `Session` object, the default session object of the app.
|
||||
|
||||
## Class: Session
|
||||
|
||||
|
||||
@@ -1,195 +0,0 @@
|
||||
# ColorSpace Object
|
||||
|
||||
* `primaries` string - The color primaries of the color space. Can be one of the following values:
|
||||
* `bt709` - BT709 primaries (also used for sRGB)
|
||||
* `bt470m` - BT470M primaries
|
||||
* `bt470bg` - BT470BG primaries
|
||||
* `smpte170m` - SMPTE170M primaries
|
||||
* `smpte240m` - SMPTE240M primaries
|
||||
* `film` - Film primaries
|
||||
* `bt2020` - BT2020 primaries
|
||||
* `smptest428-1` - SMPTEST428-1 primaries
|
||||
* `smptest431-2` - SMPTEST431-2 primaries
|
||||
* `p3` - P3 primaries
|
||||
* `xyz-d50` - XYZ D50 primaries
|
||||
* `adobe-rgb` - Adobe RGB primaries
|
||||
* `apple-generic-rgb` - Apple Generic RGB primaries
|
||||
* `wide-gamut-color-spin` - Wide Gamut Color Spin primaries
|
||||
* `ebu-3213-e` - EBU 3213-E primaries
|
||||
* `custom` - Custom primaries
|
||||
* `invalid` - Invalid primaries
|
||||
|
||||
* `transfer` string - The transfer function of the color space. Can be one of the following values:
|
||||
* `bt709` - BT709 transfer function
|
||||
* `bt709-apple` - BT709 Apple transfer function
|
||||
* `gamma18` - Gamma 1.8 transfer function
|
||||
* `gamma22` - Gamma 2.2 transfer function
|
||||
* `gamma24` - Gamma 2.4 transfer function
|
||||
* `gamma28` - Gamma 2.8 transfer function
|
||||
* `smpte170m` - SMPTE170M transfer function
|
||||
* `smpte240m` - SMPTE240M transfer function
|
||||
* `linear` - Linear transfer function
|
||||
* `log` - Log transfer function
|
||||
* `log-sqrt` - Log Square Root transfer function
|
||||
* `iec61966-2-4` - IEC61966-2-4 transfer function
|
||||
* `bt1361-ecg` - BT1361 ECG transfer function
|
||||
* `srgb` - sRGB transfer function
|
||||
* `bt2020-10` - BT2020-10 transfer function
|
||||
* `bt2020-12` - BT2020-12 transfer function
|
||||
* `pq` - PQ (Perceptual Quantizer) transfer function
|
||||
* `smptest428-1` - SMPTEST428-1 transfer function
|
||||
* `hlg` - HLG (Hybrid Log-Gamma) transfer function
|
||||
* `srgb-hdr` - sRGB HDR transfer function
|
||||
* `linear-hdr` - Linear HDR transfer function
|
||||
* `custom` - Custom transfer function
|
||||
* `custom-hdr` - Custom HDR transfer function
|
||||
* `scrgb-linear-80-nits` - scRGB Linear 80 nits transfer function
|
||||
* `invalid` - Invalid transfer function
|
||||
|
||||
* `matrix` string - The color matrix of the color space. Can be one of the following values:
|
||||
* `rgb` - RGB matrix
|
||||
* `bt709` - BT709 matrix
|
||||
* `fcc` - FCC matrix
|
||||
* `bt470bg` - BT470BG matrix
|
||||
* `smpte170m` - SMPTE170M matrix
|
||||
* `smpte240m` - SMPTE240M matrix
|
||||
* `ycocg` - YCoCg matrix
|
||||
* `bt2020-ncl` - BT2020 NCL matrix
|
||||
* `ydzdx` - YDzDx matrix
|
||||
* `gbr` - GBR matrix
|
||||
* `invalid` - Invalid matrix
|
||||
|
||||
* `range` string - The color range of the color space. Can be one of the following values:
|
||||
* `limited` - Limited color range (RGB values ranging from 16 to 235)
|
||||
* `full` - Full color range (RGB values from 0 to 255)
|
||||
* `derived` - Range defined by the transfer function and matrix
|
||||
* `invalid` - Invalid range
|
||||
|
||||
## Common `ColorSpace` definitions
|
||||
|
||||
### Standard Color Spaces
|
||||
|
||||
**sRGB**:
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'srgb',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**Display P3**:
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'p3',
|
||||
transfer: 'srgb',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**XYZ D50**:
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'xyz-d50',
|
||||
transfer: 'linear',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
### HDR Color Spaces
|
||||
|
||||
**Extended sRGB** (extends sRGB to all real values):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'srgb-hdr',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**scRGB Linear** (linear transfer function for all real values):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'linear-hdr',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**scRGB Linear 80 Nits** (with an SDR white level of 80 nits):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'scrgb-linear-80-nits',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**HDR10** (BT.2020 primaries with PQ transfer function):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt2020',
|
||||
transfer: 'pq',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
**HLG** (BT.2020 primaries with HLG transfer function):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt2020',
|
||||
transfer: 'hlg',
|
||||
matrix: 'rgb',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
|
||||
### Video Color Spaces
|
||||
|
||||
**Rec. 601** (SDTV):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'smpte170m',
|
||||
transfer: 'smpte170m',
|
||||
matrix: 'smpte170m',
|
||||
range: 'limited'
|
||||
}
|
||||
```
|
||||
|
||||
**Rec. 709** (HDTV):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'bt709',
|
||||
matrix: 'bt709',
|
||||
range: 'limited'
|
||||
}
|
||||
```
|
||||
|
||||
**JPEG** (typical color space for JPEG images):
|
||||
|
||||
```js
|
||||
const cs = {
|
||||
primaries: 'bt709',
|
||||
transfer: 'srgb',
|
||||
matrix: 'smpte170m',
|
||||
range: 'full'
|
||||
}
|
||||
```
|
||||
@@ -2,13 +2,9 @@
|
||||
|
||||
* `textureInfo` Object - The shared texture info.
|
||||
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
|
||||
* `pixelFormat` string - The pixel format of the texture.
|
||||
* `rgba` - The texture format is 8-bit unorm RGBA.
|
||||
* `bgra` - The texture format is 8-bit unorm BGRA.
|
||||
* `rgbaf16` - The texture format is 16-bit float RGBA.
|
||||
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
|
||||
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
|
||||
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
|
||||
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.
|
||||
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In OSR case, it is expected to have the full section area.
|
||||
* `contentRect` [Rectangle](rectangle.md) - The region of the video frame that capturer would like to populate. In OSR case, it is the same with `dirtyRect` that needs to be painted.
|
||||
* `timestamp` number - The time in microseconds since the capture start.
|
||||
* `metadata` Object - Extra metadata. See comments in src\media\base\video_frame_metadata.h for accurate details.
|
||||
@@ -16,6 +12,13 @@
|
||||
* `regionCaptureRect` [Rectangle](rectangle.md) (optional) - May reflect the frame's contents origin if region capture is used internally.
|
||||
* `sourceSize` [Rectangle](rectangle.md) (optional) - Full size of the source frame.
|
||||
* `frameCount` number (optional) - The increasing count of captured frame. May contain gaps if frames are dropped between two consecutively received frames.
|
||||
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle data.
|
||||
* `sharedTextureHandle` Buffer _Windows_ _macOS_ - The handle to the shared texture.
|
||||
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
|
||||
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
|
||||
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
|
||||
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
|
||||
* `release` Function - Release the resources. The `texture` cannot be directly passed to another process, users need to maintain texture lifecycles in
|
||||
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important that you call `texture.release()` as soon as you're done with the texture.
|
||||
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important
|
||||
that you call `texture.release()` as soon as you're done with the texture.
|
||||
|
||||
@@ -8,7 +8,6 @@
|
||||
* `oom` - Process ran out of memory
|
||||
* `launch-failed` - Process never successfully launched
|
||||
* `integrity-failure` - Windows code integrity checks failed
|
||||
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
|
||||
* `exitCode` Integer - The exit code of the process, unless `reason` is
|
||||
`launch-failed`, in which case `exitCode` will be a platform-specific
|
||||
launch failure error code.
|
||||
|
||||
@@ -1,12 +0,0 @@
|
||||
# SharedTextureHandle Object
|
||||
|
||||
* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process.
|
||||
* `ioSurface` Buffer (optional) _macOS_ - IOSurfaceRef holds the shared texture. Note that this IOSurface is local to current process (not global).
|
||||
* `nativePixmap` Object (optional) _Linux_ - Structure contains planes of shared texture.
|
||||
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
|
||||
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
|
||||
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
|
||||
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
|
||||
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
|
||||
* `supportsZeroCopyWebGpuImport` boolean _Linux_ - Indicates whether supports zero copy import to WebGPU.
|
||||
@@ -1,35 +1,17 @@
|
||||
# USBDevice Object
|
||||
|
||||
* `configuration` Object (optional) - A [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) object containing information about the currently selected configuration of a USB device.
|
||||
* `configurationValue` Integer - the configuration value of this configuration.
|
||||
* `configurationName` string - the name provided by the device to describe this configuration.
|
||||
* `interfaces` Object[] - An array of [USBInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBInterface) objects containing information about an interface provided by the USB device.
|
||||
* `interfaceNumber` Integer - the interface number of this interface.
|
||||
* `alternate` Object - the currently selected alternative configuration of this interface.
|
||||
* `alternateSetting` Integer - the alternate setting number of this interface.
|
||||
* `interfaceClass` Integer - the class of this interface. See [USB.org](https://www.usb.org/defined-class-codes) for class code descriptions.
|
||||
* `interfaceSubclass` Integer - the subclass of this interface.
|
||||
* `interfaceProtocol` Integer - the protocol supported by this interface.
|
||||
* `interfaceName` string (optional) - the name of the interface, if one is provided by the device.
|
||||
* `endpoints` Object[] - an array containing instances of the [USBEndpoint interface](https://developer.mozilla.org/en-US/docs/Web/API/USBEndpoint) describing each of the endpoints that are part of this interface.
|
||||
* `endpointNumber` Integer - this endpoint's "endpoint number" which is a value from 1 to 15.
|
||||
* `direction` string - the direction in which this endpoint transfers data - can be either 'in' or 'out'.
|
||||
* `type` string - the type of this endpoint - can be either 'bulk', 'interrupt', or 'isochronous'.
|
||||
* `packetSize` Integer - the size of the packets that data sent through this endpoint will be divided into.
|
||||
* `alternates` Object[] - an array containing instances of the [USBAlternateInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBAlternateInterface) interface describing each of the alternative configurations possible for this interface.
|
||||
* `configurations` Object[] - An array of [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) interfaces for controlling a paired USB device.
|
||||
* `deviceClass` Integer - The device class for the communication interface supported by the device.
|
||||
* `deviceId` string - Unique identifier for the device.
|
||||
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device.
|
||||
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device.
|
||||
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
|
||||
* `manufacturerName` string (optional) - The manufacturer name of the device.
|
||||
* `vendorId` Integer - The USB vendor ID.
|
||||
* `productId` Integer - The USB product ID.
|
||||
* `productName` string (optional) - Name of the device.
|
||||
* `serialNumber` string (optional) - The USB device serial number.
|
||||
* `usbVersionMajor` Integer - The USB protocol major version supported by the device.
|
||||
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device.
|
||||
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device.
|
||||
* `vendorId` Integer - The USB vendor ID.
|
||||
* `manufacturerName` string (optional) - The manufacturer name of the device.
|
||||
* `usbVersionMajor` Integer - The USB protocol major version supported by the device
|
||||
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device
|
||||
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device
|
||||
* `deviceClass` Integer - The device class for the communication interface supported by the device
|
||||
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device
|
||||
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device
|
||||
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
|
||||
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
|
||||
|
||||
@@ -89,11 +89,6 @@
|
||||
paint event. Defaults to `false`. See the
|
||||
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
|
||||
more details.
|
||||
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
|
||||
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
|
||||
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
|
||||
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
|
||||
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
|
||||
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
|
||||
the specified `preload` script in a separate JavaScript context. Defaults
|
||||
to `true`. The context that the `preload` script runs in will only have
|
||||
|
||||
@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
|
||||
|
||||
The `systemPreferences` object emits the following events:
|
||||
|
||||
### Event: 'accent-color-changed' _Windows_ _Linux_
|
||||
### Event: 'accent-color-changed' _Windows_
|
||||
|
||||
Returns:
|
||||
|
||||
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
|
||||
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
|
||||
or global value of a `key` previously set with `setUserDefault`.
|
||||
|
||||
### `systemPreferences.getAccentColor()`
|
||||
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
|
||||
|
||||
Returns `string` - The users current system wide accent color preference in RGBA
|
||||
hexadecimal form.
|
||||
|
||||
@@ -12,37 +12,6 @@ This document uses the following convention to categorize breaking changes:
|
||||
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
|
||||
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
|
||||
|
||||
## Planned Breaking API Changes (39.0)
|
||||
|
||||
### Deprecated: `--host-rules` command line switch
|
||||
|
||||
Chromium is deprecating the `--host-rules` switch.
|
||||
|
||||
You should use `--host-resolver-rules` instead.
|
||||
|
||||
### Behavior Changed: window.open popups are always resizable
|
||||
|
||||
Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
|
||||
|
||||
To restore previous behavior:
|
||||
|
||||
```js
|
||||
webContents.setWindowOpenHandler((details) => {
|
||||
return {
|
||||
action: 'allow',
|
||||
overrideBrowserWindowOptions: {
|
||||
resizable: details.features.includes('resizable=yes')
|
||||
}
|
||||
}
|
||||
})
|
||||
```
|
||||
|
||||
### Behavior Changed: shared texture OSR `paint` event data structure
|
||||
|
||||
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
|
||||
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
|
||||
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
|
||||
|
||||
## Planned Breaking API Changes (38.0)
|
||||
|
||||
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
|
||||
|
||||
@@ -6,77 +6,17 @@ Follow the guidelines below for building **Electron itself** on Linux, for the p
|
||||
|
||||
## Prerequisites
|
||||
|
||||
* At least 25GB disk space and 8GB RAM.
|
||||
* Python >= 3.9.
|
||||
* [Node.js](https://nodejs.org/download/) >= 22.12.0
|
||||
* [clang](https://clang.llvm.org/get_started.html) 3.4 or later.
|
||||
* Development headers of GTK 3 and libnotify.
|
||||
Due to Electron's dependency on Chromium, prerequisites and dependencies for Electron change over time. [Chromium's documentation on building on Linux](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/linux/build_instructions.md) has up to date information for building Chromium on Linux. This documentation can generally
|
||||
be followed for building Electron on Linux as well.
|
||||
|
||||
On Ubuntu >= 20.04, install the following libraries:
|
||||
|
||||
```sh
|
||||
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
|
||||
libnotify-dev libasound2-dev libcap-dev \
|
||||
libcups2-dev libxtst-dev \
|
||||
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
|
||||
gperf bison python3-dbusmock openjdk-8-jre
|
||||
```
|
||||
|
||||
On Ubuntu < 20.04, install the following libraries:
|
||||
|
||||
```sh
|
||||
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
|
||||
libnotify-dev libgnome-keyring-dev \
|
||||
libasound2-dev libcap-dev libcups2-dev libxtst-dev \
|
||||
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
|
||||
gperf bison python-dbusmock openjdk-8-jre
|
||||
```
|
||||
|
||||
On RHEL / CentOS, install the following libraries:
|
||||
|
||||
```sh
|
||||
$ sudo yum install clang dbus-devel gtk3-devel libnotify-devel \
|
||||
libgnome-keyring-devel xorg-x11-server-utils libcap-devel \
|
||||
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
|
||||
nss-devel python-dbusmock openjdk-8-jre
|
||||
```
|
||||
|
||||
On Fedora, install the following libraries:
|
||||
|
||||
```sh
|
||||
$ sudo dnf install clang dbus-devel gperf gtk3-devel \
|
||||
libnotify-devel libgnome-keyring-devel libcap-devel \
|
||||
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
|
||||
nss-devel python-dbusmock
|
||||
```
|
||||
|
||||
On Arch Linux / Manjaro, install the following libraries:
|
||||
|
||||
```sh
|
||||
$ sudo pacman -Syu base-devel clang libdbus gtk2 libnotify \
|
||||
libgnome-keyring alsa-lib libcap libcups libxtst \
|
||||
libxss nss gcc-multilib curl gperf bison \
|
||||
python2 python-dbusmock jdk8-openjdk
|
||||
```
|
||||
|
||||
Other distributions may offer similar packages for installation via package
|
||||
managers such as pacman. Or one can compile from source code.
|
||||
Additionally, Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) can be referenced to get the current dependencies that Electron requires in addition to what Chromium installs via [build/install-deps.sh](https://chromium.googlesource.com/chromium/src/+/HEAD/build/install-build-deps.sh).
|
||||
|
||||
### Cross compilation
|
||||
|
||||
If you want to build for an `arm` target you should also install the following
|
||||
dependencies:
|
||||
If you want to build for an `arm` target, you can use Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) to install the additional dependencies by passing the `--arm argument`:
|
||||
|
||||
```sh
|
||||
$ sudo apt-get install libc6-dev-armhf-cross linux-libc-dev-armhf-cross \
|
||||
g++-arm-linux-gnueabihf
|
||||
```
|
||||
|
||||
Similarly for `arm64`, install the following:
|
||||
|
||||
```sh
|
||||
$ sudo apt-get install libc6-dev-arm64-cross linux-libc-dev-arm64-cross \
|
||||
g++-aarch64-linux-gnu
|
||||
$ sudo install-deps.sh --arm
|
||||
```
|
||||
|
||||
And to cross-compile for `arm` or targets, you should pass the
|
||||
|
||||
@@ -12,15 +12,6 @@ The ASAR format was created primarily to improve performance on Windows when
|
||||
reading large quantities of small files (e.g. when loading your app's JavaScript
|
||||
dependency tree from `node_modules`).
|
||||
|
||||
### ASAR integrity
|
||||
|
||||
ASAR integrity is an security feature that validates the contents of your app's
|
||||
ASAR archives at runtime. When enabled, your Electron app will verify the
|
||||
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
|
||||
hashes, the app will forcefully terminate.
|
||||
|
||||
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
|
||||
|
||||
### code signing
|
||||
|
||||
Code signing is a process where an app developer digitally signs their code to
|
||||
|
||||
@@ -5,7 +5,7 @@ slug: asar-integrity
|
||||
hide_title: false
|
||||
---
|
||||
|
||||
ASAR integrity is a security feature that validates the contents of your app's
|
||||
ASAR integrity is an experimental feature that validates the contents of your app's
|
||||
[ASAR archives](./asar-archives.md) at runtime.
|
||||
|
||||
## Version support
|
||||
@@ -77,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
|
||||
### Using Electron tooling
|
||||
|
||||
Electron Forge and Electron Packager do this setup automatically for you with no additional
|
||||
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
|
||||
configuration. The minimum required versions for ASAR integrity are:
|
||||
|
||||
* `@electron/packager@18.3.1`
|
||||
* `@electron/forge@7.4.0`
|
||||
|
||||
@@ -74,22 +74,46 @@ describe('keyboard input', () => {
|
||||
Furthermore, WebdriverIO allows you to access Electron APIs to get static information about your application:
|
||||
|
||||
```js @ts-nocheck
|
||||
import { browser } from '@wdio/globals'
|
||||
import { browser, $, expect } from '@wdio/globals'
|
||||
|
||||
describe('trigger message modal', async () => {
|
||||
it('message modal can be triggered from a test', async () => {
|
||||
await browser.electron.execute(
|
||||
(electron, param1, param2, param3) => {
|
||||
const appWindow = electron.BrowserWindow.getFocusedWindow()
|
||||
electron.dialog.showMessageBox(appWindow, {
|
||||
message: 'Hello World!',
|
||||
detail: `${param1} + ${param2} + ${param3} = ${param1 + param2 + param3}`
|
||||
})
|
||||
},
|
||||
1,
|
||||
2,
|
||||
3
|
||||
)
|
||||
describe('when the make smaller button is clicked', () => {
|
||||
it('should decrease the window height and width by 10 pixels', async () => {
|
||||
const boundsBefore = await browser.electron.browserWindow('getBounds')
|
||||
expect(boundsBefore.width).toEqual(210)
|
||||
expect(boundsBefore.height).toEqual(310)
|
||||
|
||||
await $('.make-smaller').click()
|
||||
const boundsAfter = await browser.electron.browserWindow('getBounds')
|
||||
expect(boundsAfter.width).toEqual(200)
|
||||
expect(boundsAfter.height).toEqual(300)
|
||||
})
|
||||
})
|
||||
```
|
||||
|
||||
or to retrieve other Electron process information:
|
||||
|
||||
```js @ts-nocheck
|
||||
import fs from 'node:fs'
|
||||
import path from 'node:path'
|
||||
|
||||
import { browser, expect } from '@wdio/globals'
|
||||
|
||||
const packageJson = JSON.parse(fs.readFileSync(path.join(__dirname, '..', 'package.json'), { encoding: 'utf-8' }))
|
||||
const { name, version } = packageJson
|
||||
|
||||
describe('electron APIs', () => {
|
||||
it('should retrieve app metadata through the electron API', async () => {
|
||||
const appName = await browser.electron.app('getName')
|
||||
expect(appName).toEqual(name)
|
||||
const appVersion = await browser.electron.app('getVersion')
|
||||
expect(appVersion).toEqual(version)
|
||||
})
|
||||
|
||||
it('should pass args through to the launched application', async () => {
|
||||
// custom args are set in the wdio.conf.js file as they need to be set before WDIO starts
|
||||
const argv = await browser.electron.mainProcess('argv')
|
||||
expect(argv).toContain('--foo')
|
||||
expect(argv).toContain('--bar=baz')
|
||||
})
|
||||
})
|
||||
```
|
||||
@@ -182,7 +206,7 @@ npm install --save-dev @playwright/test
|
||||
```
|
||||
|
||||
:::caution Dependencies
|
||||
This tutorial was written with `@playwright/test@1.52.0`. Check out
|
||||
This tutorial was written with `@playwright/test@1.41.1`. Check out
|
||||
[Playwright's releases][playwright-releases] page to learn about
|
||||
changes that might affect the code below.
|
||||
:::
|
||||
@@ -194,10 +218,10 @@ To point this API to your Electron app, you can pass the path to your main proce
|
||||
entry point (here, it is `main.js`).
|
||||
|
||||
```js {5} @ts-nocheck
|
||||
import { test, _electron as electron } from '@playwright/test'
|
||||
const { test, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('launch app', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
const electronApp = await electron.launch({ args: ['main.js'] })
|
||||
// close app
|
||||
await electronApp.close()
|
||||
})
|
||||
@@ -207,10 +231,10 @@ After that, you will access to an instance of Playwright's `ElectronApp` class.
|
||||
is a powerful class that has access to main process modules for example:
|
||||
|
||||
```js {5-10} @ts-nocheck
|
||||
import { test, _electron as electron } from '@playwright/test'
|
||||
const { test, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('get isPackaged', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
const electronApp = await electron.launch({ args: ['main.js'] })
|
||||
const isPackaged = await electronApp.evaluate(async ({ app }) => {
|
||||
// This runs in Electron's main process, parameter here is always
|
||||
// the result of the require('electron') in the main app script.
|
||||
@@ -226,10 +250,10 @@ It can also create individual [Page][playwright-page] objects from Electron Brow
|
||||
For example, to grab the first BrowserWindow and save a screenshot:
|
||||
|
||||
```js {6-7} @ts-nocheck
|
||||
import { test, _electron as electron } from '@playwright/test'
|
||||
const { test, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('save screenshot', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
const electronApp = await electron.launch({ args: ['main.js'] })
|
||||
const window = await electronApp.firstWindow()
|
||||
await window.screenshot({ path: 'intro.png' })
|
||||
// close app
|
||||
@@ -241,7 +265,7 @@ Putting all this together using the Playwright test-runner, let's create a `exam
|
||||
test file with a single test and assertion:
|
||||
|
||||
```js title='example.spec.js' @ts-nocheck
|
||||
import { test, expect, _electron as electron } from '@playwright/test'
|
||||
const { test, expect, _electron: electron } = require('@playwright/test')
|
||||
|
||||
test('example test', async () => {
|
||||
const electronApp = await electron.launch({ args: ['.'] })
|
||||
|
||||
@@ -9,11 +9,10 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
|
||||
|
||||
| Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
|
||||
| ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
|
||||
| 40.0.0 | 2025-Oct-30 | 2025-Dec-03 | 2025-Oct-28 | 2026-Jun-30 | M144 | TBD | ✅ |
|
||||
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
|
||||
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | TBD | ✅ |
|
||||
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
|
||||
| 37.0.0 | 2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
|
||||
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
|
||||
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | ✅ |
|
||||
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
|
||||
| 34.0.0 | 2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
|
||||
| 33.0.0 | 2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
|
||||
@@ -122,3 +121,22 @@ and that number is reduced to two in major version 10, the three-argument versio
|
||||
continue to work until, at minimum, major version 12. Past the minimum two-version
|
||||
threshold, we will attempt to support backwards compatibility beyond two versions
|
||||
until the maintainers feel the maintenance burden is too high to continue doing so.
|
||||
|
||||
### End-of-life
|
||||
|
||||
When a release branch reaches the end of its support cycle, the series
|
||||
will be deprecated in NPM and a final end-of-support release will be
|
||||
made. This release will add a warning to inform that an unsupported
|
||||
version of Electron is in use.
|
||||
|
||||
These steps are to help app developers learn when a branch they're
|
||||
using becomes unsupported, but without being excessively intrusive
|
||||
to end users.
|
||||
|
||||
If an application has exceptional circumstances and needs to stay
|
||||
on an unsupported series of Electron, developers can silence the
|
||||
end-of-support warning by omitting the final release from the app's
|
||||
`package.json` `devDependencies`. For example, since the 1-6-x series
|
||||
ended with an end-of-support 1.6.18 release, developers could choose
|
||||
to stay in the 1-6-x series without warnings with `devDependency` of
|
||||
`"electron": 1.6.0 - 1.6.17`.
|
||||
|
||||
@@ -4,24 +4,11 @@
|
||||
|
||||
## What are fuses?
|
||||
|
||||
From a security perspective, it makes sense to disable certain unused Electron features
|
||||
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
|
||||
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
|
||||
subset of "living off the land" attacks.
|
||||
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
|
||||
|
||||
We also don't want Electron consumers forking to achieve this goal, as building from source and
|
||||
maintaining a fork is a massive technical challenge and costs a lot of time and money.
|
||||
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
|
||||
|
||||
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
|
||||
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
|
||||
|
||||
Because they are flipped at package time before you code sign your app, the OS becomes responsible
|
||||
for ensuring those bits aren't flipped back via OS-level code signing validation
|
||||
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
|
||||
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
|
||||
on Windows).
|
||||
|
||||
## Current fuses
|
||||
## Current Fuses
|
||||
|
||||
### `runAsNode`
|
||||
|
||||
@@ -29,11 +16,7 @@ on Windows).
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.RunAsNode`
|
||||
|
||||
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
|
||||
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
|
||||
as expected, as it depends on this environment variable to function. Instead, we recommend that you
|
||||
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
|
||||
standalone Node.js process (e.g. a SQLite server process).
|
||||
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
|
||||
|
||||
### `cookieEncryption`
|
||||
|
||||
@@ -41,12 +24,7 @@ standalone Node.js process (e.g. a SQLite server process).
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
|
||||
|
||||
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
|
||||
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
|
||||
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
|
||||
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
|
||||
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
|
||||
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
|
||||
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
|
||||
|
||||
### `nodeOptions`
|
||||
|
||||
@@ -54,11 +32,7 @@ later will make your cookie store corrupt and useless. Most apps can safely enab
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
|
||||
|
||||
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
|
||||
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
|
||||
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
|
||||
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
|
||||
Most apps can safely disable this fuse.
|
||||
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
|
||||
|
||||
### `nodeCliInspect`
|
||||
|
||||
@@ -66,9 +40,7 @@ Most apps can safely disable this fuse.
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
|
||||
|
||||
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
|
||||
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
|
||||
inspector. Most apps can safely disable this fuse.
|
||||
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
|
||||
|
||||
### `embeddedAsarIntegrityValidation`
|
||||
|
||||
@@ -76,12 +48,9 @@ inspector. Most apps can safely disable this fuse.
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
|
||||
|
||||
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
|
||||
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
|
||||
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
|
||||
Most apps can safely enable this fuse.
|
||||
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
|
||||
|
||||
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
|
||||
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
|
||||
|
||||
### `onlyLoadAppFromAsar`
|
||||
|
||||
@@ -89,15 +58,7 @@ For more information on how to use ASAR integrity validation, please read the [A
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
|
||||
|
||||
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
|
||||
By default, Electron will search for this code in the following order:
|
||||
|
||||
1. `app.asar`
|
||||
1. `app`
|
||||
1. `default_app.asar`
|
||||
|
||||
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
|
||||
it is impossible to load non-validated code.
|
||||
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
|
||||
|
||||
### `loadBrowserProcessSpecificV8Snapshot`
|
||||
|
||||
@@ -105,17 +66,11 @@ it is impossible to load non-validated code.
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
|
||||
|
||||
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
|
||||
initialized heaps and then load them back in to avoid the cost of initializing the heap.
|
||||
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
|
||||
|
||||
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
|
||||
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
|
||||
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
|
||||
Other processes will use the V8 snapshot file that they normally do.
|
||||
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
|
||||
|
||||
Using separate snapshots for renderer processes and the main process can improve security, especially
|
||||
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
|
||||
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
|
||||
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
|
||||
|
||||
### `grantFileProtocolExtraPrivileges`
|
||||
|
||||
@@ -123,25 +78,19 @@ See [electron/electron#35170](https://github.com/electron/electron/issues/35170)
|
||||
|
||||
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
|
||||
|
||||
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
|
||||
are given privileges beyond what they would receive in a traditional web browser. This behavior was
|
||||
core to Electron apps in original versions of Electron, but is no longer required as apps should be
|
||||
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
|
||||
|
||||
If you aren't serving pages from `file://`, you should disable this fuse.
|
||||
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
|
||||
|
||||
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
|
||||
|
||||
* `file://` protocol pages can use `fetch` to load other assets over `file://`
|
||||
* `file://` protocol pages can use service workers
|
||||
* `file://` protocol pages have universal access granted to child frames also running on `file://`
|
||||
protocols regardless of sandbox settings
|
||||
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
|
||||
|
||||
## How do I flip fuses?
|
||||
## How do I flip the fuses?
|
||||
|
||||
### The easy way
|
||||
|
||||
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
|
||||
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
|
||||
|
||||
```js @ts-nocheck
|
||||
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
|
||||
@@ -157,37 +106,29 @@ flipFuses(
|
||||
)
|
||||
```
|
||||
|
||||
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
|
||||
app using the `@electron/fuses` CLI.
|
||||
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
|
||||
|
||||
```bash
|
||||
npx @electron/fuses read --app /Applications/Foo.app
|
||||
```
|
||||
|
||||
>[!NOTE]
|
||||
> If you are using Electron Forge to distribute your application, you can flip fuses using
|
||||
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
|
||||
> which comes pre-installed with all templates.
|
||||
|
||||
### The hard way
|
||||
|
||||
> [!IMPORTANT]
|
||||
> Glossary:
|
||||
>
|
||||
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
|
||||
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
|
||||
> * **Fuse Schema**: The format/allowed values for the fuse wire
|
||||
#### Quick Glossary
|
||||
|
||||
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
|
||||
sequence of bytes that represent the state of the fuses you want.
|
||||
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
|
||||
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
|
||||
* **Fuse Schema**: The format / allowed values for the fuse wire
|
||||
|
||||
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
|
||||
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
|
||||
|
||||
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
|
||||
|
||||
```text
|
||||
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
|
||||
```
|
||||
|
||||
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
|
||||
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
|
||||
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
|
||||
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
|
||||
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
|
||||
@@ -195,6 +136,6 @@ Somewhere in the Electron binary, there will be a sequence of bytes that look li
|
||||
* "1" (0x31) indicates the fuse is enabled
|
||||
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
|
||||
|
||||
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
|
||||
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
|
||||
|
||||
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).
|
||||
|
||||
@@ -110,10 +110,4 @@ the item is a Markdown file located in the root of the project:
|
||||
|
||||

|
||||
|
||||
## Dragging files into your app
|
||||
|
||||
You can use the standard
|
||||
[Drag and Drop web API](https://developer.mozilla.org/en-US/docs/Web/API/HTML_Drag_and_Drop_API)
|
||||
for dragging and dropping files into your app.
|
||||
|
||||
[`contextBridge`]: ../api/context-bridge.md
|
||||
|
||||
@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
|
||||
You should at least follow these steps to improve the security of your application:
|
||||
|
||||
1. [Only load secure content](#1-only-load-secure-content)
|
||||
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
|
||||
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
|
||||
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
|
||||
4. [Enable process sandboxing](#4-enable-process-sandboxing)
|
||||
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
|
||||
@@ -299,7 +299,7 @@ const { session } = require('electron')
|
||||
const { URL } = require('node:url')
|
||||
|
||||
session
|
||||
.defaultSession
|
||||
.fromPartition('some-partition')
|
||||
.setPermissionRequestHandler((webContents, permission, callback) => {
|
||||
const parsedUrl = new URL(webContents.getURL())
|
||||
|
||||
@@ -316,8 +316,6 @@ session
|
||||
})
|
||||
```
|
||||
|
||||
Note: `session.defaultSession` is only available after `app.whenReady` is called.
|
||||
|
||||
### 6. Do not disable `webSecurity`
|
||||
|
||||
:::info
|
||||
@@ -408,8 +406,6 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
|
||||
})
|
||||
```
|
||||
|
||||
Note: `session.defaultSession` is only available after `app.whenReady` is called.
|
||||
|
||||
#### CSP meta tag
|
||||
|
||||
CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
|
||||
@@ -822,10 +818,10 @@ that your application might have the rights for.
|
||||
|
||||
#### How?
|
||||
|
||||
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
|
||||
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
|
||||
flipping these fuses easy. Check out the README of that module for more details on usage and
|
||||
potential error cases, and refer to
|
||||
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
|
||||
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
|
||||
|
||||
### 20. Do not expose Electron APIs to untrusted web content
|
||||
|
||||
|
||||
@@ -82,7 +82,6 @@ auto_filenames = {
|
||||
"docs/api/structures/browser-window-options.md",
|
||||
"docs/api/structures/certificate-principal.md",
|
||||
"docs/api/structures/certificate.md",
|
||||
"docs/api/structures/color-space.md",
|
||||
"docs/api/structures/cookie.md",
|
||||
"docs/api/structures/cpu-usage.md",
|
||||
"docs/api/structures/crash-report.md",
|
||||
@@ -144,7 +143,6 @@ auto_filenames = {
|
||||
"docs/api/structures/service-worker-info.md",
|
||||
"docs/api/structures/shared-dictionary-info.md",
|
||||
"docs/api/structures/shared-dictionary-usage-info.md",
|
||||
"docs/api/structures/shared-texture-handle.md",
|
||||
"docs/api/structures/shared-worker-info.md",
|
||||
"docs/api/structures/sharing-item.md",
|
||||
"docs/api/structures/shortcut-details.md",
|
||||
|
||||
@@ -629,6 +629,8 @@ filenames = {
|
||||
"shell/common/gin_converters/usb_device_info_converter.h",
|
||||
"shell/common/gin_converters/value_converter.cc",
|
||||
"shell/common/gin_converters/value_converter.h",
|
||||
"shell/common/gin_helper/arguments.cc",
|
||||
"shell/common/gin_helper/arguments.h",
|
||||
"shell/common/gin_helper/callback.cc",
|
||||
"shell/common/gin_helper/callback.h",
|
||||
"shell/common/gin_helper/cleaned_up_at_exit.cc",
|
||||
|
||||
@@ -217,7 +217,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
|
||||
"//third_party/libc++/src/include/__atomic/contention_t.h",
|
||||
"//third_party/libc++/src/include/__atomic/fence.h",
|
||||
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
|
||||
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
|
||||
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
|
||||
"//third_party/libc++/src/include/__atomic/memory_order.h",
|
||||
@@ -841,6 +840,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/cmath",
|
||||
"//third_party/libc++/src/include/__cxx03/codecvt",
|
||||
"//third_party/libc++/src/include/__cxx03/complex",
|
||||
"//third_party/libc++/src/include/__cxx03/complex.h",
|
||||
"//third_party/libc++/src/include/__cxx03/condition_variable",
|
||||
"//third_party/libc++/src/include/__cxx03/csetjmp",
|
||||
"//third_party/libc++/src/include/__cxx03/csignal",
|
||||
@@ -853,20 +853,25 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/cstring",
|
||||
"//third_party/libc++/src/include/__cxx03/ctgmath",
|
||||
"//third_party/libc++/src/include/__cxx03/ctime",
|
||||
"//third_party/libc++/src/include/__cxx03/ctype.h",
|
||||
"//third_party/libc++/src/include/__cxx03/cuchar",
|
||||
"//third_party/libc++/src/include/__cxx03/cwchar",
|
||||
"//third_party/libc++/src/include/__cxx03/cwctype",
|
||||
"//third_party/libc++/src/include/__cxx03/deque",
|
||||
"//third_party/libc++/src/include/__cxx03/errno.h",
|
||||
"//third_party/libc++/src/include/__cxx03/exception",
|
||||
"//third_party/libc++/src/include/__cxx03/experimental/__config",
|
||||
"//third_party/libc++/src/include/__cxx03/experimental/utility",
|
||||
"//third_party/libc++/src/include/__cxx03/ext/__hash",
|
||||
"//third_party/libc++/src/include/__cxx03/ext/hash_map",
|
||||
"//third_party/libc++/src/include/__cxx03/ext/hash_set",
|
||||
"//third_party/libc++/src/include/__cxx03/fenv.h",
|
||||
"//third_party/libc++/src/include/__cxx03/float.h",
|
||||
"//third_party/libc++/src/include/__cxx03/forward_list",
|
||||
"//third_party/libc++/src/include/__cxx03/fstream",
|
||||
"//third_party/libc++/src/include/__cxx03/functional",
|
||||
"//third_party/libc++/src/include/__cxx03/future",
|
||||
"//third_party/libc++/src/include/__cxx03/inttypes.h",
|
||||
"//third_party/libc++/src/include/__cxx03/iomanip",
|
||||
"//third_party/libc++/src/include/__cxx03/ios",
|
||||
"//third_party/libc++/src/include/__cxx03/iosfwd",
|
||||
@@ -893,8 +898,11 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/sstream",
|
||||
"//third_party/libc++/src/include/__cxx03/stack",
|
||||
"//third_party/libc++/src/include/__cxx03/stdatomic.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdbool.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stddef.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdexcept",
|
||||
"//third_party/libc++/src/include/__cxx03/stdint.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdio.h",
|
||||
"//third_party/libc++/src/include/__cxx03/stdlib.h",
|
||||
"//third_party/libc++/src/include/__cxx03/streambuf",
|
||||
"//third_party/libc++/src/include/__cxx03/string",
|
||||
@@ -902,6 +910,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/string_view",
|
||||
"//third_party/libc++/src/include/__cxx03/strstream",
|
||||
"//third_party/libc++/src/include/__cxx03/system_error",
|
||||
"//third_party/libc++/src/include/__cxx03/tgmath.h",
|
||||
"//third_party/libc++/src/include/__cxx03/thread",
|
||||
"//third_party/libc++/src/include/__cxx03/type_traits",
|
||||
"//third_party/libc++/src/include/__cxx03/typeindex",
|
||||
@@ -914,6 +923,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__cxx03/vector",
|
||||
"//third_party/libc++/src/include/__cxx03/version",
|
||||
"//third_party/libc++/src/include/__cxx03/wchar.h",
|
||||
"//third_party/libc++/src/include/__cxx03/wctype.h",
|
||||
"//third_party/libc++/src/include/__debug_utils/randomize_range.h",
|
||||
"//third_party/libc++/src/include/__debug_utils/sanitizers.h",
|
||||
"//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
|
||||
@@ -1024,12 +1034,14 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__fwd/get.h",
|
||||
"//third_party/libc++/src/include/__fwd/ios.h",
|
||||
"//third_party/libc++/src/include/__fwd/istream.h",
|
||||
"//third_party/libc++/src/include/__fwd/map.h",
|
||||
"//third_party/libc++/src/include/__fwd/mdspan.h",
|
||||
"//third_party/libc++/src/include/__fwd/memory.h",
|
||||
"//third_party/libc++/src/include/__fwd/memory_resource.h",
|
||||
"//third_party/libc++/src/include/__fwd/ostream.h",
|
||||
"//third_party/libc++/src/include/__fwd/pair.h",
|
||||
"//third_party/libc++/src/include/__fwd/queue.h",
|
||||
"//third_party/libc++/src/include/__fwd/set.h",
|
||||
"//third_party/libc++/src/include/__fwd/span.h",
|
||||
"//third_party/libc++/src/include/__fwd/sstream.h",
|
||||
"//third_party/libc++/src/include/__fwd/stack.h",
|
||||
@@ -1105,7 +1117,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__locale_dir/support/freebsd.h",
|
||||
"//third_party/libc++/src/include/__locale_dir/support/fuchsia.h",
|
||||
"//third_party/libc++/src/include/__locale_dir/support/linux.h",
|
||||
"//third_party/libc++/src/include/__locale_dir/support/netbsd.h",
|
||||
"//third_party/libc++/src/include/__locale_dir/support/no_locale/characters.h",
|
||||
"//third_party/libc++/src/include/__locale_dir/support/no_locale/strtonum.h",
|
||||
"//third_party/libc++/src/include/__locale_dir/support/windows.h",
|
||||
@@ -1356,9 +1367,11 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__tree",
|
||||
"//third_party/libc++/src/include/__tuple/find_index.h",
|
||||
"//third_party/libc++/src/include/__tuple/ignore.h",
|
||||
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
|
||||
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_element.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_like.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_size.h",
|
||||
"//third_party/libc++/src/include/__tuple/tuple_types.h",
|
||||
@@ -1368,6 +1381,7 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/aligned_storage.h",
|
||||
"//third_party/libc++/src/include/__type_traits/aligned_union.h",
|
||||
"//third_party/libc++/src/include/__type_traits/alignment_of.h",
|
||||
"//third_party/libc++/src/include/__type_traits/can_extract_key.h",
|
||||
"//third_party/libc++/src/include/__type_traits/common_reference.h",
|
||||
"//third_party/libc++/src/include/__type_traits/common_type.h",
|
||||
"//third_party/libc++/src/include/__type_traits/conditional.h",
|
||||
@@ -1415,7 +1429,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_function.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_integral.h",
|
||||
@@ -1449,7 +1462,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/is_trivially_relocatable.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_unbounded_array.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_union.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_unqualified.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_unsigned.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
|
||||
"//third_party/libc++/src/include/__type_traits/is_void.h",
|
||||
@@ -1458,7 +1470,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_signed.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
|
||||
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
|
||||
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
|
||||
"//third_party/libc++/src/include/__type_traits/nat.h",
|
||||
@@ -1490,7 +1501,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__utility/cmp.h",
|
||||
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
|
||||
"//third_party/libc++/src/include/__utility/declval.h",
|
||||
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
|
||||
"//third_party/libc++/src/include/__utility/element_count.h",
|
||||
"//third_party/libc++/src/include/__utility/empty.h",
|
||||
"//third_party/libc++/src/include/__utility/exception_guard.h",
|
||||
@@ -1501,7 +1511,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__utility/integer_sequence.h",
|
||||
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
|
||||
"//third_party/libc++/src/include/__utility/is_valid_range.h",
|
||||
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
|
||||
"//third_party/libc++/src/include/__utility/move.h",
|
||||
"//third_party/libc++/src/include/__utility/no_destroy.h",
|
||||
"//third_party/libc++/src/include/__utility/pair.h",
|
||||
@@ -1513,7 +1522,6 @@ libcxx_headers = [
|
||||
"//third_party/libc++/src/include/__utility/small_buffer.h",
|
||||
"//third_party/libc++/src/include/__utility/swap.h",
|
||||
"//third_party/libc++/src/include/__utility/to_underlying.h",
|
||||
"//third_party/libc++/src/include/__utility/try_key_extraction.h",
|
||||
"//third_party/libc++/src/include/__utility/unreachable.h",
|
||||
"//third_party/libc++/src/include/__variant/monostate.h",
|
||||
"//third_party/libc++/src/include/__vector/comparison.h",
|
||||
|
||||
@@ -1,14 +1,11 @@
|
||||
import { Menu } from 'electron/main';
|
||||
|
||||
import { EventEmitter } from 'events';
|
||||
import * as fs from 'fs';
|
||||
|
||||
const bindings = process._linkedBinding('electron_browser_app');
|
||||
const commandLine = process._linkedBinding('electron_common_command_line');
|
||||
const { app } = bindings;
|
||||
|
||||
Object.setPrototypeOf(app, EventEmitter.prototype);
|
||||
|
||||
// Only one app object permitted.
|
||||
export default app;
|
||||
|
||||
|
||||
@@ -46,11 +46,11 @@ Menu.prototype._isCommandIdEnabled = function (id) {
|
||||
};
|
||||
|
||||
Menu.prototype._shouldCommandIdWorkWhenHidden = function (id) {
|
||||
return this.commandsMap[id]?.acceleratorWorksWhenHidden ?? false;
|
||||
return this.commandsMap[id] ? !!this.commandsMap[id].acceleratorWorksWhenHidden : false;
|
||||
};
|
||||
|
||||
Menu.prototype._isCommandIdVisible = function (id) {
|
||||
return this.commandsMap[id]?.visible ?? false;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].visible : false;
|
||||
};
|
||||
|
||||
Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator) {
|
||||
@@ -61,12 +61,12 @@ Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator
|
||||
};
|
||||
|
||||
Menu.prototype._shouldRegisterAcceleratorForCommandId = function (id) {
|
||||
return this.commandsMap[id]?.registerAccelerator ?? false;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].registerAccelerator : false;
|
||||
};
|
||||
|
||||
if (process.platform === 'darwin') {
|
||||
Menu.prototype._getSharingItemForCommandId = function (id) {
|
||||
return this.commandsMap[id]?.sharingItem ?? null;
|
||||
return this.commandsMap[id] ? this.commandsMap[id].sharingItem : null;
|
||||
};
|
||||
}
|
||||
|
||||
|
||||
@@ -882,7 +882,7 @@ export function create (options = {}): Electron.WebContents {
|
||||
return new (WebContents as any)(options);
|
||||
}
|
||||
|
||||
export function fromId (id: number) {
|
||||
export function fromId (id: string) {
|
||||
return binding.fromId(id);
|
||||
}
|
||||
|
||||
|
||||
@@ -91,12 +91,6 @@ export function parseFeatures (features: string) {
|
||||
delete parsed[key];
|
||||
}
|
||||
|
||||
// Per spec - https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev
|
||||
// windows are always resizable.
|
||||
if (parsed.resizable !== undefined) {
|
||||
delete parsed.resizable;
|
||||
}
|
||||
|
||||
if (parsed.left !== undefined) parsed.x = parsed.left;
|
||||
if (parsed.top !== undefined) parsed.y = parsed.top;
|
||||
|
||||
|
||||
@@ -289,7 +289,8 @@ function parseOptions (optionsIn: ClientRequestConstructorOptions | string): Nod
|
||||
referrerPolicy: options.referrerPolicy,
|
||||
cache: options.cache,
|
||||
allowNonHttpProtocols: Object.hasOwn(options, kAllowNonHttpProtocols),
|
||||
priority: options.priority
|
||||
priority: options.priority,
|
||||
bypassCustomProtocolHandlers: options.bypassCustomProtocolHandlers
|
||||
};
|
||||
if ('priorityIncremental' in options) {
|
||||
urlLoaderOptions.priorityIncremental = options.priorityIncremental;
|
||||
@@ -427,8 +428,9 @@ export class ClientRequest extends Writable implements Electron.ClientRequest {
|
||||
this._started = true;
|
||||
const stringifyValues = (obj: Record<string, { name: string, value: string | string[] }>) => {
|
||||
const ret: Record<string, string> = {};
|
||||
for (const { name, value } of Object.values(obj)) {
|
||||
ret[name] = value.toString();
|
||||
for (const k of Object.keys(obj)) {
|
||||
const kv = obj[k];
|
||||
ret[kv.name] = kv.value.toString();
|
||||
}
|
||||
return ret;
|
||||
};
|
||||
|
||||
@@ -746,7 +746,7 @@ export const wrapFsWithAsar = (fs: Record<string, any>) => {
|
||||
|
||||
context.readdirResults.push(dirent);
|
||||
if (dirent!.isDirectory() || stat === 1) {
|
||||
context.pathsQueue.push(path.join(dirent!.parentPath, dirent!.name));
|
||||
context.pathsQueue.push(path.join(dirent!.path, dirent!.name));
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
@@ -5,9 +5,7 @@ const proc = require('child_process');
|
||||
const electron = require('./');
|
||||
|
||||
const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
|
||||
let childClosed = false;
|
||||
child.on('close', function (code, signal) {
|
||||
childClosed = true;
|
||||
if (code === null) {
|
||||
console.error(electron, 'exited with signal', signal);
|
||||
process.exit(1);
|
||||
@@ -17,7 +15,7 @@ child.on('close', function (code, signal) {
|
||||
|
||||
const handleTerminationSignal = function (signal) {
|
||||
process.on(signal, function signalHandler () {
|
||||
if (!childClosed) {
|
||||
if (!child.killed) {
|
||||
child.kill(signal);
|
||||
}
|
||||
});
|
||||
@@ -25,4 +23,3 @@ const handleTerminationSignal = function (signal) {
|
||||
|
||||
handleTerminationSignal('SIGINT');
|
||||
handleTerminationSignal('SIGTERM');
|
||||
handleTerminationSignal('SIGUSR2');
|
||||
|
||||
@@ -9,7 +9,7 @@
|
||||
},
|
||||
"dependencies": {
|
||||
"@electron/get": "^2.0.0",
|
||||
"@types/node": "^24.9.0",
|
||||
"@types/node": "^22.7.7",
|
||||
"extract-zip": "^2.0.1"
|
||||
},
|
||||
"engines": {
|
||||
|
||||
50
package.json
50
package.json
@@ -1,22 +1,23 @@
|
||||
{
|
||||
"name": "electron",
|
||||
"name": "@electron-ci/dev-root",
|
||||
"version": "0.0.0-development",
|
||||
"repository": "https://github.com/electron/electron",
|
||||
"description": "Build cross platform desktop apps with JavaScript, HTML, and CSS",
|
||||
"devDependencies": {
|
||||
"@azure/storage-blob": "^12.28.0",
|
||||
"@azure/storage-blob": "^12.25.0",
|
||||
"@datadog/datadog-ci": "^4.1.2",
|
||||
"@electron/asar": "^3.2.13",
|
||||
"@electron/docs-parser": "^2.0.0",
|
||||
"@electron/fiddle-core": "^1.3.4",
|
||||
"@electron/github-app-auth": "^2.2.1",
|
||||
"@electron/lint-roller": "^3.1.2",
|
||||
"@electron/typescript-definitions": "^9.1.5",
|
||||
"@octokit/rest": "^20.1.2",
|
||||
"@electron/github-app-auth": "^3.2.0",
|
||||
"@electron/lint-roller": "^3.1.1",
|
||||
"@electron/typescript-definitions": "^9.1.2",
|
||||
"@octokit/rest": "^20.0.2",
|
||||
"@primer/octicons": "^10.0.0",
|
||||
"@types/minimist": "^1.2.5",
|
||||
"@types/node": "^24.9.0",
|
||||
"@types/node": "^22.7.7",
|
||||
"@types/semver": "^7.5.8",
|
||||
"@types/stream-json": "^1.7.8",
|
||||
"@types/stream-json": "^1.7.7",
|
||||
"@types/temp": "^0.9.4",
|
||||
"@typescript-eslint/eslint-plugin": "^8.32.1",
|
||||
"@typescript-eslint/parser": "^8.7.0",
|
||||
@@ -24,7 +25,6 @@
|
||||
"buffer": "^6.0.3",
|
||||
"chalk": "^4.1.0",
|
||||
"check-for-leaks": "^1.2.1",
|
||||
"dugite": "^2.7.1",
|
||||
"eslint": "^8.57.1",
|
||||
"eslint-config-standard": "^17.1.0",
|
||||
"eslint-plugin-import": "^2.32.0",
|
||||
@@ -34,29 +34,31 @@
|
||||
"eslint-plugin-node": "^11.1.0",
|
||||
"eslint-plugin-promise": "^6.6.0",
|
||||
"events": "^3.2.0",
|
||||
"folder-hash": "^4.1.1",
|
||||
"folder-hash": "^2.1.1",
|
||||
"got": "^11.8.5",
|
||||
"husky": "^9.1.7",
|
||||
"lint-staged": "^16.1.0",
|
||||
"markdownlint-cli2": "^0.18.0",
|
||||
"minimist": "^1.2.8",
|
||||
"node-gyp": "^11.4.2",
|
||||
"null-loader": "^4.0.1",
|
||||
"pre-flight": "^2.0.0",
|
||||
"process": "^0.11.10",
|
||||
"remark-cli": "^12.0.1",
|
||||
"remark-preset-lint-markdown-style-guide": "^6.0.1",
|
||||
"remark-preset-lint-markdown-style-guide": "^4.0.0",
|
||||
"semver": "^7.6.3",
|
||||
"stream-json": "^1.9.1",
|
||||
"stream-json": "^1.8.0",
|
||||
"tap-xunit": "^2.4.1",
|
||||
"temp": "^0.9.4",
|
||||
"timers-browserify": "1.4.2",
|
||||
"ts-loader": "^8.0.2",
|
||||
"ts-node": "6.2.0",
|
||||
"typescript": "^5.8.3",
|
||||
"typescript": "^5.6.2",
|
||||
"url": "^0.11.4",
|
||||
"webpack": "^5.95.0",
|
||||
"webpack-cli": "^6.0.1",
|
||||
"wrapper-webpack-plugin": "^2.2.0"
|
||||
"webpack-cli": "^5.1.4",
|
||||
"wrapper-webpack-plugin": "^2.2.0",
|
||||
"yaml": "^2.8.1"
|
||||
},
|
||||
"private": true,
|
||||
"scripts": {
|
||||
@@ -131,9 +133,25 @@
|
||||
"DEPS": [
|
||||
"node script/gen-hunspell-filenames.js",
|
||||
"node script/gen-libc++-filenames.js"
|
||||
],
|
||||
".github/workflows/pipeline-segment-electron-build.yml": [
|
||||
"node script/copy-pipeline-segment-publish.js",
|
||||
"git add .github/workflows/pipeline-segment-electron-publish.yml"
|
||||
]
|
||||
},
|
||||
"resolutions": {
|
||||
"nan": "nodejs/nan#e14bdcd1f72d62bca1d541b66da43130384ec213"
|
||||
"dbus-native/xml2js": "0.5.0",
|
||||
"abstract-socket": "github:deepak1556/node-abstractsocket#928cc591decd12aff7dad96449da8afc29832c19",
|
||||
"minimist@npm:~0.0.1": "0.2.4"
|
||||
},
|
||||
"packageManager": "yarn@4.12.0",
|
||||
"workspaces": [
|
||||
"spec",
|
||||
"spec/fixtures/native-addon/*"
|
||||
],
|
||||
"dependenciesMeta": {
|
||||
"abstract-socket": {
|
||||
"built": true
|
||||
}
|
||||
}
|
||||
}
|
||||
|
||||
1
patches/angle/.patches
Normal file
1
patches/angle/.patches
Normal file
@@ -0,0 +1 @@
|
||||
cherry-pick-2f564f1ca07b.patch
|
||||
125
patches/angle/cherry-pick-2f564f1ca07b.patch
Normal file
125
patches/angle/cherry-pick-2f564f1ca07b.patch
Normal file
@@ -0,0 +1,125 @@
|
||||
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
|
||||
From: Mark Mentovai <mark@chromium.org>
|
||||
Date: Tue, 16 Sep 2025 16:46:36 -0400
|
||||
Subject: mac: handle Metal toolchain being unbundled from Xcode 26
|
||||
MIME-Version: 1.0
|
||||
Content-Type: text/plain; charset=UTF-8
|
||||
Content-Transfer-Encoding: 8bit
|
||||
|
||||
The Metal toolchain was formerly part of Xcode, but in Xcode 26, it has
|
||||
been unbundled and is now a separate install. Attempting to use the
|
||||
Metal toolchain without installing it results in a build error, such as:
|
||||
|
||||
error: error: cannot execute tool 'metal' due to missing Metal
|
||||
Toolchain; use: xcodebuild -downloadComponent MetalToolchain
|
||||
|
||||
By running the suggested command, the Metal toolchain can be installed,
|
||||
but the existing angle build does not know how to find it correctly.
|
||||
|
||||
For system Xcode installations, tools from the Metal toolchain (`metal`
|
||||
and `metallib`) can be run via `xcrun`. This construct should work
|
||||
equally well for older Xcode versions, for situations where it’s still
|
||||
in use.
|
||||
|
||||
For the hermetic toolchain, we’ll continue splicing the Metal toolchain
|
||||
into the location it had previously been avialable (see
|
||||
https://chromium-review.googlesource.com/c/6950738), although this is
|
||||
subject to change in the future.
|
||||
|
||||
Bug: chromium:423933062, chromium:445400016
|
||||
Change-Id: I139eca51938f7cecfec9b90fd488947160ef4ec9
|
||||
Reviewed-on: https://chromium-review.googlesource.com/c/angle/angle/+/6955000
|
||||
Auto-Submit: Mark Mentovai <mark@chromium.org>
|
||||
Commit-Queue: Mark Mentovai <mark@chromium.org>
|
||||
Reviewed-by: Geoff Lang <geofflang@chromium.org>
|
||||
|
||||
diff --git a/src/libANGLE/renderer/metal/BUILD.gn b/src/libANGLE/renderer/metal/BUILD.gn
|
||||
index 96e9ee8420810f6a3ca9a0c290d4a654200eb7b9..50ac42a5b9a0f7c8b3b161af40c598cb34ff132a 100644
|
||||
--- a/src/libANGLE/renderer/metal/BUILD.gn
|
||||
+++ b/src/libANGLE/renderer/metal/BUILD.gn
|
||||
@@ -24,20 +24,56 @@ config("angle_metal_backend_config") {
|
||||
}
|
||||
|
||||
if (metal_internal_shader_compilation_supported) {
|
||||
+ template("run_metal_tool") {
|
||||
+ action(target_name) {
|
||||
+ forward_variables_from(invoker,
|
||||
+ [
|
||||
+ "deps",
|
||||
+ "sources",
|
||||
+ "outputs",
|
||||
+ "metal_tool",
|
||||
+ ])
|
||||
+ script = "shaders/metal_wrapper.py"
|
||||
+ if (use_system_xcode) {
|
||||
+ # System Xcode: run metal and metallib via xcrun. Since Xcode 26.0, the
|
||||
+ # Metal toolchain has been unbundled from Xcode, and must be installed
|
||||
+ # separately by running `xcodebuild -downloadComponent MetalToolchain`.
|
||||
+ # There is a vestigial metal executable in mac_bin_path, but it’s
|
||||
+ # incapable of running successfuly without the
|
||||
+ # rest of the Metal toolchain surrounding it. `xcrun` is able to find
|
||||
+ # and run the correct Metal toolchain when properly installed.
|
||||
+ #
|
||||
+ # If you’re using system Xcode and your build fails with this message:
|
||||
+ # error: error: cannot execute tool 'metal' due to missing Metal Toolchain; use: xcodebuild -downloadComponent MetalToolchain
|
||||
+ # then do what the error message suggests, and then retry your build.
|
||||
+ args = [
|
||||
+ "xcrun",
|
||||
+ metal_tool,
|
||||
+ ]
|
||||
+ } else {
|
||||
+ # Hermetic Xcode: at least for now, the Metal toolchain is
|
||||
+ # “spliced” into the location in the hermetic toolchain where it lived
|
||||
+ # before Xcode 26.0, so it can be run directly from there.
|
||||
+ args = [ mac_bin_path + metal_tool ]
|
||||
+ }
|
||||
+
|
||||
+ args += invoker.args
|
||||
+ }
|
||||
+ }
|
||||
+
|
||||
_metal_internal_shaders_air_file =
|
||||
"$root_gen_dir/angle/mtl_internal_shaders_autogen.air"
|
||||
|
||||
- action("angle_metal_internal_shaders_to_air") {
|
||||
- script = "shaders/metal_wrapper.py"
|
||||
-
|
||||
- outputs = [ _metal_internal_shaders_air_file ]
|
||||
-
|
||||
+ run_metal_tool("angle_metal_internal_shaders_to_air") {
|
||||
_metal_internal_shaders_metal_source =
|
||||
"shaders/mtl_internal_shaders_autogen.metal"
|
||||
sources = [ _metal_internal_shaders_metal_source ]
|
||||
|
||||
+ outputs = [ _metal_internal_shaders_air_file ]
|
||||
+
|
||||
+ metal_tool = "metal"
|
||||
+
|
||||
args = [
|
||||
- mac_bin_path + "metal",
|
||||
"-c",
|
||||
rebase_path(_metal_internal_shaders_metal_source, root_build_dir),
|
||||
"-o",
|
||||
@@ -60,17 +96,16 @@ if (metal_internal_shader_compilation_supported) {
|
||||
_metal_internal_shaders_metallib_file =
|
||||
"$root_gen_dir/angle/mtl_internal_shaders_autogen.metallib"
|
||||
|
||||
- action("angle_metal_internal_shaders_to_mtllib") {
|
||||
- script = "shaders/metal_wrapper.py"
|
||||
-
|
||||
- outputs = [ _metal_internal_shaders_metallib_file ]
|
||||
+ run_metal_tool("angle_metal_internal_shaders_to_mtllib") {
|
||||
+ deps = [ ":angle_metal_internal_shaders_to_air" ]
|
||||
|
||||
sources = [ _metal_internal_shaders_air_file ]
|
||||
|
||||
- deps = [ ":angle_metal_internal_shaders_to_air" ]
|
||||
+ outputs = [ _metal_internal_shaders_metallib_file ]
|
||||
+
|
||||
+ metal_tool = "metallib"
|
||||
|
||||
args = [
|
||||
- mac_bin_path + "metallib",
|
||||
rebase_path(_metal_internal_shaders_air_file, root_build_dir),
|
||||
"-o",
|
||||
rebase_path(_metal_internal_shaders_metallib_file, root_build_dir),
|
||||
@@ -10,10 +10,10 @@ this patch is required to provide ripemd160 support in the nodejs crypto
|
||||
module.
|
||||
|
||||
diff --git a/crypto/digest/digest_extra.cc b/crypto/digest/digest_extra.cc
|
||||
index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47b9e3034f 100644
|
||||
index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d27388be99 100644
|
||||
--- a/crypto/digest/digest_extra.cc
|
||||
+++ b/crypto/digest/digest_extra.cc
|
||||
@@ -47,6 +47,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
|
||||
@@ -46,6 +46,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
|
||||
{NID_sha512, EVP_sha512, SN_sha512, LN_sha512},
|
||||
{NID_sha512_256, EVP_sha512_256, SN_sha512_256, LN_sha512_256},
|
||||
{NID_md5_sha1, EVP_md5_sha1, SN_md5_sha1, LN_md5_sha1},
|
||||
@@ -22,7 +22,7 @@ index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47
|
||||
// hash function when given a signature OID. To avoid unintended lax parsing
|
||||
// of hash OIDs, this is no longer supported for lookup by OID or NID.
|
||||
diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
|
||||
index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
|
||||
index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
|
||||
--- a/crypto/fipsmodule/digest/digests.cc.inc
|
||||
+++ b/crypto/fipsmodule/digest/digests.cc.inc
|
||||
@@ -18,6 +18,7 @@
|
||||
@@ -62,27 +62,27 @@ index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649
|
||||
+
|
||||
#undef CHECK
|
||||
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
|
||||
index feaf17c72cecb8099bc11ac10747fbad719ddca9..891a73f229e3f0838cb2fa99b8fb24fdeac1962b 100644
|
||||
index e04b80cd6a1a215fc87f8fd8d750c3d258c3974f..8fdf1c624794f568bfc77b7b6b0c510b23905a4d 100644
|
||||
--- a/decrepit/evp/evp_do_all.cc
|
||||
+++ b/decrepit/evp/evp_do_all.cc
|
||||
@@ -79,6 +79,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
|
||||
callback(EVP_sha384(), "SHA384", nullptr, arg);
|
||||
callback(EVP_sha512(), "SHA512", nullptr, arg);
|
||||
callback(EVP_sha512_256(), "SHA512-256", nullptr, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
|
||||
callback(EVP_sha384(), "SHA384", NULL, arg);
|
||||
callback(EVP_sha512(), "SHA512", NULL, arg);
|
||||
callback(EVP_sha512_256(), "SHA512-256", NULL, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
|
||||
|
||||
callback(EVP_md4(), "md4", nullptr, arg);
|
||||
callback(EVP_md5(), "md5", nullptr, arg);
|
||||
callback(EVP_md4(), "md4", NULL, arg);
|
||||
callback(EVP_md5(), "md5", NULL, arg);
|
||||
@@ -88,6 +89,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
|
||||
callback(EVP_sha384(), "sha384", nullptr, arg);
|
||||
callback(EVP_sha512(), "sha512", nullptr, arg);
|
||||
callback(EVP_sha512_256(), "sha512-256", nullptr, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
|
||||
callback(EVP_sha384(), "sha384", NULL, arg);
|
||||
callback(EVP_sha512(), "sha512", NULL, arg);
|
||||
callback(EVP_sha512_256(), "sha512-256", NULL, arg);
|
||||
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
|
||||
}
|
||||
|
||||
void EVP_MD_do_all(void (*callback)(const EVP_MD *cipher, const char *name,
|
||||
diff --git a/include/openssl/digest.h b/include/openssl/digest.h
|
||||
index a86c18926e7798a3b0aae70c53870e03b5acd0ab..f4f27f9e803533d8db50d89e7a0125384a025a46 100644
|
||||
index 710c6e6d110378d1db10d8c2ae57b2d844c603b9..dbb1e0cd5e9480d1ac7a86cbca6fae29d6a8dca4 100644
|
||||
--- a/include/openssl/digest.h
|
||||
+++ b/include/openssl/digest.h
|
||||
@@ -48,6 +48,9 @@ OPENSSL_EXPORT const EVP_MD *EVP_blake2b256(void);
|
||||
|
||||
@@ -28,7 +28,7 @@ RC2 Ciphers: rc2-40-cbc
|
||||
It's unclear whether this would be accepted upstream. We should try regardless.
|
||||
|
||||
diff --git a/crypto/cipher/get_cipher.cc b/crypto/cipher/get_cipher.cc
|
||||
index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da0229687f 100644
|
||||
index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f825851b634 100644
|
||||
--- a/crypto/cipher/get_cipher.cc
|
||||
+++ b/crypto/cipher/get_cipher.cc
|
||||
@@ -31,6 +31,7 @@ static const struct {
|
||||
@@ -64,64 +64,64 @@ index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da
|
||||
|
||||
const EVP_CIPHER *EVP_get_cipherbynid(int nid) {
|
||||
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
|
||||
index 891a73f229e3f0838cb2fa99b8fb24fdeac1962b..f7d0c5dc66f016eb9338c15e7f5ef59e6de2969d 100644
|
||||
index 8fdf1c624794f568bfc77b7b6b0c510b23905a4d..2e40c031e8c681fe921331b26dbf63f4df2fcf71 100644
|
||||
--- a/decrepit/evp/evp_do_all.cc
|
||||
+++ b/decrepit/evp/evp_do_all.cc
|
||||
@@ -20,8 +20,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
const char *unused, void *arg),
|
||||
void *arg) {
|
||||
callback(EVP_aes_128_cbc(), "AES-128-CBC", nullptr, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", nullptr, arg);
|
||||
callback(EVP_aes_192_cbc(), "AES-192-CBC", nullptr, arg);
|
||||
callback(EVP_aes_256_cbc(), "AES-256-CBC", nullptr, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", nullptr, arg);
|
||||
callback(EVP_aes_128_ctr(), "AES-128-CTR", nullptr, arg);
|
||||
callback(EVP_aes_192_ctr(), "AES-192-CTR", nullptr, arg);
|
||||
callback(EVP_aes_256_ctr(), "AES-256-CTR", nullptr, arg);
|
||||
callback(EVP_aes_128_cbc(), "AES-128-CBC", NULL, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", NULL, arg);
|
||||
callback(EVP_aes_192_cbc(), "AES-192-CBC", NULL, arg);
|
||||
callback(EVP_aes_256_cbc(), "AES-256-CBC", NULL, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", NULL, arg);
|
||||
callback(EVP_aes_128_ctr(), "AES-128-CTR", NULL, arg);
|
||||
callback(EVP_aes_192_ctr(), "AES-192-CTR", NULL, arg);
|
||||
callback(EVP_aes_256_ctr(), "AES-256-CTR", NULL, arg);
|
||||
@@ -34,9 +36,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
callback(EVP_aes_128_gcm(), "AES-128-GCM", nullptr, arg);
|
||||
callback(EVP_aes_192_gcm(), "AES-192-GCM", nullptr, arg);
|
||||
callback(EVP_aes_256_gcm(), "AES-256-GCM", nullptr, arg);
|
||||
+ callback(EVP_bf_cbc(), "BF-CBC", nullptr, arg);
|
||||
+ callback(EVP_bf_cfb(), "BF-CFB", nullptr, arg);
|
||||
+ callback(EVP_bf_ecb(), "BF-ECB", nullptr, arg);
|
||||
callback(EVP_des_cbc(), "DES-CBC", nullptr, arg);
|
||||
callback(EVP_des_ecb(), "DES-ECB", nullptr, arg);
|
||||
callback(EVP_des_ede(), "DES-EDE", nullptr, arg);
|
||||
+ callback(EVP_des_ede3(), "DES-EDE3", nullptr, arg);
|
||||
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", nullptr, arg);
|
||||
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", nullptr, arg);
|
||||
callback(EVP_rc2_cbc(), "RC2-CBC", nullptr, arg);
|
||||
callback(EVP_aes_128_gcm(), "AES-128-GCM", NULL, arg);
|
||||
callback(EVP_aes_192_gcm(), "AES-192-GCM", NULL, arg);
|
||||
callback(EVP_aes_256_gcm(), "AES-256-GCM", NULL, arg);
|
||||
+ callback(EVP_bf_cbc(), "BF-CBC", NULL, arg);
|
||||
+ callback(EVP_bf_cfb(), "BF-CFB", NULL, arg);
|
||||
+ callback(EVP_bf_ecb(), "BF-ECB", NULL, arg);
|
||||
callback(EVP_des_cbc(), "DES-CBC", NULL, arg);
|
||||
callback(EVP_des_ecb(), "DES-ECB", NULL, arg);
|
||||
callback(EVP_des_ede(), "DES-EDE", NULL, arg);
|
||||
+ callback(EVP_des_ede3(), "DES-EDE3", NULL, arg);
|
||||
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", NULL, arg);
|
||||
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", NULL, arg);
|
||||
callback(EVP_rc2_cbc(), "RC2-CBC", NULL, arg);
|
||||
@@ -44,8 +50,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
|
||||
// OpenSSL returns everything twice, the second time in lower case.
|
||||
callback(EVP_aes_128_cbc(), "aes-128-cbc", nullptr, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", nullptr, arg);
|
||||
callback(EVP_aes_192_cbc(), "aes-192-cbc", nullptr, arg);
|
||||
callback(EVP_aes_256_cbc(), "aes-256-cbc", nullptr, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", nullptr, arg);
|
||||
callback(EVP_aes_128_ctr(), "aes-128-ctr", nullptr, arg);
|
||||
callback(EVP_aes_192_ctr(), "aes-192-ctr", nullptr, arg);
|
||||
callback(EVP_aes_256_ctr(), "aes-256-ctr", nullptr, arg);
|
||||
callback(EVP_aes_128_cbc(), "aes-128-cbc", NULL, arg);
|
||||
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", NULL, arg);
|
||||
callback(EVP_aes_192_cbc(), "aes-192-cbc", NULL, arg);
|
||||
callback(EVP_aes_256_cbc(), "aes-256-cbc", NULL, arg);
|
||||
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", NULL, arg);
|
||||
callback(EVP_aes_128_ctr(), "aes-128-ctr", NULL, arg);
|
||||
callback(EVP_aes_192_ctr(), "aes-192-ctr", NULL, arg);
|
||||
callback(EVP_aes_256_ctr(), "aes-256-ctr", NULL, arg);
|
||||
@@ -58,9 +66,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
|
||||
callback(EVP_aes_128_gcm(), "aes-128-gcm", nullptr, arg);
|
||||
callback(EVP_aes_192_gcm(), "aes-192-gcm", nullptr, arg);
|
||||
callback(EVP_aes_256_gcm(), "aes-256-gcm", nullptr, arg);
|
||||
+ callback(EVP_bf_cbc(), "bf-cbc", nullptr, arg);
|
||||
+ callback(EVP_bf_cfb(), "bf-cfb", nullptr, arg);
|
||||
+ callback(EVP_bf_ecb(), "bf-ecb", nullptr, arg);
|
||||
callback(EVP_des_cbc(), "des-cbc", nullptr, arg);
|
||||
callback(EVP_des_ecb(), "des-ecb", nullptr, arg);
|
||||
callback(EVP_des_ede(), "des-ede", nullptr, arg);
|
||||
+ callback(EVP_des_ede3(), "des-ede3", nullptr, arg);
|
||||
callback(EVP_des_ede_cbc(), "des-ede-cbc", nullptr, arg);
|
||||
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", nullptr, arg);
|
||||
callback(EVP_rc2_cbc(), "rc2-cbc", nullptr, arg);
|
||||
callback(EVP_aes_128_gcm(), "aes-128-gcm", NULL, arg);
|
||||
callback(EVP_aes_192_gcm(), "aes-192-gcm", NULL, arg);
|
||||
callback(EVP_aes_256_gcm(), "aes-256-gcm", NULL, arg);
|
||||
+ callback(EVP_bf_cbc(), "bf-cbc", NULL, arg);
|
||||
+ callback(EVP_bf_cfb(), "bf-cfb", NULL, arg);
|
||||
+ callback(EVP_bf_ecb(), "bf-ecb", NULL, arg);
|
||||
callback(EVP_des_cbc(), "des-cbc", NULL, arg);
|
||||
callback(EVP_des_ecb(), "des-ecb", NULL, arg);
|
||||
callback(EVP_des_ede(), "des-ede", NULL, arg);
|
||||
+ callback(EVP_des_ede3(), "des-ede3", NULL, arg);
|
||||
callback(EVP_des_ede_cbc(), "des-ede-cbc", NULL, arg);
|
||||
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", NULL, arg);
|
||||
callback(EVP_rc2_cbc(), "rc2-cbc", NULL, arg);
|
||||
diff --git a/include/openssl/cipher.h b/include/openssl/cipher.h
|
||||
index a5533caf45eaacc4baef4a73d97e9bc2b6e3a942..35f24c1b22ea2c6b4766c0d87e75b6fc6b459f79 100644
|
||||
index 13e68ad20ac08a462bb577d7f99e2c6f167579fa..4960d0eeb8f31bec4347ed2a1b63beba530de700 100644
|
||||
--- a/include/openssl/cipher.h
|
||||
+++ b/include/openssl/cipher.h
|
||||
@@ -461,6 +461,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
|
||||
@@ -448,6 +448,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
|
||||
|
||||
// EVP_aes_128_cfb128 is only available in decrepit.
|
||||
OPENSSL_EXPORT const EVP_CIPHER *EVP_aes_128_cfb128(void);
|
||||
|
||||
@@ -8,7 +8,7 @@ This reverts commit ebd8b8965c74ab06bb91f7a00b23822e1f1f26ca.
|
||||
It is causing significant TLS failures in Node.js.
|
||||
|
||||
diff --git a/ssl/ssl_buffer.cc b/ssl/ssl_buffer.cc
|
||||
index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad1655500d33 100644
|
||||
index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a02124b80f9ef 100644
|
||||
--- a/ssl/ssl_buffer.cc
|
||||
+++ b/ssl/ssl_buffer.cc
|
||||
@@ -230,7 +230,6 @@ int ssl_handle_open_record(SSL *ssl, bool *out_retry, ssl_open_record_t ret,
|
||||
@@ -20,10 +20,10 @@ index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad16
|
||||
|
||||
case ssl_open_record_error:
|
||||
diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
|
||||
index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e517ea6ae2 100644
|
||||
index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f8431434e42 100644
|
||||
--- a/ssl/ssl_lib.cc
|
||||
+++ b/ssl/ssl_lib.cc
|
||||
@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
|
||||
@@ -1206,7 +1206,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
|
||||
}
|
||||
|
||||
if (ret_code == 0) {
|
||||
@@ -32,7 +32,7 @@ index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e5
|
||||
return SSL_ERROR_ZERO_RETURN;
|
||||
}
|
||||
// An EOF was observed which violates the protocol, and the underlying
|
||||
@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
|
||||
@@ -2567,13 +2567,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
|
||||
return CRYPTO_get_ex_data(&ctx->ex_data, idx);
|
||||
}
|
||||
|
||||
|
||||
@@ -110,6 +110,7 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
|
||||
fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
|
||||
refactor_expose_file_system_access_blocklist.patch
|
||||
feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
|
||||
fix_font_face_resolution_when_renderer_is_blocked.patch
|
||||
feat_enable_passing_exit_code_on_service_process_crash.patch
|
||||
chore_remove_reference_to_chrome_browser_themes.patch
|
||||
feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
|
||||
@@ -131,16 +132,12 @@ chore_grandfather_in_electron_views_and_delegates.patch
|
||||
refactor_patch_electron_permissiontypes_into_blink.patch
|
||||
revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
|
||||
build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
|
||||
build_set_mac_sdk_minimum_to_10.patch
|
||||
fix_add_macos_memory_query_fallback_to_avoid_crash.patch
|
||||
fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
|
||||
feat_add_support_for_embedder_snapshot_validation.patch
|
||||
chore_restore_some_deprecated_wrapper_utility_in_gin.patch
|
||||
chore_add_electron_objects_to_wrappablepointertag.patch
|
||||
chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
|
||||
revert_partial_remove_unused_prehandlemouseevent.patch
|
||||
allow_electron_to_depend_on_components_os_crypt_sync.patch
|
||||
band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch
|
||||
inspectorpageagent_provisional_frame_speculative_fix.patch
|
||||
expose_referrerscriptinfo_hostdefinedoptionsindex.patch
|
||||
chore_disable_protocol_handler_dcheck.patch
|
||||
fix_check_for_file_existence_before_setting_mtime.patch
|
||||
revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch
|
||||
fix_linux_tray_id.patch
|
||||
fix_release_mouse_buttons_on_focus_loss_on_wayland.patch
|
||||
cherry-pick-e045399a1ecb.patch
|
||||
|
||||
@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
|
||||
}
|
||||
|
||||
diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
|
||||
index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
|
||||
index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
|
||||
--- a/ui/base/accelerators/accelerator.h
|
||||
+++ b/ui/base/accelerators/accelerator.h
|
||||
@@ -21,6 +21,7 @@
|
||||
@@ -18,6 +18,7 @@
|
||||
#include <vector>
|
||||
|
||||
#include "base/component_export.h"
|
||||
+#include "third_party/abseil-cpp/absl/types/optional.h"
|
||||
#include "base/time/time.h"
|
||||
#include "build/blink_buildflags.h"
|
||||
#include "build/build_config.h"
|
||||
+#include "third_party/abseil-cpp/absl/types/optional.h"
|
||||
#include "ui/events/event_constants.h"
|
||||
#include "ui/events/keycodes/keyboard_codes.h"
|
||||
|
||||
@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
|
||||
<< 18); // masked to 6 bits
|
||||
@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
|
||||
return interrupted_by_mouse_event_;
|
||||
}
|
||||
|
||||
+ absl::optional<char16_t> shifted_char;
|
||||
|
||||
@@ -10,10 +10,10 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
|
||||
This should be upstreamed.
|
||||
|
||||
diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
|
||||
index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
|
||||
index f9e15ddeeb022b77607ae7880a5a7121abc7a111..954a4966c73a74816131217756f17c04483bb1fe 100644
|
||||
--- a/content/gpu/gpu_main.cc
|
||||
+++ b/content/gpu/gpu_main.cc
|
||||
@@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
@@ -271,6 +271,10 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
// to the GpuProcessHost once the GpuServiceImpl has started.
|
||||
viz::GpuLogMessageManager::GetInstance()->InstallPreInitializeLogHandler();
|
||||
|
||||
@@ -24,7 +24,7 @@ index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f
|
||||
// We are experiencing what appear to be memory-stomp issues in the GPU
|
||||
// process. These issues seem to be impacting the task executor and listeners
|
||||
// registered to it. Create the task executor on the heap to guard against
|
||||
@@ -381,7 +385,6 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
@@ -380,7 +384,6 @@ int GpuMain(MainFunctionParams parameters) {
|
||||
#endif
|
||||
const bool dead_on_arrival = !init_success;
|
||||
|
||||
|
||||
@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
|
||||
context, which can cause some preload scripts to trip.
|
||||
|
||||
diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
|
||||
index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
|
||||
index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e90be3d39b 100644
|
||||
--- a/content/public/renderer/render_frame_observer.h
|
||||
+++ b/content/public/renderer/render_frame_observer.h
|
||||
@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
|
||||
@@ -138,6 +138,8 @@ class CONTENT_EXPORT RenderFrameObserver {
|
||||
virtual void DidHandleOnloadEvents() {}
|
||||
virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
int32_t world_id) {}
|
||||
@@ -23,10 +23,10 @@ index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b
|
||||
int32_t world_id) {}
|
||||
virtual void DidClearWindowObject() {}
|
||||
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
|
||||
index 30c2972e1fbc21d382304897c542ecd7fa95b896..3f512dcaec9f1d8a1375277ab8c6649d69070a33 100644
|
||||
index ede4414f875254b77ffb29d0e1bfb254c619b10f..5f766b7d1bd20131b380e862090716de899d086c 100644
|
||||
--- a/content/renderer/render_frame_impl.cc
|
||||
+++ b/content/renderer/render_frame_impl.cc
|
||||
@@ -4665,6 +4665,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
@@ -4676,6 +4676,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
observer.DidCreateScriptContext(context, world_id);
|
||||
}
|
||||
|
||||
@@ -40,10 +40,10 @@ index 30c2972e1fbc21d382304897c542ecd7fa95b896..3f512dcaec9f1d8a1375277ab8c6649d
|
||||
int world_id) {
|
||||
for (auto& observer : observers_)
|
||||
diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
|
||||
index c3c45d6a953d7c068c0d6c8bfb6855cd4403aa6d..b3fd71b237c134853f796a1d8d803e4d28519d53 100644
|
||||
index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa56dbfa2dc 100644
|
||||
--- a/content/renderer/render_frame_impl.h
|
||||
+++ b/content/renderer/render_frame_impl.h
|
||||
@@ -602,6 +602,8 @@ class CONTENT_EXPORT RenderFrameImpl
|
||||
@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
|
||||
void DidObserveLayoutShift(double score, bool after_input_or_scroll) override;
|
||||
void DidCreateScriptContext(v8::Local<v8::Context> context,
|
||||
int world_id) override;
|
||||
@@ -53,10 +53,10 @@ index c3c45d6a953d7c068c0d6c8bfb6855cd4403aa6d..b3fd71b237c134853f796a1d8d803e4d
|
||||
int world_id) override;
|
||||
void DidChangeScrollOffset() override;
|
||||
diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
|
||||
index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
|
||||
index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00bf366e92d 100644
|
||||
--- a/third_party/blink/public/web/web_local_frame_client.h
|
||||
+++ b/third_party/blink/public/web/web_local_frame_client.h
|
||||
@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
|
||||
@@ -662,6 +662,9 @@ class BLINK_EXPORT WebLocalFrameClient {
|
||||
virtual void DidCreateScriptContext(v8::Local<v8::Context>,
|
||||
int32_t world_id) {}
|
||||
|
||||
@@ -67,10 +67,10 @@ index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb3
|
||||
virtual void WillReleaseScriptContext(v8::Local<v8::Context>,
|
||||
int32_t world_id) {}
|
||||
diff --git a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
|
||||
index 3ce1ef340780075951fb8c1b65f2ec90569f34ef..898d7caac98727210ac5780b576526a71ec5a5aa 100644
|
||||
index b963abd8c4bf6ffaea1930a8d1f647a8a8c266bc..2e8653654686f4fc775288f059ff27daa38e02d5 100644
|
||||
--- a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
|
||||
+++ b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
|
||||
@@ -217,6 +217,7 @@ void LocalWindowProxy::Initialize() {
|
||||
@@ -216,6 +216,7 @@ void LocalWindowProxy::Initialize() {
|
||||
}
|
||||
|
||||
InstallConditionalFeatures();
|
||||
@@ -92,11 +92,11 @@ index 36baf908d3be8aed44ff60b8de2cffe2eee15efe..8d73ddb12013ce195026b9f63050cf33
|
||||
int32_t world_id) = 0;
|
||||
virtual bool AllowScriptExtensions() = 0;
|
||||
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
|
||||
index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9ae8d3379f 100644
|
||||
index 22f1a4a3a903cb82a1066642e542bb78bf321d79..77d76bf97976e18a8bd077e005b8a3addf9b029d 100644
|
||||
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
|
||||
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
|
||||
@@ -300,6 +300,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
|
||||
}
|
||||
@@ -295,6 +295,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
|
||||
web_frame_->Client()->DidCreateScriptContext(context, world_id);
|
||||
}
|
||||
|
||||
+void LocalFrameClientImpl::DidInstallConditionalFeatures(
|
||||
@@ -110,7 +110,7 @@ index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9a
|
||||
v8::Local<v8::Context> context,
|
||||
int32_t world_id) {
|
||||
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.h b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
|
||||
index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e5844349c0b5 100644
|
||||
index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf30267fddf7c4 100644
|
||||
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.h
|
||||
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
|
||||
@@ -81,6 +81,8 @@ class CORE_EXPORT LocalFrameClientImpl final : public LocalFrameClient {
|
||||
@@ -123,10 +123,10 @@ index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e584
|
||||
int32_t world_id) override;
|
||||
|
||||
diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
|
||||
index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
|
||||
index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
|
||||
--- a/third_party/blink/renderer/core/loader/empty_clients.h
|
||||
+++ b/third_party/blink/renderer/core/loader/empty_clients.h
|
||||
@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
|
||||
@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
|
||||
|
||||
void DidCreateScriptContext(v8::Local<v8::Context>,
|
||||
int32_t world_id) override {}
|
||||
|
||||
@@ -7,12 +7,12 @@ Ensure that licenses for the dependencies introduced by Electron
|
||||
are included in `LICENSES.chromium.html`
|
||||
|
||||
diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
|
||||
index 514be069768cc1bbd39f2b261cefb1a9f267f89f..0a1ab64914cfaa087e4000fb81bfafd18aa1b98b 100755
|
||||
index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
|
||||
--- a/tools/licenses/licenses.py
|
||||
+++ b/tools/licenses/licenses.py
|
||||
@@ -357,6 +357,31 @@ SPECIAL_CASES = {
|
||||
@@ -337,6 +337,31 @@ SPECIAL_CASES = {
|
||||
"License": "Apache 2.0",
|
||||
"License File": ["//third_party/sample3/the_license"],
|
||||
"License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
|
||||
},
|
||||
+ os.path.join('third_party', 'electron_node'): {
|
||||
+ "Name": "Node.js",
|
||||
|
||||
@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
|
||||
https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
|
||||
|
||||
diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
|
||||
index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
|
||||
index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
|
||||
--- a/ui/base/clipboard/scoped_clipboard_writer.cc
|
||||
+++ b/ui/base/clipboard/scoped_clipboard_writer.cc
|
||||
@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
|
||||
@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
|
||||
}
|
||||
}
|
||||
|
||||
@@ -29,10 +29,10 @@ index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0
|
||||
objects_.clear();
|
||||
raw_objects_.clear();
|
||||
diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
|
||||
index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
|
||||
index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
|
||||
--- a/ui/base/clipboard/scoped_clipboard_writer.h
|
||||
+++ b/ui/base/clipboard/scoped_clipboard_writer.h
|
||||
@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
|
||||
@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
|
||||
// This is only used to write custom format data.
|
||||
void WriteData(std::u16string_view format, mojo_base::BigBuffer data);
|
||||
|
||||
|
||||
@@ -8,7 +8,7 @@ accessing Blink internals. Its inverse, which already exists, is used in
|
||||
Android WebView.
|
||||
|
||||
diff --git a/third_party/blink/public/web/web_message_port_converter.h b/third_party/blink/public/web/web_message_port_converter.h
|
||||
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211a29548aa 100644
|
||||
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e7521cb71b8 100644
|
||||
--- a/third_party/blink/public/web/web_message_port_converter.h
|
||||
+++ b/third_party/blink/public/web/web_message_port_converter.h
|
||||
@@ -13,6 +13,7 @@
|
||||
@@ -19,20 +19,18 @@ index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211
|
||||
} // namespace v8
|
||||
|
||||
namespace blink {
|
||||
@@ -25,6 +26,11 @@ class BLINK_EXPORT WebMessagePortConverter {
|
||||
@@ -25,6 +26,9 @@ class BLINK_EXPORT WebMessagePortConverter {
|
||||
// neutered, it will return nullopt.
|
||||
static std::optional<MessagePortChannel>
|
||||
DisentangleAndExtractMessagePortChannel(v8::Isolate*, v8::Local<v8::Value>);
|
||||
+
|
||||
+ BLINK_EXPORT static v8::Local<v8::Value>
|
||||
+ EntangleAndInjectMessagePortChannel(v8::Isolate*,
|
||||
+ v8::Local<v8::Context>,
|
||||
+ MessagePortChannel);
|
||||
+ EntangleAndInjectMessagePortChannel(v8::Local<v8::Context>, MessagePortChannel);
|
||||
};
|
||||
|
||||
} // namespace blink
|
||||
diff --git a/third_party/blink/renderer/core/exported/web_message_port_converter.cc b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
|
||||
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d84213eba 100644
|
||||
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef732225d6 100644
|
||||
--- a/third_party/blink/renderer/core/exported/web_message_port_converter.cc
|
||||
+++ b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
|
||||
@@ -6,6 +6,7 @@
|
||||
@@ -43,20 +41,19 @@ index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d
|
||||
#include "third_party/blink/renderer/bindings/core/v8/v8_message_port.h"
|
||||
#include "third_party/blink/renderer/core/messaging/message_port.h"
|
||||
|
||||
@@ -21,4 +22,16 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
|
||||
@@ -21,4 +22,15 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
|
||||
return port->Disentangle();
|
||||
}
|
||||
|
||||
+v8::Local<v8::Value>
|
||||
+WebMessagePortConverter::EntangleAndInjectMessagePortChannel(
|
||||
+ v8::Isolate* isolate,
|
||||
+ v8::Local<v8::Context> context,
|
||||
+ MessagePortChannel port_channel) {
|
||||
+ auto* execution_context = ToExecutionContext(context);
|
||||
+ CHECK(execution_context);
|
||||
+ auto* port = MakeGarbageCollected<MessagePort>(*execution_context);
|
||||
+ port->Entangle(std::move(port_channel));
|
||||
+ return port->ToV8(isolate, context->Global());
|
||||
+ return port->ToV8(context->GetIsolate(), context->Global());
|
||||
+}
|
||||
+
|
||||
} // namespace blink
|
||||
|
||||
@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
|
||||
WindowList.
|
||||
|
||||
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
|
||||
index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3b33c3777 100644
|
||||
index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aabbba621cb 100644
|
||||
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
|
||||
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
|
||||
@@ -48,6 +48,7 @@
|
||||
@@ -19,18 +19,18 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
#include "content/public/browser/web_ui_data_source.h"
|
||||
+#include "electron/shell/browser/electron_browser_context.h"
|
||||
#include "ui/accessibility/accessibility_features.h"
|
||||
#include "ui/accessibility/ax_mode.h"
|
||||
#include "ui/accessibility/ax_updates_and_events.h"
|
||||
@@ -179,7 +180,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
|
||||
#include "ui/accessibility/platform/ax_platform.h"
|
||||
@@ -173,7 +174,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
|
||||
rvh->GetRoutingID(), accessibility_mode);
|
||||
}
|
||||
|
||||
-#if !BUILDFLAG(IS_ANDROID)
|
||||
+#if 0
|
||||
base::Value::Dict BuildTargetDescriptor(BrowserWindowInterface* browser) {
|
||||
base::Value::Dict BuildTargetDescriptor(Browser* browser) {
|
||||
base::Value::Dict target_data;
|
||||
target_data.Set(kSessionIdField, browser->GetSessionID().id());
|
||||
@@ -226,7 +227,7 @@ void HandleAccessibilityRequestCallback(
|
||||
target_data.Set(kSessionIdField, browser->session_id().id());
|
||||
@@ -197,7 +198,7 @@ void HandleAccessibilityRequestCallback(
|
||||
auto& browser_accessibility_state =
|
||||
*content::BrowserAccessibilityState::GetInstance();
|
||||
base::Value::Dict data;
|
||||
@@ -39,7 +39,7 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
ui::AXMode mode = browser_accessibility_state.GetAccessibilityMode();
|
||||
bool native = mode.has_mode(ui::AXMode::kNativeAPIs);
|
||||
bool web = mode.has_mode(ui::AXMode::kWebContents);
|
||||
@@ -287,7 +288,7 @@ void HandleAccessibilityRequestCallback(
|
||||
@@ -258,7 +259,7 @@ void HandleAccessibilityRequestCallback(
|
||||
data.Set(kIsScreenReaderActive, is_screen_reader_active);
|
||||
|
||||
std::string pref_api_type =
|
||||
@@ -48,23 +48,21 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
bool pref_api_type_supported = false;
|
||||
|
||||
std::vector<ui::AXApiType::Type> supported_api_types =
|
||||
@@ -355,13 +356,13 @@ void HandleAccessibilityRequestCallback(
|
||||
@@ -326,11 +327,11 @@ void HandleAccessibilityRequestCallback(
|
||||
data.Set(kPagesField, std::move(page_list));
|
||||
|
||||
base::Value::List browser_list;
|
||||
-#if !BUILDFLAG(IS_ANDROID)
|
||||
+#if 0
|
||||
ForEachCurrentBrowserWindowInterfaceOrderedByActivation(
|
||||
[&browser_list](BrowserWindowInterface* browser) {
|
||||
browser_list.Append(BuildTargetDescriptor(browser));
|
||||
return true;
|
||||
});
|
||||
for (Browser* browser : *BrowserList::GetInstance()) {
|
||||
browser_list.Append(BuildTargetDescriptor(browser));
|
||||
}
|
||||
-#endif // !BUILDFLAG(IS_ANDROID)
|
||||
+#endif
|
||||
data.Set(kBrowsersField, std::move(browser_list));
|
||||
|
||||
#if BUILDFLAG(IS_WIN)
|
||||
@@ -848,7 +849,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
|
||||
std::string json_string;
|
||||
@@ -804,7 +805,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
|
||||
const std::string value = CheckJSValue(data.FindString(kValueField));
|
||||
|
||||
if (string_name == kApiTypeField) {
|
||||
@@ -74,7 +72,7 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
pref->SetString(prefs::kShownAccessibilityApiType, value);
|
||||
}
|
||||
}
|
||||
@@ -902,7 +904,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
|
||||
@@ -858,7 +860,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
|
||||
AXPropertyFilter::ALLOW_EMPTY);
|
||||
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
|
||||
|
||||
@@ -84,25 +82,23 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
ui::AXApiType::Type api_type =
|
||||
ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
|
||||
std::string accessibility_contents =
|
||||
@@ -922,7 +925,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
@@ -885,6 +888,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
AXPropertyFilter::ALLOW_EMPTY);
|
||||
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
|
||||
|
||||
AllowJavascript();
|
||||
|
||||
-#if !BUILDFLAG(IS_ANDROID)
|
||||
+#if 0
|
||||
std::vector<AXPropertyFilter> property_filters;
|
||||
AddPropertyFilters(property_filters, allow, AXPropertyFilter::ALLOW);
|
||||
AddPropertyFilters(property_filters, allow_empty,
|
||||
@@ -949,7 +952,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
if (found) {
|
||||
return;
|
||||
for (Browser* browser : *BrowserList::GetInstance()) {
|
||||
if (browser->session_id().id() == session_id) {
|
||||
base::Value::Dict result = BuildTargetDescriptor(browser);
|
||||
@@ -897,6 +901,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
|
||||
return;
|
||||
}
|
||||
}
|
||||
-#endif // !BUILDFLAG(IS_ANDROID)
|
||||
+#endif
|
||||
#endif // !BUILDFLAG(IS_ANDROID)
|
||||
// No browser with the specified |session_id| was found.
|
||||
base::Value::Dict result;
|
||||
result.Set(kSessionIdField, session_id);
|
||||
@@ -992,11 +995,13 @@ void AccessibilityUIMessageHandler::StopRecording(
|
||||
@@ -940,11 +945,13 @@ void AccessibilityUIMessageHandler::StopRecording(
|
||||
}
|
||||
|
||||
ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
|
||||
@@ -119,7 +115,7 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
// Check to see if it is in the supported types list.
|
||||
if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
|
||||
supported_types.end()) {
|
||||
@@ -1066,10 +1071,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
|
||||
@@ -1014,8 +1021,11 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
|
||||
// static
|
||||
void AccessibilityUIMessageHandler::RegisterProfilePrefs(
|
||||
user_prefs::PrefRegistrySyncable* registry) {
|
||||
@@ -131,13 +127,11 @@ index 3a9f87d82212bfeab23b312a593fb855df344780..83b4a7fe7149f2b195e53fcb05f77da3
|
||||
+ registry->RegisterBooleanPref(prefs::kShowInternalAccessibilityTree, false);
|
||||
+#endif
|
||||
}
|
||||
|
||||
void AccessibilityUIMessageHandler::OnVisibilityChanged(
|
||||
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.h b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
|
||||
index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83c1d1fa0a 100644
|
||||
index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7f1648148 100644
|
||||
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.h
|
||||
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
|
||||
@@ -28,6 +28,8 @@ namespace content {
|
||||
@@ -27,6 +27,8 @@ namespace content {
|
||||
class WebContents;
|
||||
} // namespace content
|
||||
|
||||
@@ -146,7 +140,7 @@ index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83
|
||||
namespace user_prefs {
|
||||
class PrefRegistrySyncable;
|
||||
} // namespace user_prefs
|
||||
@@ -79,6 +81,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler,
|
||||
@@ -77,6 +79,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler {
|
||||
static void RegisterProfilePrefs(user_prefs::PrefRegistrySyncable* registry);
|
||||
|
||||
private:
|
||||
|
||||
@@ -6,11 +6,11 @@ Subject: allow disabling blink scheduler throttling per RenderView
|
||||
This allows us to disable throttling for hidden windows.
|
||||
|
||||
diff --git a/content/browser/renderer_host/navigation_controller_impl_unittest.cc b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
|
||||
index 5765fe8264ecf117d68cdc2c95517f2fcc22715f..37a734f120427571cf5f4f7b6b6eabb881ba59cb 100644
|
||||
index d321fe74be7af24d1246224d7a28c9dede3635b2..af2cb60c42863b1fdad487c28d544b7a7dade805 100644
|
||||
--- a/content/browser/renderer_host/navigation_controller_impl_unittest.cc
|
||||
+++ b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
|
||||
@@ -168,6 +168,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
|
||||
(bool supports_draggable_regions),
|
||||
@@ -167,6 +167,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
|
||||
(network::mojom::AttributionSupport support),
|
||||
(override));
|
||||
|
||||
+ MOCK_METHOD(
|
||||
@@ -23,10 +23,10 @@ index 5765fe8264ecf117d68cdc2c95517f2fcc22715f..37a734f120427571cf5f4f7b6b6eabb8
|
||||
return receiver_.BindNewEndpointAndPassDedicatedRemote();
|
||||
}
|
||||
diff --git a/content/browser/renderer_host/render_view_host_impl.cc b/content/browser/renderer_host/render_view_host_impl.cc
|
||||
index 357dc106e4c53122e87ea09a780f7976ad37f25e..5209b85dc285f5e177377bd06e36b8b175581cbb 100644
|
||||
index 87c448c04f8f164f7b2dca6f21a8ea9cc26db163..e88cfee7ad8495e7733c85efc8d21ad2aef26db0 100644
|
||||
--- a/content/browser/renderer_host/render_view_host_impl.cc
|
||||
+++ b/content/browser/renderer_host/render_view_host_impl.cc
|
||||
@@ -767,6 +767,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
|
||||
@@ -773,6 +773,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
|
||||
GetWidget()->GetAssociatedFrameWidget()->SetBackgroundOpaque(opaque);
|
||||
}
|
||||
|
||||
@@ -51,25 +51,25 @@ index 7944fe64e0da112fc670358b75506bb199bb5e4a..0e3c16c6af2a078943e9f39808134ab2
|
||||
void SendRendererPreferencesToRenderer(
|
||||
const blink::RendererPreferences& preferences);
|
||||
diff --git a/content/browser/renderer_host/render_widget_host_view_aura.cc b/content/browser/renderer_host/render_widget_host_view_aura.cc
|
||||
index 84899b5208f036bd58ba51513820404b6c5a24b9..87fd5aa4fab7ddd0b444a3c8473ae35066c87054 100644
|
||||
index b14f5bc3f023c512a066ce9ec9f681c96b1fafc4..b930145db575eb8c4e84297ddd610bd90fb5d3a8 100644
|
||||
--- a/content/browser/renderer_host/render_widget_host_view_aura.cc
|
||||
+++ b/content/browser/renderer_host/render_widget_host_view_aura.cc
|
||||
@@ -632,8 +632,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
|
||||
@@ -580,8 +580,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
|
||||
// OnShowWithPageVisibility will not call NotifyHostAndDelegateOnWasShown,
|
||||
// which updates `visibility_`, unless the host is hidden. Make sure no update
|
||||
// is needed.
|
||||
- CHECK(host_->IsHidden() || visibility_ == Visibility::VISIBLE);
|
||||
- CHECK(host_->is_hidden() || visibility_ == Visibility::VISIBLE);
|
||||
- OnShowWithPageVisibility(page_visibility);
|
||||
+ if (host_->IsHidden() || visibility_ == Visibility::VISIBLE)
|
||||
+ if (host_->is_hidden() || visibility_ == Visibility::VISIBLE)
|
||||
+ OnShowWithPageVisibility(page_visibility);
|
||||
}
|
||||
|
||||
void RenderWidgetHostViewAura::EnsurePlatformVisibility(
|
||||
diff --git a/content/public/browser/render_view_host.h b/content/public/browser/render_view_host.h
|
||||
index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060f0a640b1 100644
|
||||
index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb19389b72203b 100644
|
||||
--- a/content/public/browser/render_view_host.h
|
||||
+++ b/content/public/browser/render_view_host.h
|
||||
@@ -73,6 +73,9 @@ class CONTENT_EXPORT RenderViewHost {
|
||||
@@ -75,6 +75,9 @@ class CONTENT_EXPORT RenderViewHost {
|
||||
virtual void WriteIntoTrace(
|
||||
perfetto::TracedProto<TraceProto> context) const = 0;
|
||||
|
||||
@@ -80,34 +80,34 @@ index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060
|
||||
// This interface should only be implemented inside content.
|
||||
friend class RenderViewHostImpl;
|
||||
diff --git a/content/test/test_page_broadcast.h b/content/test/test_page_broadcast.h
|
||||
index 4c8d44cdb2fde8e174b78aee7defb980651da18e..f8bf421b5b32af4cd197cbf23f4bd281c3a12514 100644
|
||||
index 3f4fdfcdf2f701a394e182bd61baf226338ef7f8..f2faa1225e8ca6abb190e6f7a0775545fa3f785d 100644
|
||||
--- a/content/test/test_page_broadcast.h
|
||||
+++ b/content/test/test_page_broadcast.h
|
||||
@@ -52,6 +52,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
|
||||
@@ -51,6 +51,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
|
||||
network::mojom::AttributionSupport support) override;
|
||||
void UpdateColorProviders(
|
||||
const blink::ColorProviderColorMaps& color_provider_colors) override;
|
||||
void SetSupportsDraggableRegions(bool supports_draggable_regions) override;
|
||||
+ void SetSchedulerThrottling(bool allowed) override {}
|
||||
|
||||
mojo::AssociatedReceiver<blink::mojom::PageBroadcast> receiver_;
|
||||
};
|
||||
diff --git a/third_party/blink/public/mojom/page/page.mojom b/third_party/blink/public/mojom/page/page.mojom
|
||||
index b00bc8a8a5044fbf46f627f9db56cea7f09d7ef6..114c3a4522d11c1348f681af500c487ccd97eea9 100644
|
||||
index b6a4e3609af1f090f1f845d77fa0589e5b178d8a..989b2cf76ce88614b57e75ce2fcace101225f43e 100644
|
||||
--- a/third_party/blink/public/mojom/page/page.mojom
|
||||
+++ b/third_party/blink/public/mojom/page/page.mojom
|
||||
@@ -180,4 +180,7 @@ interface PageBroadcast {
|
||||
// Indicates that the page's main frame should collect draggable regions set
|
||||
// using the app-region CSS property.
|
||||
SetSupportsDraggableRegions(bool supports_draggable_regions);
|
||||
@@ -175,4 +175,7 @@ interface PageBroadcast {
|
||||
// 2. The ColorProvider associated with the WebContents changes as a result
|
||||
// of theme changes.
|
||||
UpdateColorProviders(ColorProviderColorMaps color_provider_colors);
|
||||
+
|
||||
+ // Whether to enable the Renderer scheduler background throttling.
|
||||
+ SetSchedulerThrottling(bool allowed);
|
||||
};
|
||||
diff --git a/third_party/blink/public/web/web_view.h b/third_party/blink/public/web/web_view.h
|
||||
index 7f995dc1fab7a1b5319f6fe9bb4d37b3851dbf87..58c93c5acf9f63eb3391fafe2904b20284381a85 100644
|
||||
index c8d27cfee8ef3fe244291f4667b59df1037c359b..92ed53a689991ec8eca9572bf2f7a212acfc4a38 100644
|
||||
--- a/third_party/blink/public/web/web_view.h
|
||||
+++ b/third_party/blink/public/web/web_view.h
|
||||
@@ -361,6 +361,7 @@ class BLINK_EXPORT WebView {
|
||||
@@ -360,6 +360,7 @@ class BLINK_EXPORT WebView {
|
||||
// Scheduling -----------------------------------------------------------
|
||||
|
||||
virtual PageScheduler* Scheduler() const = 0;
|
||||
@@ -116,10 +116,10 @@ index 7f995dc1fab7a1b5319f6fe9bb4d37b3851dbf87..58c93c5acf9f63eb3391fafe2904b202
|
||||
// Visibility -----------------------------------------------------------
|
||||
|
||||
diff --git a/third_party/blink/renderer/core/exported/web_view_impl.cc b/third_party/blink/renderer/core/exported/web_view_impl.cc
|
||||
index 2bb50e492558f0130918717605bf48b8a61f1e14..b50e4805af36aa96c0ce69359adcf1b18d80c62a 100644
|
||||
index b0a8c14c845a69c72ab823af1eccad22b27f1ad6..6ba55d345d4b18c9c76e26a8a1eb3835dd692581 100644
|
||||
--- a/third_party/blink/renderer/core/exported/web_view_impl.cc
|
||||
+++ b/third_party/blink/renderer/core/exported/web_view_impl.cc
|
||||
@@ -2499,6 +2499,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
|
||||
@@ -2485,6 +2485,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
|
||||
TRACE_EVENT2("navigation", "WebViewImpl::SetPageLifecycleStateInternal",
|
||||
"old_state", old_state, "new_state", new_state);
|
||||
|
||||
@@ -130,7 +130,7 @@ index 2bb50e492558f0130918717605bf48b8a61f1e14..b50e4805af36aa96c0ce69359adcf1b1
|
||||
bool storing_in_bfcache = new_state->is_in_back_forward_cache &&
|
||||
!old_state->is_in_back_forward_cache;
|
||||
bool restoring_from_bfcache = !new_state->is_in_back_forward_cache &&
|
||||
@@ -4007,10 +4011,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
|
||||
@@ -3986,10 +3990,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
|
||||
return GetPage()->GetPageScheduler();
|
||||
}
|
||||
|
||||
@@ -155,10 +155,10 @@ index 2bb50e492558f0130918717605bf48b8a61f1e14..b50e4805af36aa96c0ce69359adcf1b1
|
||||
// Do not throttle if the page should be painting.
|
||||
bool is_visible =
|
||||
diff --git a/third_party/blink/renderer/core/exported/web_view_impl.h b/third_party/blink/renderer/core/exported/web_view_impl.h
|
||||
index 881e561c0b4c55e30f6b4f69bcbbe092cc449fd1..9afced261ae85244f99dac4372fb7b1c3eabfbaa 100644
|
||||
index 5c8a5d7f9b675a460740643fc26d778a08ef7112..2ebae3e0a5b76eb9551d286af1ed64e1e58b9de4 100644
|
||||
--- a/third_party/blink/renderer/core/exported/web_view_impl.h
|
||||
+++ b/third_party/blink/renderer/core/exported/web_view_impl.h
|
||||
@@ -447,6 +447,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
|
||||
@@ -445,6 +445,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
|
||||
LocalDOMWindow* PagePopupWindow() const;
|
||||
|
||||
PageScheduler* Scheduler() const override;
|
||||
@@ -166,7 +166,7 @@ index 881e561c0b4c55e30f6b4f69bcbbe092cc449fd1..9afced261ae85244f99dac4372fb7b1c
|
||||
void SetVisibilityState(mojom::blink::PageVisibilityState visibility_state,
|
||||
bool is_initial_state) override;
|
||||
mojom::blink::PageVisibilityState GetVisibilityState() override;
|
||||
@@ -939,6 +940,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
|
||||
@@ -935,6 +936,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
|
||||
// If true, we send IPC messages when |preferred_size_| changes.
|
||||
bool send_preferred_size_changes_ = false;
|
||||
|
||||
|
||||
Some files were not shown because too many files have changed in this diff Show More
Reference in New Issue
Block a user