Compare commits

...

272 Commits

Author SHA1 Message Date
electron-roller[bot]
893faf4f04 chore: bump node in DEPS to v24.14.0 2026-02-25 13:00:31 +00:00
electron-roller[bot]
2d12f059b4 chore: bump chromium to 144.0.7559.225 (40-x-y) (#49928)
chore: bump chromium in DEPS to 144.0.7559.225

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-02-24 11:20:35 -05:00
trop[bot]
f715930d49 docs: fix some string enum typings (#49931)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-24 11:19:28 -05:00
trop[bot]
477fe8566e ci: fix checking latest release for website docs update (#49921)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-23 18:09:51 -08:00
trop[bot]
a9837ed476 fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49915)
fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)

Updated Alt detection to explicitly exclude AltGraph/AltGr

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shashwat Raj <65155843+darthvader58@users.noreply.github.com>
2026-02-23 15:29:25 -08:00
trop[bot]
1f7269f482 fix: apply zoomFactor from setWindowOpenHandler to window.open() windows (#49909)
fix: apply zoomFactor from setWindowOpenHandler to window.open() windows

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-23 11:36:55 +01:00
trop[bot]
2813b89824 fix: prevent GBytes leak in GdkPixbufFromSkBitmap on Linux/GTK (#49898)
Inside gtk_util::GdkPixbufFromSkBitmap, g_bytes_new() was called
inline as an argument to gdk_pixbuf_new_from_bytes(), which per
GTK docs does not take ownership of the GBytes - it adds its own
internal reference. The caller's GBytes* was never stored or
unreffed, leaking 4 x width x height bytes of pixel data on every
call.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: redeemer <marcin.probola@gmail.com>
2026-02-20 16:10:34 -08:00
trop[bot]
a4560db9f0 fix: refresh menu item state on key equivalent dispatch (#49889)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-20 14:58:52 -05:00
trop[bot]
adfc062313 fix: fullscreen restoration on Windows (#49892)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-20 14:29:48 -05:00
trop[bot]
8dc34b4b25 fix: update DBus signal signature for XDG GlobalShortcuts portal (#49870)
* fix: update DBus signal signature for XDG GlobalShortcuts portal

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! fix: update DBus signal signature for XDG GlobalShortcuts portal

chore: fix .patches file

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-19 19:07:56 -06:00
trop[bot]
6cc5ad763d fix: avoid startup crash when V8 sandbox is disabled (#49884)
* fix: avoid startup crash when V8 sandbox is disabled

Co-authored-by: David Franco <davidfrsan@gmail.com>

* chore: update patch

Co-authored-by: David Franco <david@metrica-sports.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Franco <davidfrsan@gmail.com>
Co-authored-by: David Franco <david@metrica-sports.com>
2026-02-19 18:41:30 -06:00
trop[bot]
4c5637c687 ci: log mocha retries in spec runner (#49877)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Nilay Arya <84241885+nilayarya@users.noreply.github.com>
2026-02-19 16:22:21 -06:00
electron-roller[bot]
0d71ed0f29 chore: bump chromium to 144.0.7559.220 (40-x-y) (#49869)
chore: bump chromium in DEPS to 144.0.7559.220

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-02-19 11:27:01 -05:00
trop[bot]
fc63000ee7 refactor: initialize libgdk stubs before use in platform_util:Beep (#49864)
* refactor: initialize libgdk stubs before use in `platform_util:Beep`

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* feat: add upstream function to get libgdk handle

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* fix: add missing include for libgdk support

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: adjust comment wording and make linter happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: make linter actually happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-02-19 14:24:12 +01:00
trop[bot]
8d41dbe65f chore: use relative links from docs/ to files outside of docs/ (#49867)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-19 14:23:34 +01:00
trop[bot]
f3b90cc91c fix: draggable region position with docked DevTools (#49847)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-19 09:55:01 +01:00
trop[bot]
a78a8cd30c ci: fixup build stats upload on Windows (#49849)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-19 09:54:36 +01:00
Sam Maddock
2511f78120 fix: frameless window resize in MAS builds (#49856)
backport: fix: frameless window resize in MAS builds
2026-02-19 14:24:38 +09:00
trop[bot]
f711af1080 docs: note required windows in 'new-window-for-tab' event (#49860)
docs: note required windows in new-window-for-tab

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-18 20:37:10 -08:00
trop[bot]
616026ce1c docs: clarify ASAR integrity is supported in MAS builds (#49853)
* docs: clarify ASAR integrity is supported in MAS builds

Add a note to the ASAR integrity documentation explicitly stating
that this feature is fully supported and recommended in Mac App
Store builds. While MAS-installed apps have system-level protections,
ASAR integrity provides an additional security layer and is important
for MAS builds distributed outside the Mac App Store.

Slack thread: https://electronhq.slack.com/archives/CB6CG54DB/p1771449093872419?thread_ts=1771446183.473289&cid=CB6CG54DB

https://claude.ai/code/session_01A97nfiqHUVxLNaQyHVXS7j

Co-authored-by: Claude <noreply@anthropic.com>

* docs: clarify ASAR integrity support for MAS builds

Updates the ASAR integrity documentation to explicitly mention that
it is supported and recommended in Mac App Store builds. Clarifies
that while MAS-installed apps have system-level protections (Resources
folder owned by root), ASAR integrity is especially important when
distributing MAS builds through other channels like direct download,
since those installations won't have the read-only protections.

https://claude.ai/code/session_012mBNZQW34h91NRcdFaLxNh

Co-authored-by: Claude <noreply@anthropic.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Claude <noreply@anthropic.com>
2026-02-18 22:24:13 +00:00
trop[bot]
ada2c4e072 feat: add focusOnNavigation flag to WebPreferences (#49512)
* feat: add focusOnNavigation webPreference

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* WebContentsView tests

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* fix

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* fix

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kyle Cutler <kycutler@microsoft.com>
2026-02-18 15:51:20 -05:00
trop[bot]
1a76e35971 feat: add support for long-animation-frame script attribution (#49772)
* feat: add support for `long-animation-frame` script attribution

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: document `AlwaysLogLOAFURL`

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: add test

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: adjust docs as per PR comment

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: test failures

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: simplify test

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: tests on Windows and Linux

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: fixup patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-02-18 14:22:00 -05:00
trop[bot]
3d475716f4 feat: improve Windows Toast actions support (#49786)
* feat: improve Windows Toast actions support

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: ensure MSIX compatibility

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: add bad clsid format test

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-18 13:22:10 -05:00
electron-roller[bot]
c7a033dd06 chore: bump chromium to 144.0.7559.177 (40-x-y) (#49800)
* chore: bump chromium in DEPS to 144.0.7559.177

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-18 16:34:57 +01:00
trop[bot]
2ff6e7e042 build: use spawn instead of spawnSync for build (#49826)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 16:22:33 -05:00
Väinö Mäkelä
3302c4dbd8 fix: make pointer lock work on Wayland (#49283)
Chromium used to only implement pointer lock on Wayland in
Chrome-specific code, and this prevented Electron from making use of it.
This has been fixed on chromium main, so backport this as a patch to
Electron.
2026-02-17 15:45:38 -05:00
trop[bot]
76ce7a7ca0 docs: fix typos across tutorial documentation (#49832)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: ron <ronald_eddy@yahoo.com>
2026-02-17 15:04:38 -05:00
trop[bot]
4237bcbc4c chore: add Copilot CLI instructions (#49824)
chore: add copilot-instructions

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 13:26:29 -05:00
trop[bot]
c81c505fea fix: missing shared texture docs (#49810)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-16 22:18:43 -08:00
trop[bot]
638dd2221a build(dev-deps): update micromark-core-commonmark to 2.0.3 (#49761)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-13 15:30:58 -08:00
electron-roller[bot]
8ec629e871 chore: bump node to v24.13.1 (40-x-y) (#49742)
* chore: bump node in DEPS to v24.13.1

* chore: fixup patches

refs:
* https://github.com/nodejs/node/pull/60425
* https://github.com/nodejs/node/pull/61270
* https://github.com/nodejs/node/pull/61044

* fix: generate_config_gypi needs to generate valid JSON

https://github.com/nodejs/node/pull/60794

* doc: align Buffer.concat documentation with behavior

https://github.com/nodejs/node/pull/60405

* src: fix off-thread cert loading in bundled cert mode

https://github.com/nodejs/node/pull/60764

* chore: fixup patch indices

* build: fix extraneous includes

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-13 16:35:43 +01:00
trop[bot]
ba487e914d fix: address upstream Chromium shift to enable CoreAudio Tap API for audio capture used in electron's desktopCapturer (🍏 macOS). (#49741)
* fix: Enable CoreAudio Tap API for Audio Capture (🍏 macOS)

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

* fix: addressed markdown issue which caused pre-commit hook failure

🧑‍🔧 : Ref : https://github.com/electron/electron/pull/49717#issuecomment-3874660013

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

* fix: updated docs to cover `desktopCapturer` nuances with macOS

📝 : PR https://github.com/electron/electron/pull/49717

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bug-Reaper <llama@soundsafari.io>
2026-02-13 16:27:51 +01:00
trop[bot]
4cd269a752 fix: revoke Read access after removing file via FileSystemAccess API (#49746)
Refs https://chromium-review.googlesource.com/6677249

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-13 10:40:22 +01:00
Keeley Hammond
201be32e0f chore: cherry-pick e045399a1ecb from chromium (#49790)
* chore: cherry-pick e045399a1ecb from chromium

* chore: update patch
2026-02-12 18:06:08 -08:00
trop[bot]
11f60f3520 ci: add markdownlint problem matcher (#49764)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-12 10:56:13 -05:00
electron-roller[bot]
530c16aab5 chore: bump chromium to 144.0.7559.173 (40-x-y) (#49766)
chore: bump chromium in DEPS to 144.0.7559.173

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-02-12 10:15:09 -05:00
trop[bot]
e0a61a58ef build: generate artifact attestions for released assets (#49767)
* build: generate artifact attestions for released assets

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* chore: address review feedback

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* build: fixup attestation for release assets (#49732)

* build: fixup attestation for release assets

* Generate artifact attestation for generated artifacts

* set id-token for attestation

* Add artifact-metadata permission for attestation

* add permissions for testing attestations

* Revert "add permissions for testing attestations"

This reverts commit 0284bed175.

* Revert "set id-token for attestation"

This reverts commit 69a1b13a18.

* Revert "Generate artifact attestation for generated artifacts"

This reverts commit ee0536eceb.

* chore: update publish workflow

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2026-02-11 15:34:26 -05:00
Keeley Hammond
fdd31a7aa4 feat: add support for disclaiming utility processes (#49695)
feat: add support for disclaiming utility processes (#49128)

* feat: add support for disclaiming utility processes

* chore: update patches

---------
2026-02-11 16:51:03 +01:00
trop[bot]
cb0727f88c docs: fix typos across documentation (#49758)
Fix 40 typos across 25 documentation files including misspellings,
missing words, doubled words, wrong words, and grammatical errors.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: ron <ronald_eddy@yahoo.com>
2026-02-11 16:48:48 +01:00
electron-roller[bot]
21c6e4e8a0 chore: bump node to v24.13.0 (40-x-y) (#49188)
* chore: bump node in DEPS to v24.12.0

* chore: bump node in DEPS to v24.13.0

* src: use CP_UTF8 for wide file names on win32

https://github.com/nodejs/node/pull/60575

* test,crypto: handle a few more BoringSSL tests

https://github.com/nodejs/node/pull/59030

* chore: re-add accidentally removed sslv23 test

* test: make buffer sizes 32bit-aware in test-internal-util-construct-sab

https://github.com/nodejs/node/pull/61026

* chore: fixup patch indices

* chore: fixup crypto patch rebase

(cherry picked from commit 0b3baf0167)

* chore: fixup sandboxed pointers patch

(cherry picked from commit f52fbdbe51)

* build: try removing zero-fill sandbox patch component (#49452)

(cherry picked from commit 73377af79e)

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782
(cherry picked from commit 87bc8ebd34)

* src: add internal binding for constructing SharedArrayBuffers

https://github.com/nodejs/node/pull/60497
(cherry picked from commit ae90076267)

* chore: fixup after rebase

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-10 15:29:51 +01:00
trop[bot]
bf4746c7c9 fix: default accelerator for role-based menu items (#49669)
fix: apply default accelerator for role-based menu items

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-09 10:09:18 -05:00
trop[bot]
091c5db763 docs: fix framerate limit when osr with shared texture (#49729)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-09 15:37:31 +01:00
electron-roller[bot]
ee64692287 chore: bump chromium to 144.0.7559.134 (40-x-y) (#49656)
* chore: bump chromium in DEPS to 144.0.7559.133

* chore: update patches

* chore: bump chromium in DEPS to 144.0.7559.134

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-09 09:17:14 -05:00
trop[bot]
0bc0553af7 fix: restore macos 12 support in Node 24 (#49702)
* fix: restore macos 12 support in Node 24

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: fix rebased patch list

* chore: fixup patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-02-07 07:59:25 -08:00
trop[bot]
51beb04c10 ci: fix patches changes detected in apply patches workflow (#49710)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-06 21:29:52 -08:00
Keeley Hammond
45a6bfbae9 chore: cherry-pick 4508b5dfb26e from v8 (#49699)
* chore: cherry-pick 4508b5dfb26e from v8

* chore: update patch
2026-02-06 07:49:31 -08:00
trop[bot]
53982a2c3a refactor: use ComPtr pattern for MSIX to avoid exception handling (#49687)
* Revert "fix: fix Windows MSIX release build errors (#49613)"

This reverts commit 4b5d5f9dd5.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* refactor: use WRL ComPtr pattern for MSIX to avoid exception handling

The MSIX auto-updater code was using C++/WinRT (winrt::* namespace), which requires exception handling (/EHsc). Mixing exception and non-exception handling code in the same binary is problematic at runtime. This commit refactors electron_api_msix_updater.cc to use an upstream Chromium pattern and eliminates the need for special exception handling build flags

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: import correct packages

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: consolidate IPackage declarations

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* refactor: use IPackageManager/IPackageManager5/IPackageManager9 and IPackage/IPackage2/IPackage4/IPackage6 interfaces as needed for different API methods.

Also consolidates duplicate completion handler logic, fixes a bug in
RegisterRestartOnUpdate where the command line string could go out of
scope, and removes unused includes.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-02-05 13:48:23 -08:00
trop[bot]
713b24db80 refactor: don't log error just for unsigned code (#49677)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-02-05 22:01:09 +01:00
trop[bot]
f63f875ee0 ci: use squash merge for apply patches workflow (#49672)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-04 18:49:57 -08:00
trop[bot]
8cd558f439 feat: import shared texture supports nv12. (#49040)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-04 14:30:54 -05:00
trop[bot]
94b18a54d0 fix: remove menu observer before destroying menu_controller_ (#49657)
* fix: remove menu observer before destroying menu_controller_

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: resolves private inheritance conflict

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-02-04 10:06:19 -08:00
trop[bot]
394d4cf60c fix(squirrel.mac): clean up old staged updates before downloading new update (#49638)
fix: clean up old staged updates before downloading new update

When checkForUpdates() is called while an update is already staged,
Squirrel creates a new temporary directory for the download without
cleaning up the old one. This can lead to disk usage growth when
new versions are released while the app hasn't restarted.

This adds a force parameter to pruneUpdateDirectories that bypasses
the AwaitingRelaunch state check. This is called before creating a
new temp directory, ensuring old staged updates are cleaned up.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Andy Locascio <loc@anthropic.com>
2026-02-04 18:54:03 +01:00
trop[bot]
96db5b9734 ci: handle PRs with no checks in rerun apply patches (#49662)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-04 09:46:02 -08:00
trop[bot]
75e4f83f87 docs: add Wayland note to win.getPosition() and win.getBounds() (#49661)
docs: add Wayland note to win.getPosition()

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-04 11:48:12 -05:00
trop[bot]
4e124f2b22 fix: menu state in macOS dock menus (#49624)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 15:10:48 -05:00
trop[bot]
04f4bcdb78 fix: alt-space should route through 'system-context-menu' (#49640)
fix: alt-space should route through system-context-menu

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 20:26:39 +01:00
trop[bot]
d5eed2bca6 fix: possible crash in FileSystem API (#49635)
Refs https://chromium-review.googlesource.com/6880247

Fixes a crash that can arise in the File System Access API in the
following scenario:

1. Create fileHandle1 at path1.
2. Call fileHandle1.remove() or user manually delete the file.
3. Create fileHandle2 at path2.
4. fileHandle2.move(path1).

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 11:57:53 -05:00
trop[bot]
0e901ca04c build(dev-deps): bump @electron/lint-roller to 3.2.0 (#49575)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-02 14:40:33 +01:00
trop[bot]
af272ec773 feat: msix auto-updater (#49587) 2026-02-02 14:22:04 +01:00
trop[bot]
f6df2854ff fix: duplicate fullscreen macOS menu item (#49595) 2026-02-02 14:20:51 +01:00
trop[bot]
f5dbe3212b docs: app.getGPUInfo() may reject (#49617)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2026-02-02 11:18:27 +01:00
trop[bot]
ef048c48f9 refactor: address PathProvider TODO (#49601)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-02 09:39:20 +01:00
trop[bot]
f8c5bb541f docs: add jsign instructions for Azure Trusted Signing on Linux/macOS (#49602)
* docs: add jsign instructions for Azure Trusted Signing on Linux/macOS

Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>

* docs: add clickable jsign link for Azure Trusted Signing

Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>
2026-02-02 09:38:29 +01:00
Robo
3d4ce3d39b fix: handle out of order recording errors in skia graphite (#49609)
Refs https://issues.chromium.org/issues/458722690
2026-02-01 22:33:05 -08:00
David Sanders
ed8493c5b1 ci: rework reapply patches (#49582)
ci: rework reapply patches (#49552)
2026-01-30 13:21:02 -05:00
trop[bot]
457598a261 fix: macOS menu item accelerators when item disabled (#49592)
fix: macOS menu item acceerators when item disabled

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-30 13:18:36 -05:00
electron-roller[bot]
c18096cdf1 chore: bump chromium to 144.0.7559.111 (40-x-y) (#49562)
* chore: bump chromium in DEPS to 144.0.7559.109

* chore: bump chromium in DEPS to 144.0.7559.111

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-01-29 16:20:54 +01:00
trop[bot]
04901ad77e ci: trigger website docs update on release published (#49569)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 20:54:54 -08:00
trop[bot]
cd00dcbafd test: remove split dependency (#49557)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 22:11:08 +01:00
trop[bot]
d0661e765b fix: chrome://accessibility drift (#49560)
https://chromium-review.googlesource.com/c/chromium/src/+/6870052

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-28 15:37:29 +01:00
trop[bot]
3c9d1dcb1a ci: reapply patches if PR base branch updates them (#49532)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-27 13:16:35 -05:00
trop[bot]
d942351bad docs: correct type for process.noDeprecation (#49544)
* docs: correct type for process.noDeprecation

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* docs: mark `noDeprecation` as optional instead

Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-27 11:37:19 +01:00
trop[bot]
ac4efed3d1 fix: second argument to shell.writeShortcutLink is optional (#49501)
fix: second argument to shell.writeShortcutLink is optional

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-26 14:29:56 +01:00
trop[bot]
db6b22a8e5 docs: add type reference links in Menu and MenuItem API documentation (#49525)
* docs: add type reference links in Menu and MenuItem API documentation

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

* docs: revert type links in Menu return types to fix parser

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sourav Bera <sbera987654321@gmail.com>
2026-01-26 14:28:04 +01:00
John Kleinschmidt
1b7073ad6a chore: update patches for 40-x-y (#49513) 2026-01-23 15:56:25 -08:00
electron-roller[bot]
cd0b34dfc4 chore: bump chromium to 144.0.7559.96 (40-x-y) (#49474)
* chore: bump chromium in DEPS to 144.0.7559.96

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-23 11:18:48 -05:00
Keeley Hammond
c37daa736b chore: cherry-pick dba49550b12d from v8 (#49487)
* chore: cherry-pick dba49550b12d from v8

* chore: update patch
2026-01-22 17:04:41 -06:00
trop[bot]
e555e520d3 fix: return early from platform_util::Beep() on Linux if there is no default GDK display (#49482)
fix: return early from beep on linux if there is no default gdk display

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-01-22 19:32:47 +01:00
trop[bot]
a2949e5217 fix: potential devtools crash on empty (#49490)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-22 10:50:59 -05:00
trop[bot]
f476b29459 docs: document that shell.trashItem requires backslashes (#49480)
docs: Update shell.md: Document that shell.trashItem requires backslashes

In Windows many functions relating to files (e.g. shell.openItem, the Node fs functions, as well as native Win32 APIs) will accept either type of slash / or \ as a folder separator.

shell.trashItem does not work with / as folder separator in Windows. This documentation change explains that.

See also:
https://github.com/electron/electron/issues/28831

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: sam marshall <s.marshall@open.ac.uk>
2026-01-21 14:51:39 -05:00
trop[bot]
412ea766bb docs: add a few API history fragments (#49477)
* docs: add a few API history fragments

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* manual fixes

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-01-21 14:50:37 -05:00
trop[bot]
03ada83421 revert: use deprecated setAllowedFileTypes in macOS dialogs (#49473)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove stray import

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-21 10:39:40 -05:00
trop[bot]
3138ac5fd2 feat: suppress devtools console logging (#49359)
* feat: suppress devtools console logging

Co-authored-by: clavin <clavin@electronjs.org>

* Emit messages as-is in testing builds

Co-authored-by: clavin <clavin@electronjs.org>

* Promote `DCHECK_IS_ON()` to preprocessor check

Co-authored-by: clavin <clavin@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2026-01-20 10:06:35 +01:00
trop[bot]
d4a52baa2f build: roll build-image to a82b87d (#49449)
build: roll build-image to a82b87d

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 19:01:37 +01:00
trop[bot]
cab791e2b1 fix: MAS rejection for private APIs (#49431)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 15:00:30 +01:00
trop[bot]
5e91ab8c50 docs: fix webContents.hostWebContents types (#49446)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-01-19 12:02:05 +01:00
trop[bot]
03d6462edf fix: try clearing InspectableWebContents delegate earlier (#49422)
fix: try clearing InspectableWebContents delegate earlier

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-18 15:54:26 +01:00
trop[bot]
1c2b4e0583 fix: make toplevel icon Wayland protocol work (#49414)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Alex Schwartz <alexschwartz01@gmail.com>
2026-01-16 11:05:20 -05:00
trop[bot]
370965819e fix: restore AXDocument accessibility attribute for representedFilename on macOS (#49417)
Starting from Chromium 134.0.6989.0 (Electron 35.0.0-beta.5), the
NativeWidgetMacNSWindow class overrides accessibilityDocument to return
the web content URL from the accessibility tree, but doesn't fall back
to NSWindow's default behavior when that URL is empty.

This broke Electron's setRepresentedFilename() API - the file path was
still set on the NSWindow, but no longer exposed via the AXDocument
accessibility attribute that screen readers use.

This fix adds an accessibilityDocument override in ElectronNSWindow that
checks representedFilename first, falling back to Chromium's behavior
for web content URLs.

Fixes: https://github.com/electron/electron/issues/XXXXX

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Daniel Gräfe <Daniel.Alm@ForumD.net>
2026-01-16 14:29:49 +01:00
trop[bot]
3d1c5ea4fa ci: detect patch needs update error with problem matcher (#49411)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-16 09:54:25 +01:00
Calvin
35b8855913 chore: empty commit to release stable 40.0.0 (#49404) 2026-01-15 13:39:20 -05:00
trop[bot]
7872c33b10 fix: revert os_crypt async cookie provider implementation (#49384)
* Revert "fix: provide explicit cookie encryption provider for cookie encryption (#49348)"

This reverts commit 95f097a392.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* Revert "fix: fix cookie encryption provider loading on Windows and Linux (#49371)"

This reverts commit 0e4ee9f03a.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* revert: 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: update patch for 40-x-y

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-01-14 19:24:45 +01:00
trop[bot]
9c753c344a docs: remove stale example and standardize DevTools capitalization (#49387)
* docs: remove stale example and standardize `DevTools` capitalization

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/api/web-contents.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-01-14 14:51:07 +01:00
trop[bot]
8b2a99183f docs: improve build-tools instructions (#49385)
* docs: improve build-tools instructions

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* address comments

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* update directory structure

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* update

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* nits

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* node -> electron_node

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* update macos build version

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/development/build-instructions-gn.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-01-14 10:29:24 +01:00
trop[bot]
c897602202 refactor: add static ReplyChannel::SendError() helper (#49372)
refactor: add static `ReplyChannel::SendError()` helper (#49338)

* refactor: add static void ReplyChannel::SendError()

* refactor: use static SendError() instead of instantiating a temporary

* refactor: remove non-static version of SendError()

* refactor: remove redundant callback-is-non-null checks

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-01-14 09:34:28 +01:00
electron-roller[bot]
8cc201e02c chore: bump chromium to 144.0.7559.60 (40-x-y) (#49380)
chore: bump chromium in DEPS to 144.0.7559.60

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-01-14 09:34:08 +01:00
electron-roller[bot]
ba26a5d4d3 chore: bump chromium to 144.0.7559.59 (40-x-y) (#49330)
* chore: bump chromium in DEPS to 144.0.7559.59

* chore: update patches

* [InputVizard] Fix missing touch cancel in InputTransferHandlerAndroid
using InputEventSource

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7302368

(cherry picked from commit f31f9e06db)

* 7264893: update postMessage tests for file: origin serialization change

Cherry-picked from 4ef78d3ee7

Chromium now serializes file: origins as 'null' in MessageEvent per spec. This is a security improvement aligning with the HTML spec behavior.  Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893

Co-Authored-By: Alice Zhao <66543449+alicelovescake@users.noreply.github.com>

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: Alice Zhao <66543449+alicelovescake@users.noreply.github.com>
2026-01-13 19:09:12 -05:00
trop[bot]
df4d0bef21 fix: fix cookie encryption provider loading on Windows and Linux (#49375)
* fix: support cookie encryption provider cross-platform

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: add async macos key provider

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-12 21:02:05 -08:00
trop[bot]
9c4e03fd8a build: roll build-tools SHA to 4430e4a (#49366)
build: roll build-tools SHA to 4430e4a

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-12 15:52:11 -05:00
Shelley Vohr
05b4b57151 feat: support WebSocket authentication handling (#49064)
* feat: support WebSocket authentication handling

* chore: make linter happy

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-01-12 11:23:31 -05:00
trop[bot]
d5087faff7 fix: provide explicit cookie encryption provider for cookie encryption (#49350)
fix: provide explicit cookie encryption provider

Fixes 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-09 17:44:47 -08:00
trop[bot]
3039ced4f3 chore: improvements to script/run-clang-tidy.ts (#49343)
* chore: disable color output for clang-tidy in CI

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: small QoL improvements to run-clang-tidy.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: add --fix option to script/run-clang-tidy.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-09 14:43:18 -06:00
trop[bot]
4152b44bf8 docs: document ELECTRON_SKIP_BINARY_DOWNLOAD (#49332)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2026-01-08 10:10:08 -06:00
John Kleinschmidt
95cd5641dd build: use @electron-ci/dev-root for package.json default
(cherry picked from commit bab6bd3dae)
2026-01-06 14:28:47 -05:00
electron-roller[bot]
9e7ef66ecb chore: bump chromium to 144.0.7559.31 (40-x-y) (#48958)
* chore: bump chromium in DEPS to 144.0.7527.1

* chore: bump chromium in DEPS to 144.0.7529.1

* chore: bump chromium in DEPS to 144.0.7529.3

* chore: bump chromium in DEPS to 144.0.7529.5

* chore: bump chromium in DEPS to 144.0.7531.1

* chore: bump chromium in DEPS to 144.0.7531.0

* chore: bump chromium in DEPS to 144.0.7532.1

* chore: bump chromium in DEPS to 144.0.7535.1

* chore: bump chromium in DEPS to 144.0.7537.1

* chore: bump chromium in DEPS to 144.0.7539.1

* chore: bump chromium in DEPS to 144.0.7541.1

* chore: bump chromium in DEPS to 144.0.7543.1

* chore: bump chromium in DEPS to 144.0.7545.1

* chore: bump chromium in DEPS to 144.0.7547.1

* chore: bump chromium in DEPS to 144.0.7549.1

* chore: bump chromium in DEPS to 144.0.7551.0

* chore: bump chromium in DEPS to 144.0.7553.0

* chore: bump chromium in DEPS to 144.0.7555.1

* chore: bump chromium in DEPS to 144.0.7557.1

* chore: bump chromium in DEPS to 144.0.7559.1

* chore: bump chromium in DEPS to 144.0.7559.5

* chore: bump chromium in DEPS to 144.0.7559.3

* chore: bump chromium in DEPS to 144.0.7559.12

* chore: bump chromium in DEPS to 144.0.7559.20

* fix(patch-conflict): update code cache patch for PersistentCache refactor

Upstream refactored code cache to use PersistentCache with new class-based
implementation (NoopCodeCacheHost, LocalCodeCacheHost, CodeCacheWithPersistentCacheHost).
Updated patch to integrate custom scheme support into the new structure while
preserving ProcessLockURLIsCodeCacheScheme checks for embedder-registered schemes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7044986

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>
(cherry picked from commit 2b9d256e78)

* fix(patch-conflict): update dialog patch for RequestXdgDesktopPortal API

Upstream changed from SetSystemdScopeUnitNameForXdgPortal to RequestXdgDesktopPortal
API pattern. Updated OnServiceStarted signature and kept OnSystemdUnitStarted callback
that calls Electron's file_dialog::StartPortalAvailabilityTestInBackground().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7204285

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>
(cherry picked from commit 2cd3911d92)

* chore: update patches

* fix(build): update VideoPixelFormat API for SharedImageFormat

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7207153
removed VideoPixelFormatToGfxBufferFormat as part of migration to
SharedImageFormat. Update to use VideoPixelFormatToSharedImageFormat
which directly returns the SharedImageFormat.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>
(cherry picked from commit ff9d072b4b)

* fix(build): extend profile methods patch for ShouldEnableXfaForms

The ShouldEnableXfaForms function uses Profile::FromBrowserContext()
which is not available in Electron. Wrap the profile-dependent code
in #if 0 to fall through to the feature flag default.

Co-Authored-By: Claude <noreply@anthropic.com>
(cherry picked from commit 3edec8ee30)

* fix(build): add missing include

`components/dbus/xdg/systemd.h` for `void OnSystemdUnitStarted(dbus_xdg::SystemdUnitStatus)` in the same patch.

(cherry picked from commit 6929589c0d)

* fixup! fix(build): add missing include

(cherry picked from commit 39cd8f15c1)

* chore: update libc++ filenames

(cherry picked from commit 6aa1ecc71d)

* fix(build): adapt to string-view-ification change in windows jump_list.cc

7186922: Fix unsafe buffer usage in base/win/win_util.cc
https://chromium-review.googlesource.com/c/chromium/src/+/7186922
(cherry picked from commit 85ce0d45a3)

* chore: bump chromium in DEPS to 144.0.7559.31

* Fix Crash in FullscreenController::EnterFullscreenModeInternal

https://chromium-review.googlesource.com/c/chromium/src/+/7260934

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: clavin <clavin@electronjs.org>
2026-01-06 14:22:31 -05:00
trop[bot]
96018acfc2 docs: update roundedCorners documentation (#49311)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-01-06 10:32:37 -05:00
Calvin
ff23784246 fix: drag regions in child windows (manual backport 40-x-y) (#49312)
fix: drag regions in child windows
2026-01-06 10:32:12 -05:00
trop[bot]
c4bfc1491a fix: webRequest.onBeforeSendHeaders not being able to modify reserved headers (#49241)
* fix: `webRequest.onBeforeSendHeaders` not being able to modify reserved headers

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* chore: add unit test for reserved header

Co-authored-by: Samuel Attard <sattard@anthropic.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-01-06 10:31:09 -05:00
Niklas Wenzel
8fd775faca fix: visual artifacts while resizing on Windows (#49191) 2026-01-05 16:32:21 -05:00
trop[bot]
a7652f68e9 build: fixup release notes generation (#49305)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-01-05 12:23:42 -05:00
trop[bot]
525917302a build: add logging to notes generator (#49301)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-01-05 09:55:16 -05:00
Keeley Hammond
a3e69b0f9e chore: cherry-pick e0052e7af9c9 from v8 (#49286)
* chore: cherry-pick e0052e7af9c9 from v8

* chore: update patches
2025-12-31 17:02:36 +13:00
trop[bot]
ce0850e4f6 ci: disallow non-maintainer changes to Yarn files (#49193)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-12-15 14:01:00 -08:00
trop[bot]
9dce2015f7 build: drop dugite as a dependency (#49204)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-12-15 14:40:56 -05:00
Keeley Hammond
b0ba443ff3 chore: cherry-pick 95a32cb37edb from angle (#49201)
* build: add angle patch dir

* chore: cherry-pick 95a32cb37edb from angle

* chore: update patches
2025-12-12 06:12:18 -08:00
trop[bot]
1c85668558 build: upgrade yarn to 4.12.0 (#49181)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-12-10 19:21:46 -08:00
John Kleinschmidt
5db7fd8fca build: upgrade github-app-auth to 3.2.0 (#49161)
build: upgrade github-app-auth to 3.2.0 (#49152)
2025-12-10 10:50:41 -05:00
trop[bot]
46919aaa1b build: use powershell for Electron build step (#49153)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-12-09 11:15:38 -05:00
trop[bot]
e3cabb6119 chore: bump chromium to 144.0.7547.0 (40-x-y) (#49146)
* chore: bump chromium in DEPS to 144.0.7543.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update patches

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update filenames.libcxx.gni

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: bump chromium in DEPS to 144.0.7545.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: bump chromium in DEPS to 144.0.7547.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* fixup Add support for UnownedUserData in GlobalFeatures

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* fixup BUILD.gn for lint

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: skip setting LPAC ACLs

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: remove patch that hasn't been backported

See https://github.com/electron/electron/pull/48675

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-12-05 12:18:13 -05:00
trop[bot]
0656e76c25 fix: run toast creation on background thread (#49129)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

Co-authored-by: Jan Hannemann <jan.hannemann@outlook.com>

* fix: comments

Co-authored-by: Jan Hannemann <jan.hannemann@outlook.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Jan Hannemann <jan.hannemann@outlook.com>
2025-12-02 20:41:03 -08:00
trop[bot]
fa9489c8ac chore: reclaim macOS disk space (#49122)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-12-01 15:29:32 -08:00
trop[bot]
8b6d9e1fa6 fix: crash when attempting to resolve modules during process exit (#49104)
* fix: crash when attempting to resolve modules during process exit

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: fix build

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-28 02:12:32 +09:00
trop[bot]
5b7e37c8dc ci: use clang problem matcher with nan spec runner (#49098)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-11-27 11:14:10 +01:00
trop[bot]
d2ae9ed69f fix: ensure menu-did-close is emitted for application menus (#49092)
fix: ensure menu-did-close is emitted for application menus

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-26 11:47:36 -06:00
trop[bot]
7eb6ff95e4 ci: don't build yarn modules for linux arm (#49086)
This should fix the oom errors

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-26 10:32:06 -05:00
trop[bot]
9ec95c0c02 chore: bump chromium to 144.0.7527.0 (40-x-y) (#49057)
chore: bump chromium to 144.0.7527.0 40-x-y

* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-24 16:59:42 -05:00
trop[bot]
718bddb407 docs: update linux build instructions (#49063)
* docs: update linux build instructions

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-24 13:50:48 -06:00
trop[bot]
488b96b18a docs: explain how to create transparent window using BaseWindow (#49052)
docs: clarify how to create transparent BaseWindow

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: teoyuqi <83915879+teoyuqi@users.noreply.github.com>
2025-11-24 09:41:08 +01:00
trop[bot]
0812f7ee86 fix: exception when reading system certificates via nodejs (#49041)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-24 14:48:42 +09:00
trop[bot]
cf7a19805e chore: backport 744f40f from devtools-frontend (#49043)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-23 21:37:11 +01:00
trop[bot]
23ef7bc703 fix: only call popup closecallback for top-level menu (#49046)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-23 21:35:25 +01:00
trop[bot]
8dbc6c14e5 build: automatically install git for dugite (#49029)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-21 11:01:25 -05:00
trop[bot]
3209d817ca fix: revert the parent window remained interactive after the modal window was opened (#49021)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: bill.shen <15865969+cucbin@users.noreply.github.com>
2025-11-19 17:08:23 -05:00
trop[bot]
f8d3e0f3cd fix: abort more descriptively for beforeunload (#49010)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-19 15:41:59 -05:00
electron-roller[bot]
d9446924dc chore: bump node to v24.11.1 (40-x-y) (#48916)
* chore: bump node in DEPS to v24.11.1

* chore: bump node to v24.11.1 (main) (#48917)

* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 17:07:34 -05:00
trop[bot]
d1d6befcf1 fix: handle empty event scenario in ipc callbacks (#48991)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-18 09:17:51 -05:00
John Kleinschmidt
fe32528c50 build: update to yarn v4 (#48993) 2025-11-17 16:04:51 -08:00
trop[bot]
ef8fad7d8e build: limit workflow gh token permissions (#48966)
* build: limit workflow gh token permissions

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* feedback

Co-authored-by: Samuel Attard <sattard@anthropic.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2025-11-17 09:44:48 +01:00
trop[bot]
bb9c867f23 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48981)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-11-15 10:04:57 -08:00
trop[bot]
e8e41a28dd fix: revert enabling WASM trap handlers in all Node.js processes (#48976)
Revert "fix: enable wasm trap handlers in all Node.js processes (#48788)"

This reverts commit ca0b46b413.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-14 18:57:05 -08:00
trop[bot]
fd1db6a8b6 test: add view.getBounds|setBounds tests (#48962)
test: add view.getBounds|setBounds tests

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-14 10:57:24 -05:00
trop[bot]
fb62a5873a build: correct uploader copy for tar files (#48954)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-11-14 10:54:37 -05:00
Shelley Vohr
b62a97805a build: fix unnecessary patch (#48957) 2025-11-14 15:05:26 +01:00
electron-roller[bot]
135f127db8 chore: bump chromium to 144.0.7526.0 (40-x-y) (#48913)
* chore: bump chromium in DEPS to 144.0.7524.0

* chore: bump chromium in DEPS to 144.0.7524.1

* chore: bump chromium in DEPS to 144.0.7526.0

* chore: bump chromium in DEPS to 144.0.7526.1

* chore: bump chromium to 144.0.7522.0 (main) (#48892)

* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
(cherry picked from commit 10b07deb97)

* chore: bump chromium to 144.0.7526.0 (main) (#48932)

* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
(cherry picked from commit 8ecd064d2c)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 18:04:34 -05:00
Shelley Vohr
6b797a84a8 chore: cherry-pick 4cf9311 from v8 (#48948) 2025-11-13 14:57:18 -08:00
trop[bot]
57bbcd5233 fix: crash on windows when UTF-8 is in path (#48942)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Fedor Indutny <indutny@signal.org>
2025-11-13 13:53:24 -08:00
trop[bot]
4c042506fe fix: handle tar.xz files in uploaders, add to breaking changes (#48952)
* fix: handle tar.xz files in uploaders, add to breaking changes

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* docs: add additional file extension info

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-13 13:21:43 -08:00
trop[bot]
ebd173afea docs: fix docs for app.isHardwareAccelerationEnabled() (#48946)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-13 14:59:13 -05:00
trop[bot]
58328779f7 docs: explain how to load SF Symbols with nativeImage (#48940)
* docs: explain how to load SF Symbols with `nativeImage`

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: use single quotes

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: use single quotes

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-13 11:18:59 -05:00
trop[bot]
7a5e34e6ca feat: add bypassCustomProtocolHandlers option to net.request (#48883)
* feat: add bypassCustomProtocolHandlers option to net.request

Co-authored-by: Kai <udbmnm@163.com>

* style: fix lint errors in api-protocol-spec

Co-authored-by: Kai <udbmnm@163.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kai <udbmnm@163.com>
2025-11-13 10:36:25 -05:00
trop[bot]
0c4f0cf729 docs: clarify meaning of string value for menu item icon (#48937)
* docs: clarify meaning of string value for menu item icon

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: format

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: wording

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-13 10:28:46 -05:00
trop[bot]
e2606bbe48 build: apply additional compression to dsym on upload (#48934)
build: use tar.xz compression

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-13 13:32:13 +01:00
trop[bot]
543f1670fe fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#48927)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: vulture <isu@vulture.fm>
2025-11-13 09:53:02 +01:00
trop[bot]
fa764f7328 docs: deprecate clipboard API access from renderer processes (#48923)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-12 15:16:37 -05:00
trop[bot]
ac7992b801 docs: fix v40 stable release date (#48914)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

Co-authored-by: 정승규 <43807509+jsk41755@users.noreply.github.com>

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule

Co-authored-by: 정승규 <43807509+jsk41755@users.noreply.github.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: 정승규 <43807509+jsk41755@users.noreply.github.com>
2025-11-12 15:44:26 +01:00
trop[bot]
499bb039a4 ci: exclude top-level docs files from full CI (#48896)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 21:05:54 +01:00
trop[bot]
b0041fdb60 chore: bump chromium to 144.0.7521.0 (40-x-y) (#48894)
* chore: bump chromium in DEPS to 144.0.7521.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 21:04:34 +01:00
trop[bot]
c229e274a0 feat: add sharedTexture module to import shared texture (#48831)
feat: add `sharedTexture` module.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2025-11-11 11:55:54 -05:00
trop[bot]
16f4655981 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48893)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 09:27:32 -06:00
trop[bot]
9e6546da7c chore: delay load pdfjs-dist for pdf spec (#48890)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-11 16:02:34 +01:00
trop[bot]
c05b5e98c4 docs: remove electronegativity (#48886)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-11 09:59:20 +01:00
trop[bot]
8bb0f146ea fix: ESM-from-CJS import when CJK is in path (#48862)
Upstream fix: https://github.com/nodejs/node/pull/60575

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Fedor Indutny <indutny@signal.org>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-11 09:47:03 +01:00
trop[bot]
45cc8dd600 chore: bump chromium to 144.0.7520.0 (40-x-y) (#48874)
* chore: bump chromium in DEPS to 144.0.7520.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 16:32:54 -05:00
trop[bot]
fe396ef002 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48772)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

Co-authored-by: TheCommieAxolotl <87679354+TheCommieAxolotl@users.noreply.github.com>

* use obj-c name in NSImage constructor

Co-authored-by: TheCommieAxolotl <87679354+TheCommieAxolotl@users.noreply.github.com>

* add test for named symbol image

Co-authored-by: TheCommieAxolotl <87679354+TheCommieAxolotl@users.noreply.github.com>

* apply suggested simplification

Co-authored-by: TheCommieAxolotl <87679354+TheCommieAxolotl@users.noreply.github.com>

* fix: support NX cocoa prefix

Co-authored-by: TheCommieAxolotl <87679354+TheCommieAxolotl@users.noreply.github.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: TheCommieAxolotl <87679354+TheCommieAxolotl@users.noreply.github.com>
2025-11-10 21:18:00 +01:00
trop[bot]
6876eb2fe9 chore: bump chromium to 144.0.7514.0 (40-x-y) (#48868)
* chore: bump chromium in DEPS to 144.0.7514.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update .patches after trop

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 18:32:34 +01:00
trop[bot]
ec84ba6b6c docs: update macOS version support in README (#48871)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Foad Lind <20255390+foadlind@users.noreply.github.com>
2025-11-10 09:51:26 -05:00
trop[bot]
2e7fdde0fc fix: the parent window remained interactive after the modal window was opened (#48864)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bill Shen <15865969+cucbin@users.noreply.github.com>
2025-11-10 13:55:46 +01:00
trop[bot]
018876adde build: add missing header for SetStackDumpFirstChanceCallback (#48863)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-10 12:06:42 +01:00
trop[bot]
59b0747676 refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48856)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 09:51:18 +01:00
trop[bot]
d4d89cdd48 fix: CSD window frame tiles properly on Wayland (#48835)
fix: CSD window frame tiles properly on Linux

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2025-11-08 10:49:29 +01:00
electron-roller[bot]
1b3ce5d74a chore: bump chromium to 144.0.7512.1 (40-x-y) (#48786)
* chore: bump chromium in DEPS to 144.0.7510.1

* chore: bump chromium in DEPS to 144.0.7512.2

* chore: bump chromium in DEPS to 144.0.7514.0

* chore: bump chromium in DEPS to 144.0.7514.1

* chore: bump chromium to 144.0.7512.1 (main) (#48768)

* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 17:40:25 -05:00
trop[bot]
2ce7bd99c4 docs: Update 404 devtools extension documentation link (#48841)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

Co-authored-by: Ryota Murakami <dojce1048@gmail.com>

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Ryota Murakami <dojce1048@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Ryota Murakami <dojce1048@gmail.com>
2025-11-07 18:42:11 +01:00
trop[bot]
bb52517054 fix: enable wasm trap handlers in all Node.js processes (#48839)
* fix: enable wasm trap handlers in all Node.js processes

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* fix: separate registrations to account for featurelist init

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-07 23:49:40 +09:00
trop[bot]
c4d9d9645a fix(reland): allow disabling all NSMenuItems (#48828)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: add guard for type

Co-authored-by: George Xu <george.xu@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: George Xu <george.xu@slack-corp.com>
2025-11-07 11:23:11 +01:00
trop[bot]
6396c12401 fix: oom crash in v8 when optimizing wasm (#48816)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-06 10:21:11 -05:00
trop[bot]
3397626653 build: use --keep-non-patch flag with git am (#48807)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-11-06 12:00:07 +01:00
trop[bot]
dd662db5d6 fix: revert allow disabling all NSMenuItems, fix menu crash (#48799)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-05 20:28:36 -08:00
trop[bot]
11191f23b1 refactor: remove base::AdaptCallbackForRepeating patch (#48790)
refactor: remove base::AdaptCallbackForRepeating patch

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-05 18:25:01 -05:00
trop[bot]
e1dadaa6a0 chore: bump chromium to 144.0.7506.0 (40-x-y) (#48767)
* chore: bump chromium in DEPS to 144.0.7504.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7506.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update filenames.libcxx.gni

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-05 09:23:03 -05:00
trop[bot]
887294ab5c fix: draw smoothing round rect corner (#48782)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bill Shen <15865969+cucbin@users.noreply.github.com>
2025-11-05 14:24:05 +01:00
trop[bot]
1265eccf43 build: apply additional compression on upload (#48777)
build: apply additional compression on upload for large files

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-04 20:04:28 +01:00
electron-roller[bot]
23792bc7ed chore: bump node to v24.11.0 (40-x-y) (#48775)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 12:36:51 -05:00
trop[bot]
4138dfeb19 chore: upgrade Node.js to v24.10.0 (#48739)
* chore: upgrade Node.js to v24.10.0

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup crypto patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup crypto test patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup lazyload fs patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: errant use of context->GetIsolate()

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: tweak BoringSSL compat patch for new changes

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: add back missing isolate dtor declaration

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! esm: fix module.exports export on CJS modules

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! src: prepare for v8 sandboxing

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump @types/node to v24

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fix const assignment in crypto test

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: sandbox pointer patch issues

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: rework source phase import patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup crypto tests

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: HostImportModuleWithPhaseDynamically todo

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: cjs esm failures

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove deleted specs

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: tweak sandboxed pr patch

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: disable parallel/test-os-checked-function

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: use WHATWG URL instead of url.parse

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fix accidental extra line

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-04 09:52:30 +01:00
trop[bot]
709a9f5f20 fix: release mouse buttons on focus loss on Wayland (#48759)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2025-11-03 11:20:43 -05:00
trop[bot]
a2bb5069a5 chore: bump chromium to 144.0.7500.0 (40-x-y) (#48745)
* chore: bump chromium in DEPS to 144.0.7500.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* build: explicitly disable reclient

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-11-03 13:18:33 +01:00
trop[bot]
2b99c7645d refactor: remove redundant map lookups in browser/api/menu.ts (#48732)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-30 09:43:25 -04:00
trop[bot]
3c8714a940 chore: bump chromium to 143.0.7499.0 (40-x-y) (#48729)
* chore: bump chromium in DEPS to 143.0.7499.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 15:40:58 -04:00
trop[bot]
a01b4becfa docs: use relative link for OffscreenSharedTexture (#48720)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-10-29 00:01:22 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
669 changed files with 34266 additions and 18284 deletions

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -45,6 +45,7 @@ runs:
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Build Electron ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
rm -rf "src/out/Default/Electron Framework.framework"
@@ -60,14 +61,51 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Build Electron (Windows) ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
cd src\electron
git pack-refs
cd ..
$env:NINJA_SUMMARIZE_BUILD = 1
if ("${{ inputs.is-release }}" -eq "true") {
e build --target electron:release_build
} else {
e build --target electron:testing_build
}
Copy-Item out\Default\.ninja_log out\electron_ninja_log
node electron\script\check-symlinks.js
# Upload build stats to Datadog
if ($env:DD_API_KEY) {
try {
npx node electron\script\build-stats.mjs out\Default\siso.exe.INFO --upload-stats ; $LASTEXITCODE = 0
} catch {
Write-Host "Build stats upload failed, continuing..."
}
} else {
Write-Host "Skipping build-stats.mjs upload because DD_API_KEY is not set"
}
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -75,11 +113,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -89,7 +126,6 @@ runs:
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
e build --target electron:electron_mksnapshot_zip
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -123,7 +159,6 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
@@ -133,11 +168,6 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -157,17 +187,11 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -180,18 +204,6 @@ runs:
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip
e build --target electron:libcxxabi_headers_zip
e build --target electron:libcxx_objects_zip
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
@@ -200,10 +212,11 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -214,6 +227,11 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash

View File

@@ -143,16 +143,17 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matcher
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
npx node src/electron/script/patches-stats.mjs --upload-stats || true
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD

View File

@@ -17,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -60,18 +62,26 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=c13f4bdb50e65da46a4703f8f882079dd21fd99e
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -6,7 +6,7 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
id: yarn-cache
with:
@@ -18,4 +18,14 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

122
.github/copilot-instructions.md vendored Normal file
View File

@@ -0,0 +1,122 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

View File

@@ -0,0 +1,16 @@
{
"problemMatcher": [
{
"owner": "markdownlint",
"pattern": [
{
"regexp": "^(.+):(\\d+):(\\d+)\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"message": 4
}
]
}
]
}

View File

@@ -19,6 +19,16 @@
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

73
.github/workflows/apply-patches.yml vendored Normal file
View File

@@ -0,0 +1,73 @@
name: Apply Patches
on:
pull_request:
permissions: {}
concurrency:
group: apply-patches-${{ github.ref }}
cancel-in-progress: true
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
has-patches: ${{ steps.filter.outputs.patches }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
persist-credentials: false
ref: ${{ github.event.pull_request.head.sha }}
# Use dorny/paths-filter instead of the path filter under the on: pull_request: block
# so that the output can be used to conditionally run the apply-patches job, which lets
# the job be marked as a required status check (conditional skip counts as a success).
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
id: filter
with:
filters: |
patches:
- DEPS
- 'patches/**'
apply-patches:
needs: setup
if: ${{ needs.setup.outputs.has-patches == 'true' }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
persist-credentials: false
ref: ${{ github.event.pull_request.base.ref }}
- name: Merge PR HEAD
working-directory: src/electron
env:
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
git config user.email "electron@github.com"
git config user.name "Electron Bot"
git fetch origin refs/pull/${PR_NUMBER}/head
git merge --squash FETCH_HEAD
git commit -n -m "Squashed commits"
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux

View File

@@ -3,17 +3,21 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
- name: Setting Up Dig Site
@@ -41,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -16,11 +16,11 @@ jobs:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444 # v5.0.0
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
@@ -73,6 +73,7 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -6,11 +6,15 @@ on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -19,7 +23,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -30,8 +34,10 @@ jobs:
build-git-cache-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -41,7 +47,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -52,10 +58,12 @@ jobs:
build-git-cache-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -64,7 +72,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
skip-macos:
type: boolean
@@ -43,10 +43,13 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -54,7 +57,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -63,13 +66,17 @@ jobs:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -80,6 +87,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
@@ -89,6 +98,8 @@ jobs:
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
@@ -98,6 +109,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -111,7 +124,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -126,6 +139,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -141,7 +156,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -155,6 +170,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -171,7 +188,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -185,16 +202,20 @@ jobs:
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
@@ -207,6 +228,8 @@ jobs:
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
@@ -225,7 +248,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
@@ -244,7 +267,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
@@ -310,7 +333,7 @@ jobs:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -400,6 +423,8 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
steps:

View File

@@ -1,16 +1,20 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -31,6 +32,8 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -11,6 +11,7 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -28,6 +29,7 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -37,7 +39,7 @@ jobs:
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}

View File

@@ -10,6 +10,7 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,9 +17,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -31,7 +35,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,12 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -54,7 +63,12 @@ jobs:
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -69,7 +83,12 @@ jobs:
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -32,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -43,11 +47,16 @@ jobs:
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -58,11 +67,16 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -73,11 +87,16 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -88,11 +107,16 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -7,6 +7,8 @@ on:
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -64,14 +64,13 @@ concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -86,6 +85,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
@@ -19,11 +21,13 @@ jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -50,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -19,11 +21,13 @@ jobs:
lint:
name: Lint
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -61,9 +65,11 @@ jobs:
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add ESLint problem matcher
- name: Add problem matchers
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
run: |
echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
echo "::add-matcher::src/electron/.github/problem-matchers/markdownlint.json"
- name: Run Lint
shell: bash
run: |
@@ -74,11 +80,15 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -59,6 +59,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -66,6 +68,7 @@ concurrency:
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
@@ -80,16 +83,19 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -113,7 +119,7 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
cache: yarn
@@ -157,7 +163,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0

View File

@@ -0,0 +1,237 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -35,10 +35,7 @@ concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -53,6 +50,10 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
@@ -68,9 +69,10 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
- name: Add TCC permissions on macOS
@@ -117,7 +119,7 @@ jobs:
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -166,43 +168,36 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
Expand-Archive -Force chromedriver.zip -DestinationPath ./
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
- name: Run Electron Tests
shell: bash
env:
@@ -228,7 +223,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -245,9 +240,14 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
- name: Upload Test results to Datadog
@@ -259,13 +259,14 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -39,6 +41,8 @@ jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +97,8 @@ jobs:
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +138,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

View File

@@ -11,6 +11,7 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
@@ -19,12 +20,16 @@ jobs:
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -0,0 +1,71 @@
name: Rerun PR Apply Patches
on:
push:
branches:
- main
- '[1-9][0-9]-x-y'
paths:
- 'DEPS'
- 'patches/**'
permissions: {}
jobs:
rerun-apply-patches:
runs-on: ubuntu-latest
permissions:
actions: write
checks: read
contents: read
pull-requests: read
steps:
- name: Find PRs and Rerun Apply Patches
env:
GH_REPO: ${{ github.repository }}
GH_TOKEN: ${{ github.token }}
run: |
BRANCH="${GITHUB_REF#refs/heads/}"
# Find all open PRs targeting this branch
PRS=$(gh pr list --base "$BRANCH" --state open --limit 250 --json number)
echo "$PRS" | jq -c '.[]' | while read -r pr; do
PR_NUMBER=$(echo "$pr" | jq -r '.number')
echo "Processing PR #${PR_NUMBER}"
# Find the Apply Patches workflow check for this PR
CHECK=$(gh pr view "$PR_NUMBER" --json statusCheckRollup --jq '[.statusCheckRollup[] | select(.workflowName == "Apply Patches" and .name == "apply-patches")] | first')
if [ -z "$CHECK" ] || [ "$CHECK" = "null" ]; then
echo " No Apply Patches workflow found for PR #${PR_NUMBER}"
continue
fi
CONCLUSION=$(echo "$CHECK" | jq -r '.conclusion')
if [ "$CONCLUSION" = "SKIPPED" ]; then
echo " apply-patches job was skipped for PR #${PR_NUMBER} (no patches)"
continue
fi
LINK=$(echo "$CHECK" | jq -r '.detailsUrl')
# Extract the run ID from the link (format: .../runs/RUN_ID/job/JOB_ID)
RUN_ID=$(echo "$LINK" | grep -oE 'runs/[0-9]+' | cut -d'/' -f2)
if [ -z "$RUN_ID" ]; then
echo " Could not extract run ID from link: ${LINK}"
continue
fi
# Check if the workflow is currently in progress
RUN_STATUS=$(gh run view "$RUN_ID" --json status --jq '.status')
if [ "$RUN_STATUS" = "in_progress" ] || [ "$RUN_STATUS" = "queued" ] || [ "$RUN_STATUS" = "waiting" ]; then
echo " Workflow run ${RUN_ID} is ${RUN_STATUS}, cancelling..."
gh run cancel "$RUN_ID" --force
gh run watch "$RUN_ID"
fi
gh run rerun "$RUN_ID"
done

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@3599b3baa15b485a2e49ef411a7a4bb2452e7f93 # v3.29.5
uses: github/codeql-action/upload-sarif@4e94bd11f71e507f7f87df81788dff88d1dacbfb # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:

View File

@@ -11,6 +11,7 @@ jobs:
check-stable-prep-items:
name: Check Stable Prep Items
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -10,13 +10,14 @@ permissions: {}
jobs:
stale:
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,10 +28,11 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
permissions: {}
if: ${{ always() }}
needs: stale
steps:
@@ -39,7 +41,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -0,0 +1,39 @@
name: Update Website Docs
on:
release:
types: [published]
permissions: {}
jobs:
update-website-docs:
name: Update Website Docs
runs-on: ubuntu-latest
environment: website-docs-updater
permissions:
contents: read
id-token: write # needed for secret-service-action
steps:
- name: Get GitHub App token
id: secret-service
uses: electron/secret-service-action@3476425e8b30555aac15b1b7096938e254b0e155 # v1.0.0
- name: Check if this release is the latest
id: check-if-latest-release
env:
GH_REPO: electron/electron
GH_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
LATEST_RELEASE_TAG="$(gh release view --json tagName --jq '.tagName')"
if [ "$LATEST_RELEASE_TAG" = "${GITHUB_REF#refs/tags/}" ]; then
echo "isLatestRelease=true" >> $GITHUB_OUTPUT
else
echo "isLatestRelease=false" >> $GITHUB_OUTPUT
fi
- name: Trigger website docs update
if: ${{ steps.check-if-latest-release.outputs.isLatestRelease == 'true' }}
env:
GH_REPO: electron/website
GH_TOKEN: ${{ fromJSON(steps.secret-service.outputs.secrets).WEBSITE_DOCS_UPDATER_APP_TOKEN }}
run: |
gh workflow run update-docs.yml -f sha=$GITHUB_SHA

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -36,7 +40,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
with:
path: src/electron
fetch-depth: 0
@@ -47,7 +51,12 @@ jobs:
target-platform: win
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -61,7 +70,12 @@ jobs:
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -75,7 +89,12 @@ jobs:
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release

2
.gitignore vendored
View File

@@ -53,3 +53,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

2
.nvmrc
View File

@@ -1 +1 @@
20
22

942
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

12
.yarnrc.yml Normal file
View File

@@ -0,0 +1,12 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

View File

@@ -480,6 +480,7 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
@@ -527,6 +528,7 @@ source_set("electron_lib") {
"//base",
"//base:i18n",
"//content/public/app",
"//ui/base/unowned_user_data",
]
include_dirs = [
@@ -586,7 +588,13 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -755,11 +763,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]
@@ -1619,6 +1629,29 @@ group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"

11
DEPS
View File

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'142.0.7417.0',
'144.0.7559.225',
'node_version':
'v22.19.0',
'v24.14.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.22.22',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -155,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -37,9 +37,9 @@ For more installation options and troubleshooting tips, see
Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* macOS (Monterey and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 140
node_module_version = 143
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"
@@ -19,15 +19,15 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false
dawn_enable_vulkan_validation_layers = false
# Removes dxc dll's that are only used experimentally.
# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
dawn_use_built_dxc = false
# These are disabled because they cause the zip manifest to differ between
# testing and release builds.
# See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.

View File

@@ -383,6 +383,8 @@ static_library("chrome") {
"//chrome/browser/pdf/chrome_pdf_stream_delegate.h",
"//chrome/browser/pdf/pdf_extension_util.cc",
"//chrome/browser/pdf/pdf_extension_util.h",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.cc",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.h",
"//chrome/browser/pdf/pdf_viewer_stream_manager.cc",
"//chrome/browser/pdf/pdf_viewer_stream_manager.h",
"//chrome/browser/plugins/pdf_iframe_navigation_throttle.cc",
@@ -391,6 +393,8 @@ static_library("chrome") {
deps += [
"//components/pdf/browser",
"//components/pdf/renderer",
"//ui/base/interaction",
"//ui/webui/resources/cr_components/help_bubble:mojo_bindings",
]
}
} else {

View File

@@ -250,7 +250,9 @@ Returns:
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
### Event: 'browser-window-blur'
@@ -421,6 +423,7 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.
@@ -610,7 +613,7 @@ Returns `string` - The current application directory.
may backup this directory to cloud storage.
* `sessionData` The directory for storing data generated by `Session`, such
as localStorage, cookies, disk cache, downloaded dictionaries, network
state, devtools files. By default this points to `userData`. Chromium may
state, DevTools files. By default this points to `userData`. Chromium may
write very large disk cache here, so if your app does not rely on browser
storage like localStorage or cookies to save user data, it is recommended
to set this directory to other locations to avoid polluting the `userData`
@@ -631,7 +634,7 @@ Returns `string` - The current application directory.
Returns `string` - A path to a special directory or file associated with `name`. On
failure, an `Error` is thrown.
If `app.getPath('logs')` is called without called `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
If `app.getPath('logs')` is called without calling `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
### `app.getFileIcon(path[, options])`
@@ -646,7 +649,7 @@ Returns `Promise<NativeImage>` - fulfilled with the app's icon, which is a [Nati
Fetches a path's associated icon.
On _Windows_, there a 2 kinds of icons:
On _Windows_, there are 2 kinds of icons:
* Icons associated with certain file extensions, like `.mp3`, `.png`, etc.
* Icons inside the file itself, like `.exe`, `.dll`, `.ico`.
@@ -762,7 +765,7 @@ app.getPreferredSystemLanguages() // ['fr-CA', 'en-US', 'zh-Hans-FI', 'es-419']
Both the available languages and regions and the possible return values differ between the two operating systems.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region,and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region, and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
### `app.addRecentDocument(path)` _macOS_ _Windows_
@@ -1120,6 +1123,19 @@ Updates the current activity if its type matches `type`, merging the entries fro
Changes the [Application User Model ID][app-user-model-id] to `id`.
### `app.setToastActivatorCLSID(id)` _Windows_
* `id` string
Changes the [Toast Activator CLSID][toast-activator-clsid] to `id`. If one is not set via this method, it will be randomly generated for the app.
* The value must be a valid GUID/CLSID in one of the following forms:
* Canonical brace-wrapped: `{XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX}` (preferred)
* Canonical without braces: `XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX` (braces will be added automatically)
* Hex digits are case-insensitive.
This method should be called early (before showing notifications) so the value is baked into the registration/shortcut. Supplying an empty string or an unparsable value throws and leaves the existing (or generated) CLSID unchanged. If this method is never called, a random CLSID is generated once per run and exposed via `app.toastActivatorCLSID`.
### `app.setActivationPolicy(policy)` _macOS_
* `policy` string - Can be 'regular', 'accessory', or 'prohibited'.
@@ -1214,10 +1230,17 @@ Disables hardware acceleration for current app.
This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently enabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.
### `app.disableDomainBlockingFor3DAPIs()`
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
domain basis if the GPU processes crashes too frequently. This function
domain basis if the GPU process crashes too frequently. This function
disables that behavior.
This method can only be called before app is ready.
@@ -1276,6 +1299,8 @@ For `infoType` equal to `basic`:
Using `basic` should be preferred if only basic information like `vendorId` or `deviceId` is needed.
Promise is rejected if the GPU is completely disabled, i.e. no hardware and software implementations are available.
### `app.setBadgeCount([count])` _Linux_ _macOS_
* `count` Integer (optional) - If a value is provided, set the badge to the provided value otherwise, on macOS, display a plain white dot (e.g. unknown number of notifications). On Linux, if a value is not provided the badge will not display.
@@ -1306,7 +1331,7 @@ Returns `boolean` - Whether the current desktop environment is Unity launcher.
### `app.getLoginItemSettings([options])` _macOS_ _Windows_
* `options` Object (optional)
* `type` string (optional) _macOS_ - Can be one of `mainAppService`, `agentService`, `daemonService`, or `loginItemService`. Defaults to `mainAppService`. Only available on macOS 13 and up. See [app.setLoginItemSettings](app.md#appsetloginitemsettingssettings-macos-windows) for more information about each type.
* `type` string (optional) _macOS_ - Can be `mainAppService`, `agentService`, `daemonService`, or `loginItemService`. Defaults to `mainAppService`. Only available on macOS 13 and up. See [app.setLoginItemSettings](app.md#appsetloginitemsettingssettings-macos-windows) for more information about each type.
* `serviceName` string (optional) _macOS_ - The name of the service. Required if `type` is non-default. Only available on macOS 13 and up.
* `path` string (optional) _Windows_ - The executable path to compare against. Defaults to `process.execPath`.
* `args` string[] (optional) _Windows_ - The command-line arguments to compare against. Defaults to an empty array.
@@ -1321,13 +1346,13 @@ Returns `Object`:
* `wasOpenedAtLogin` boolean _macOS_ - `true` if the app was opened at login automatically.
* `wasOpenedAsHidden` boolean _macOS_ _Deprecated_ - `true` if the app was opened as a hidden login item. This indicates that the app should not open any windows at startup. This setting is not available on [MAS builds][mas-builds] or on macOS 13 and up.
* `restoreState` boolean _macOS_ _Deprecated_ - `true` if the app was opened as a login item that should restore the state from the previous session. This indicates that the app should restore the windows that were open the last time the app was closed. This setting is not available on [MAS builds][mas-builds] or on macOS 13 and up.
* `status` string _macOS_ - can be one of `not-registered`, `enabled`, `requires-approval`, or `not-found`.
* `status` string _macOS_ - can be `not-registered`, `enabled`, `requires-approval`, or `not-found`.
* `executableWillLaunchAtLogin` boolean _Windows_ - `true` if app is set to open at login and its run key is not deactivated. This differs from `openAtLogin` as it ignores the `args` option, this property will be true if the given executable would be launched at login with **any** arguments.
* `launchItems` Object[] _Windows_
* `name` string _Windows_ - name value of a registry entry.
* `path` string _Windows_ - The executable to an app that corresponds to a registry entry.
* `args` string[] _Windows_ - the command-line arguments to pass to the executable.
* `scope` string _Windows_ - one of `user` or `machine`. Indicates whether the registry entry is under `HKEY_CURRENT USER` or `HKEY_LOCAL_MACHINE`.
* `scope` string _Windows_ - can be `user` or `machine`. Indicates whether the registry entry is under `HKEY_CURRENT USER` or `HKEY_LOCAL_MACHINE`.
* `enabled` boolean _Windows_ - `true` if the app registry key is startup approved and therefore shows as `enabled` in Task Manager and Windows settings.
### `app.setLoginItemSettings(settings)` _macOS_ _Windows_
@@ -1397,7 +1422,75 @@ details. Disabled by default.
This API must be called after the `ready` event is emitted.
> [!NOTE]
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
Notes:
* The array may be empty if no accessibility modes are active.
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
prefer this method for granular diagnostics or telemetry.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
// Change some app UI to better work with Screen Readers.
}
})
```
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
* `features` string[] - An array of the accessibility features to enable.
Possible values are:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
To disable all supported features, pass an empty array `[]`.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
// Enable a subset of features:
app.setAccessibilitySupportFeatures([
'screenReader',
'pdfPrinting',
'webContents'
])
// Other logic
// Some time later, disable all features:
app.setAccessibilitySupportFeatures([])
})
```
### `app.showAboutPanel()`
@@ -1625,8 +1718,13 @@ platforms) that allows you to perform actions on your app icon in the user's doc
A `boolean` property that returns `true` if the app is packaged, `false` otherwise. For many apps, this property can be used to distinguish development and production environments.
### `app.toastActivatorCLSID` _Windows_ _Readonly_
A `string` property that returns the app's [Toast Activator CLSID][toast-activator-clsid].
[tasks]:https://learn.microsoft.com/en-us/windows/win32/shell/taskbar-extensions#tasks
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[toast-activator-clsid]: https://learn.microsoft.com/en-us/windows/win32/properties/props-system-appusermodel-toastactivatorclsid
[electron-forge]: https://www.electronforge.io/
[electron-packager]: https://github.com/electron/packager
[CFBundleURLTypes]: https://developer.apple.com/library/ios/documentation/General/Reference/InfoPlistKeyReference/Articles/CoreFoundationKeys.html#//apple_ref/doc/uid/TP40009249-102207-TPXREF115

View File

@@ -32,9 +32,19 @@ update process. Apps that need to disable ATS can add the
### Windows
On Windows, you have to install your app into a user's machine before you can
use the `autoUpdater`, so it is recommended that you use
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib] to generate a Windows installer.
On Windows, the `autoUpdater` module automatically selects the appropriate update mechanism
based on how your app is packaged:
* **MSIX packages**: If your app is running as an MSIX package (created with [electron-windows-msix][msix-lib] and detected via [`process.windowsStore`](process.md#processwindowsstore-readonly)),
the module uses the MSIX updater, which supports direct MSIX file links and JSON update feeds.
* **Squirrel.Windows**: For apps installed via traditional installers (created with
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib]),
the module uses Squirrel.Windows for updates.
You don't need to configure which updater to use; Electron automatically detects the packaging
format and uses the appropriate one.
#### Squirrel.Windows
Apps built with Squirrel.Windows will trigger [custom launch events](https://github.com/Squirrel/Squirrel.Windows/blob/51f5e2cb01add79280a53d51e8d0cfa20f8c9f9f/docs/using/custom-squirrel-events-non-cs.md#application-startup-commands)
that must be handled by your Electron application to ensure proper setup and teardown.
@@ -55,6 +65,14 @@ The installer generated with Squirrel.Windows will create a shortcut icon with a
same ID for your app with `app.setAppUserModelId` API, otherwise Windows will
not be able to pin your app properly in task bar.
#### MSIX Packages
When your app is packaged as an MSIX, the `autoUpdater` module provides additional
functionality:
* Use the `allowAnyVersion` option in `setFeedURL()` to allow updates to older versions (downgrades)
* Support for direct MSIX file links or JSON update feeds (similar to Squirrel.Mac format)
## Events
The `autoUpdater` object emits the following events:
@@ -92,7 +110,7 @@ Returns:
Emitted when an update has been downloaded.
On Windows only `releaseName` is available.
With Squirrel.Windows only `releaseName` is available.
> [!NOTE]
> It is not strictly necessary to handle this event. A successfully
@@ -100,6 +118,13 @@ On Windows only `releaseName` is available.
### Event: 'before-quit-for-update'
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/12619
```
-->
This event is emitted after a user calls `quitAndInstall()`.
When this API is called, the `before-quit` event is not emitted before all windows are closed. As a result you should listen to this event if you wish to perform actions before the windows are closed while a process is quitting, as well as listening to `before-quit`.
@@ -110,11 +135,23 @@ The `autoUpdater` object has the following methods:
### `autoUpdater.setFeedURL(options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/5879
description: "Added `headers` as a second parameter."
- pr-url: https://github.com/electron/electron/pull/11925
description: "Changed API to accept a single `options` argument (contains `url`, `headers`, and `serverType` properties)."
```
-->
* `options` Object
* `url` string
* `url` string - The update server URL. For _Windows_ MSIX, this can be either a direct link to an MSIX file (e.g., `https://example.com/update.msix`) or a JSON endpoint that returns update information (see the [Squirrel.Mac][squirrel-mac] README for more information).
* `headers` Record\<string, string\> (optional) _macOS_ - HTTP request headers.
* `serverType` string (optional) _macOS_ - Can be `json` or `default`, see the [Squirrel.Mac][squirrel-mac]
README for more information.
* `allowAnyVersion` boolean (optional) _Windows_ - If `true`, allows downgrades to older versions for MSIX packages.
Defaults to `false`.
Sets the `url` and initialize the auto updater.
@@ -151,3 +188,4 @@ closed.
[electron-forge-lib]: https://www.electronforge.io/config/makers/squirrel.windows
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[event-emitter]: https://nodejs.org/api/events.html#events_class_eventemitter
[msix-lib]: https://github.com/electron-userland/electron-windows-msix

View File

@@ -351,7 +351,11 @@ Emitted when the window has closed a sheet.
#### Event: 'new-window-for-tab' _macOS_
Emitted when the native new tab button is clicked.
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
#### Event: 'system-context-menu' _Windows_ _Linux_
@@ -756,6 +760,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -969,6 +976,9 @@ Moves window to `x` and `y`.
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1043,7 +1053,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1262,15 +1272,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1294,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -431,7 +431,11 @@ Emitted when the window has closed a sheet.
#### Event: 'new-window-for-tab' _macOS_
Emitted when the native new tab button is clicked.
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
#### Event: 'system-context-menu' _Windows_ _Linux_
@@ -849,6 +853,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -1062,6 +1069,9 @@ Moves window to `x` and `y`.
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1134,7 +1144,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1227,7 +1237,8 @@ Captures a snapshot of the page within `rect`. Omitting `rect` will capture the
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see [`did-fail-load`](web-contents.md#event-did-fail-load)).
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Same as [`webContents.loadURL(url[, options])`](web-contents.md#contentsloadurlurl-options).
@@ -1442,15 +1453,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1463,11 +1475,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -25,6 +25,11 @@ following properties:
with which the request is associated. Defaults to the empty string. The
`session` option supersedes `partition`. Thus if a `session` is explicitly
specified, `partition` is ignored.
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
custom protocol handlers registered for the request's URL scheme will not be
called. This allows forwarding an intercepted request to the built-in
handler. [webRequest](web-request.md) handlers will still be triggered
when bypassing custom protocols. Defaults to `false`.
* `credentials` string (optional) - Can be `include`, `omit` or
`same-origin`. Whether to send
[credentials](https://fetch.spec.whatwg.org/#credentials) with this
@@ -259,7 +264,7 @@ will not be allowed. The `finish` event is emitted just after the end operation.
Cancels an ongoing HTTP transaction. If the request has already emitted the
`close` event, the abort operation will have no effect. Otherwise an ongoing
event will emit `abort` and `close` events. Additionally, if there is an ongoing
response object,it will emit the `aborted` event.
response object, it will emit the `aborted` event.
#### `request.followRedirect()`

View File

@@ -2,10 +2,13 @@
> Perform copy and paste operations on the system clipboard.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) _Deprecated_ (non-sandboxed only)
> [!NOTE]
> Using the `clipboard` API from the renderer process is deprecated.
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> If you want to call this API from a renderer process,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.

View File

@@ -168,7 +168,7 @@ Enables net log events to be saved and writes them to `path`.
Sets the verbosity of logging when used together with `--enable-logging`.
`N` should be one of [Chrome's LogSeverities][severities].
Note that two complimentary logging mechanisms in Chromium -- `LOG()`
Note that two complementary logging mechanisms in Chromium -- `LOG()`
and `VLOG()` -- are controlled by different switches. `--log-level`
controls `LOG()` messages, while `--v` and `--vmodule` control `VLOG()`
messages. So you may want to use a combination of these three switches
@@ -193,6 +193,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated
@@ -308,7 +313,7 @@ By default inspector websocket url is available in stderr and under /json/list e
### `--experimental-network-inspection`
Enable support for devtools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
Enable support for DevTools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
### `--no-deprecation`
@@ -361,6 +366,13 @@ Keep in mind that standalone switches can sometimes be split into individual fea
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
### Chromium features relevant to Electron apps
* `AlwaysLogLOAFURL`: enables script attribution for
[`long-animation-frame`](https://developer.mozilla.org/en-US/docs/Web/API/Performance_API/Long_animation_frame_timing)
`PerformanceObserver` events for non-http(s), non-data, non-blob URLs (such as `file:` or custom
protocol URLs).
[app]: app.md
[append-switch]: command-line.md#commandlineappendswitchswitch-value
[debugging-main-process]: ../tutorial/debugging-main-process.md

View File

@@ -49,7 +49,7 @@ Use the `system-ui` keyword to match the smoothness to the OS design language.
| Value: | `60%` | `0%` |
| Example: | ![A rectangle with round corners whose smoothness matches macOS](../images/corner-smoothing-example-60.svg) | ![A rectangle with round corners whose smoothness matches Windows and Linux](../images/corner-smoothing-example-0.svg) |
### Controlling availibility
### Controlling availability
This CSS rule can be disabled using the Blink feature flag `ElectronCSSCornerSmoothing`.

View File

@@ -44,7 +44,7 @@ Returns:
* `reason` string - Reason for detaching debugger.
Emitted when the debugging session is terminated. This happens either when
`webContents` is closed or devtools is invoked for the attached `webContents`.
`webContents` is closed or DevTools is invoked for the attached `webContents`.
#### Event: 'message'

View File

@@ -94,14 +94,45 @@ The `desktopCapturer` module has the following methods:
Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`DesktopCapturerSource`](structures/desktop-capturer-source.md) objects, each `DesktopCapturerSource` represents a screen or an individual window that can be captured.
> [!NOTE]
> Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher,
> which can detected by [`systemPreferences.getMediaAccessStatus`][].
> * Capturing audio requires `NSAudioCaptureUsageDescription` Info.plist key on macOS 14.2 Sonoma and higher - [read more](#macos-versions-142-or-higher).
> * Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher, which can detected by [`systemPreferences.getMediaAccessStatus`][].
[`navigator.mediaDevices.getUserMedia`]: https://developer.mozilla.org/en/docs/Web/API/MediaDevices/getUserMedia
[`systemPreferences.getMediaAccessStatus`]: system-preferences.md#systempreferencesgetmediaaccessstatusmediatype-windows-macos
## Caveats
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
### Linux
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
---
### MacOS versions 14.2 or higher
`NSAudioCaptureUsageDescription` Info.plist key must be added in-order for audio to be captured by `desktopCapturer`. If instead you are running electron from another program like a terminal or IDE then that parent program must contain the Info.plist key.
This is in order to facillitate use of Apple's new [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps#Configure-the-sample-code-project) by Chromium.
> [!WARNING]
> Failure of `desktopCapturer` to start an audio stream due to `NSAudioCaptureUsageDescription` permission not present will still create a dead audio stream however no warnings or errors are displayed.
As of electron `v39.0.0-beta.4` Chromium [made Apple's new `CoreAudio Tap API` the default](https://source.chromium.org/chromium/chromium/src/+/ad17e8f8b93d5f34891b06085d373a668918255e) for desktop audio capture. There is no fallback to the older `Screen & System Audio Recording` permissions system even if [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps) stream creation fails.
If you need to continue using `Screen & System Audio Recording` permissions for `desktopCapturer` on macOS versions 14.2 and later, you can apply a chromium feature flag to force use of that older permissions system:
```js
// main.js (right beneath your require/import statments)
app.commandLine.appendSwitch('disable-features', 'MacCatapLoopbackAudioForScreenShare')
```
---
### MacOS versions 12.7.6 or lower
`navigator.mediaDevices.getUserMedia` does not work on macOS versions 12.7.6 and prior for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this. Only in macOS 13 and onwards does Apple provide APIs to capture desktop audio without the need for a signed kernel extension.
It is possible to circumvent this limitation by capturing system audio with another macOS app like [BlackHole](https://existential.audio/blackhole/) or [Soundflower](https://rogueamoeba.com/freebies/soundflower/) and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -344,7 +344,7 @@ Displays a modal dialog that shows an error message.
This API can be called safely before the `ready` event the `app` module emits,
it is usually used to report errors in early stage of startup. If called
before the app `ready`event on Linux, the message will be emitted to stderr,
before the app `ready` event on Linux, the message will be emitted to stderr,
and no GUI dialog will appear.
### `dialog.showCertificateTrustDialog([window, ]options)` _macOS_ _Windows_

View File

@@ -159,6 +159,22 @@ Notification activated (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76
Notification replied to (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76-F88EC9D73D44)
```
### `ELECTRON_DEBUG_MSIX_UPDATER`
Adds extra logs to MSIX updater operations on Windows to aid in debugging. Extra logging will be displayed when MSIX update operations are initiated, including package updates, package registration, and restart registration. This helps diagnose issues with MSIX package updates and deployments.
Sample output:
```sh
UpdateMsix called with URI: https://example.com/app.msix
DoUpdateMsix: Starting
Calling AddPackageByUriAsync... URI: https://example.com/app.msix
Update options - deferRegistration: true, developerMode: false, forceShutdown: false, forceTargetShutdown: false, forceUpdateFromAnyVersion: false
Waiting for deployment...
Deployment finished.
MSIX Deployment completed.
```
### `ELECTRON_LOG_ASAR_READS`
When Electron reads from an ASAR file, log the read offset and file path to
@@ -187,13 +203,13 @@ the one downloaded by `npm install`. Usage:
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
## Set By Electron
### `ELECTRON_SKIP_BINARY_DOWNLOAD`
Electron sets some variables in your environment at runtime.
If you want to install your project's dependencies but don't need to use Electron functionality,
you can set the `ELECTRON_SKIP_BINARY_DOWNLOAD` environment variable to prevent the binary from being
downloaded. For instance, this feature can be useful in continuous integration environments when
running unit tests that mock out the `electron` module.
### `ORIGINAL_XDG_CURRENT_DESKTOP`
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
to affect other logic within Chromium so if you want access to the _original_ value
you should look up this environment variable instead.
```sh
ELECTRON_SKIP_BINARY_DOWNLOAD=1 npm install
```

View File

@@ -57,7 +57,7 @@ The following methods are available on instances of `Extensions`:
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -83,7 +83,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.extensions.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -34,7 +34,7 @@ Returns:
* `error` Error - Typically holds an error string identifying failure root cause.
Emitted when an error was encountered while streaming response data events. For
instance, if the server closes the underlying while the response is still
instance, if the server closes the underlying connection while the response is still
streaming, an `error` event will be emitted on the response object and a `close`
event will subsequently follow on the request object.

View File

@@ -17,7 +17,7 @@ See [`Menu`](menu.md) for examples.
* `options` Object
* `click` Function (optional) - Will be called with
`click(menuItem, window, event)` when the menu item is clicked.
* `menuItem` MenuItem
* `menuItem` [MenuItem](menu-item.md)
* `window` [BaseWindow](base-window.md) | undefined - This will not be defined if no window is open.
* `event` [KeyboardEvent](structures/keyboard-event.md)
* `role` string (optional) - Can be `undo`, `redo`, `cut`, `copy`, `paste`, `pasteAndMatchStyle`, `delete`, `selectAll`, `reload`, `forceReload`, `toggleDevTools`, `resetZoom`, `zoomIn`, `zoomOut`, `toggleSpellChecker`, `togglefullscreen`, `window`, `minimize`, `close`, `help`, `about`, `services`, `hide`, `hideOthers`, `unhide`, `quit`, `showSubstitutions`, `toggleSmartQuotes`, `toggleSmartDashes`, `toggleTextReplacement`, `startSpeaking`, `stopSpeaking`, `zoom`, `front`, `appMenu`, `fileMenu`, `editMenu`, `viewMenu`, `shareMenu`, `recentDocuments`, `toggleTabBar`, `selectNextTab`, `selectPreviousTab`, `showAllTabs`, `mergeAllWindows`, `clearRecentDocuments`, `moveTabToNewWindow` or `windowMenu` - Define the action of the menu item, when specified the
@@ -34,7 +34,8 @@ See [`Menu`](menu.md) for examples.
* `sublabel` string (optional) _macOS_ - Available in macOS >= 14.4
* `toolTip` string (optional) _macOS_ - Hover text for this menu item.
* `accelerator` string (optional) - An [Accelerator](../tutorial/keyboard-shortcuts.md#accelerators) string.
* `icon` ([NativeImage](native-image.md) | string) (optional)
* `icon` ([NativeImage](native-image.md) | string) (optional) - Can be a
[NativeImage](native-image.md) or the file path of an icon.
* `enabled` boolean (optional) - If false, the menu item will be greyed out and
unclickable.
* `acceleratorWorksWhenHidden` boolean (optional) _macOS_ - default is `true`, and when `false` will prevent the accelerator from triggering the item if the item is not visible.
@@ -90,7 +91,7 @@ It can be called with `menuItem.click(event, focusedWindow, focusedWebContents)`
#### `menuItem.submenu`
A `Menu` (optional) containing the menu
A [`Menu`](menu.md) (optional) containing the menu
item's submenu, if present.
#### `menuItem.type`
@@ -106,7 +107,7 @@ A `string` (optional) indicating the item's role, if set. Can be `undo`, `redo`,
#### `menuItem.accelerator`
An `Accelerator` (optional) indicating the item's accelerator, if set.
An `Accelerator | null` indicating the item's accelerator, if set.
#### `menuItem.userAccelerator` _Readonly_ _macOS_
@@ -170,4 +171,4 @@ A `number` indicating an item's sequential unique id.
#### `menuItem.menu`
A `Menu` that the item is a part of.
A [`Menu`](menu.md) that the item is a part of.

View File

@@ -23,7 +23,7 @@ The `Menu` class has the following static methods:
#### `Menu.setApplicationMenu(menu)`
- `menu` Menu | null
- `menu` [Menu](menu.md) | null
Sets `menu` as the application menu on macOS. On Windows and Linux, the
`menu` will be set as each window's top menu.
@@ -34,7 +34,7 @@ indicate which letter should get a generated accelerator. For example, using
opens the associated menu. The indicated character in the button label then gets an
underline, and the `&` character is not displayed on the button label.
In order to escape the `&` character in an item name, add a proceeding `&`. For example, `&&File` would result in `&File` displayed on the button label.
In order to escape the `&` character in an item name, add a preceding `&`. For example, `&&File` would result in `&File` displayed on the button label.
Passing `null` will suppress the default menu. On Windows and Linux,
this has the additional effect of removing the menu bar from the window.
@@ -65,9 +65,9 @@ for more information on macOS' native actions.
#### `Menu.buildFromTemplate(template)`
- `template` (MenuItemConstructorOptions | MenuItem)[]
- `template` (MenuItemConstructorOptions | [MenuItem](menu-item.md))[]
Returns `Menu`
Returns [`Menu`](menu.md)
Generally, the `template` is an array of `options` for constructing a
[MenuItem](menu-item.md). The usage can be referenced above.

View File

@@ -202,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
Returns `NativeImage`
Creates a new `NativeImage` instance from the `NSImage` that maps to the
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
documentation for a list of possible values.
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
The `hslShift` is applied to the image with the following rules:
@@ -231,6 +230,15 @@ echo -e '#import <Cocoa/Cocoa.h>\nint main() { NSLog(@"%@", SYSTEM_IMAGE_NAME);
where `SYSTEM_IMAGE_NAME` should be replaced with any value from [this list](https://developer.apple.com/documentation/appkit/nsimagename?language=objc).
For SF Symbols, usage looks as follows:
```js
const image = nativeImage.createFromNamedImage('square.and.pencil')
```
where `'square.and.pencil'` is the symbol name from the
[SF Symbols app](https://developer.apple.com/sf-symbols/).
## Class: NativeImage
> Natively wrap images such as tray, dock, and application icons.

View File

@@ -36,7 +36,7 @@ everything will be reset to the OS default. By default `themeSource` is `system
Settings this property to `dark` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `true` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the dark UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the dark UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the dark UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `dark` mode.
* The `updated` event will be emitted
@@ -44,7 +44,7 @@ Settings this property to `dark` will have the following effects:
Settings this property to `light` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `false` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the light UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the light UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the light UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `light` mode.
* The `updated` event will be emitted
@@ -83,4 +83,4 @@ Currently, Windows high contrast is the only system setting that triggers forced
### `nativeTheme.prefersReducedTransparency` _Readonly_
A `boolean` that indicates the whether the user has chosen via system accessibility settings to reduce transparency at the OS level.
A `boolean` that indicates whether the user has chosen via system accessibility settings to reduce transparency at the OS level.

View File

@@ -67,6 +67,22 @@ Emitted when the notification is shown to the user. Note that this event can be
multiple times as a notification can be shown multiple times through the
`show()` method.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('show', () => console.log('Notification shown!'))
n.show()
})
```
#### Event: 'click'
Returns:
@@ -75,6 +91,22 @@ Returns:
Emitted when the notification is clicked by the user.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('click', () => console.log('Notification clicked!'))
n.show()
})
```
#### Event: 'close'
Returns:
@@ -88,21 +120,85 @@ is closed.
On Windows, the `close` event can be emitted in one of three ways: programmatic dismissal with `notification.close()`, by the user closing the notification, or via system timeout. If a notification is in the Action Center after the initial `close` event is emitted, a call to `notification.close()` will remove the notification from the action center but the `close` event will not be emitted again.
#### Event: 'reply' _macOS_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('close', () => console.log('Notification closed!'))
n.show()
})
```
#### Event: 'reply' _macOS_ _Windows_
Returns:
* `event` Event
* `reply` string - The string the user entered into the inline reply field.
* `details` Event\<\>
* `reply` string - The string the user entered into the inline reply field.
* `reply` string _Deprecated_
Emitted when the user clicks the "Reply" button on a notification with `hasReply: true`.
#### Event: 'action' _macOS_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Send a Message',
body: 'Body Text',
hasReply: true,
replyPlaceholder: 'Message text...'
})
n.on('reply', (e, reply) => console.log(`User replied: ${reply}`))
n.on('click', () => console.log('Notification clicked'))
n.show()
})
```
#### Event: 'action' _macOS_ _Windows_
Returns:
* `event` Event
* `index` number - The index of the action that was activated.
* `details` Event\<\>
* `actionIndex` number - The index of the action that was activated.
* `selectionIndex` number _Windows_ - The index of the selected item, if one was chosen. -1 if none was chosen.
* `actionIndex` number _Deprecated_
* `selectionIndex` number _Windows_ _Deprecated_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const items = ['One', 'Two', 'Three']
const n = new Notification({
title: 'Choose an Action!',
actions: [
{ type: 'button', text: 'Action 1' },
{ type: 'button', text: 'Action 2' },
{ type: 'selection', text: 'Apply', items }
]
})
n.on('click', () => console.log('Notification clicked'))
n.on('action', (e) => {
console.log(`User triggered action at index: ${e.actionIndex}`)
if (e.selectionIndex > -1) {
console.log(`User chose selection item '${items[e.selectionIndex]}'`)
}
})
n.show()
})
```
#### Event: 'failed' _Windows_
@@ -113,6 +209,22 @@ Returns:
Emitted when an error is encountered while creating and showing the native notification.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Bad Action'
})
n.on('failed', (e, err) => {
console.log('Notification failed: ', err)
})
n.show()
})
```
### Instance Methods
Objects created with the `new Notification()` constructor have the following instance methods:
@@ -126,12 +238,42 @@ call this method before the OS will display it.
If the notification has been shown before, this method will dismiss the previously
shown notification and create a new one with identical properties.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.show()
})
```
#### `notification.close()`
Dismisses the notification.
On Windows, calling `notification.close()` while the notification is visible on screen will dismiss the notification and remove it from the Action Center. If `notification.close()` is called after the notification is no longer visible on screen, calling `notification.close()` will try remove it from the Action Center.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.show()
setTimeout(() => n.close(), 5000)
})
```
### Instance Properties
#### `notification.title`

View File

@@ -71,7 +71,7 @@ will disable the support for `asar` archives in Node's built-in modules.
### `process.noDeprecation`
A `boolean` that controls whether or not deprecation warnings are printed to `stderr`.
A `boolean` (optional) that controls whether or not deprecation warnings are printed to `stderr`.
Setting this to `true` will silence deprecation warnings. This property is used
instead of the `--no-deprecation` command line flag.
@@ -99,13 +99,13 @@ property is used instead of the `--throw-deprecation` command line flag.
A `boolean` that controls whether or not deprecations printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for deprecations.
This property is instead of the `--trace-deprecation` command line flag.
This property is used instead of the `--trace-deprecation` command line flag.
### `process.traceProcessWarnings`
A `boolean` that controls whether or not process warnings printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for process warnings
(including deprecations). This property is instead of the `--trace-warnings` command
(including deprecations). This property is used instead of the `--trace-warnings` command
line flag.
### `process.type` _Readonly_
@@ -128,8 +128,8 @@ A `string` representing Electron's version string.
### `process.windowsStore` _Readonly_
A `boolean`. If the app is running as a Windows Store app (appx), this property is `true`,
for otherwise it is `undefined`.
A `boolean`. If the app is running as an MSIX package (including AppX for Windows Store),
this property is `true`, otherwise it is `undefined`.
### `process.contextId` _Readonly_

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session
@@ -1216,7 +1216,7 @@ function createWindow () {
mainWindow.webContents.session.setBluetoothPairingHandler((details, callback) => {
bluetoothPinCallback = callback
// Send a IPC message to the renderer to prompt the user to confirm the pairing.
// Send an IPC message to the renderer to prompt the user to confirm the pairing.
// Note that this will require logic in the renderer to handle this message and
// display a prompt to the user.
mainWindow.webContents.send('bluetooth-pairing-request', details)
@@ -1264,7 +1264,7 @@ session.defaultSession.allowNTLMCredentialsForDomains('*')
Overrides the `userAgent` and `acceptLanguages` for this session.
The `acceptLanguages` must a comma separated ordered list of language codes, for
The `acceptLanguages` must be a comma separated ordered list of language codes, for
example `"en-US,fr,de,ko,zh-CN,ja"`.
This doesn't affect existing `WebContents`, and each `WebContents` can use
@@ -1512,7 +1512,7 @@ will not work on non-persistent (in-memory) sessions.
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -1538,7 +1538,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -9,6 +9,13 @@ For including the share menu as a submenu of other menus, please use the
## Class: ShareMenu
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25629
```
-->
> Create share menu on macOS.
Process: [Main](../glossary.md#main-process)

View File

@@ -0,0 +1,58 @@
# sharedTexture
> Import shared textures into Electron and converts platform specific handles into [`VideoFrame`](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame). Supports all Web rendering systems, and can be transferred across Electron processes. Read [here](../../shell/common/api/shared_texture/README.md) for more information.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
## Methods
The `sharedTexture` module has the following methods:
**Note:** Experimental APIs are marked as such and could be removed in the future.
### `sharedTexture.importSharedTexture(options)` _Experimental_
* `options` Object - Options for importing shared textures.
* `textureInfo` [SharedTextureImportTextureInfo](structures/shared-texture-import-texture-info.md) - The information of the shared texture to import.
* `allReferencesReleased` Function (optional) - Called when all references in all processes are released. You should keep the imported texture valid until this callback is called.
Imports the shared texture from the given options.
> [!NOTE]
> This method is only available in the main process.
Returns `SharedTextureImported` - The imported shared texture.
### `sharedTexture.sendSharedTexture(options, ...args)` _Experimental_
* `options` Object - Options for sending shared texture.
* `frame` [WebFrameMain](web-frame-main.md) - The target frame to transfer the shared texture to. For `WebContents`, you can pass `webContents.mainFrame`. If you provide a `webFrameMain` that is not a main frame, you'll need to enable `webPreferences.nodeIntegrationInSubFrames` for this, since this feature requires [IPC](https://www.electronjs.org/docs/latest/api/web-frame-main#frameipc-readonly) between main and the frame.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments to pass to the renderer process.
Send the imported shared texture to a renderer process. You must register a receiver at renderer process before calling this method. This method has a 1000ms timeout. Ensure the receiver is set and the renderer process is alive before calling this method.
> [!NOTE]
> This method is only available in the main process.
Returns `Promise<void>` - Resolves when the transfer is complete.
### `sharedTexture.setSharedTextureReceiver(callback)` _Experimental_
* `callback` Function\<Promise\<void\>\> - The function to receive the imported shared texture.
* `receivedSharedTextureData` Object - The data received from the main process.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments passed from the main process.
Set a callback to receive imported shared textures from the main process.
> [!NOTE]
> This method is only available in the renderer process.
## Properties
The `sharedTexture` module has the following properties:
### `sharedTexture.subtle` _Experimental_
A [`SharedTextureSubtle`](structures/shared-texture-subtle.md) property, provides subtle APIs for interacting with shared texture for advanced users.

View File

@@ -29,6 +29,14 @@ Show the given file in a file manager. If possible, select the file.
### `shell.openPath(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/20682
breaking-changes-header: api-changed-shellopenitem-is-now-shellopenpath
```
-->
* `path` string
Returns `Promise<string>` - Resolves with a string containing the error message corresponding to the failure if a failure occurred, otherwise "".
@@ -37,6 +45,18 @@ Open the given file in the desktop's default manner.
### `shell.openExternal(url[, options])`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/4508
description: "Added `activate` option."
- pr-url: https://github.com/electron/electron/pull/15065
description: "Added `workingDirectory` option."
- pr-url: https://github.com/electron/electron/pull/37139
description: "Added `logUsage` option."
```
-->
* `url` string - Max 2081 characters on Windows.
* `options` Object (optional)
* `activate` boolean (optional) _macOS_ - `true` to bring the opened application to the foreground. The default is `true`.
@@ -50,6 +70,14 @@ Open the given external protocol URL in the desktop's default manner. (For examp
### `shell.trashItem(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25114
breaking-changes-header: deprecated-shellmoveitemtotrash
```
-->
* `path` string - path to the item to be moved to the trash.
Returns `Promise<void>` - Resolves when the operation has been completed.
@@ -58,6 +86,10 @@ Rejects if there was an error while deleting the requested item.
This moves a path to the OS-specific trash location (Trash on macOS, Recycle
Bin on Windows, and a desktop-environment-specific location on Linux).
The path must use the default path separator for the platform (backslash on
Windows). Use `path.resolve()` from the `node:path` module to ensure correct
handling on all filesystems.
### `shell.beep()`
Play the beep sound.

View File

@@ -72,6 +72,9 @@
some GTK+3 desktop environments. Default is `false`.
* `transparent` boolean (optional) - Makes the window [transparent](../../tutorial/custom-window-styles.md#transparent-windows).
Default is `false`. On Windows, does not work unless the window is frameless.
When you add a [`View`](../view.md) to a `BaseWindow`, you'll need to call
[`view.setBackgroundColor`](../view.md#viewsetbackgroundcolorcolor) with a transparent
background color on that view to make its background transparent as well.
* `type` string (optional) - The type of window, default is normal window. See more about
this below.
* `visualEffectState` string (optional) _macOS_ - Specify how the material
@@ -99,12 +102,13 @@
* `trafficLightPosition` [Point](point.md) (optional) _macOS_ -
Set a custom position for the traffic light buttons in frameless windows.
* `roundedCorners` boolean (optional) _macOS_ _Windows_ - Whether frameless window
should have rounded corners. Default is `true`. Setting this property
to `false` will prevent the window from being fullscreenable on macOS.
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
* `thickFrame` boolean (optional) - Use `WS_THICKFRAME` style for frameless windows on
Windows, which adds standard window frame. Setting it to `false` will remove
window shadow and window animations. Default is `true`.
should have rounded corners. Default is `true`. On Windows versions older than
Windows 11 Build 22000 this property has no effect, and frameless windows will
not have rounded corners.
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
frameless windows on Windows, which adds the standard window frame. Setting it
to `false` will remove window shadow and window animations, and disable window
resizing via dragging the window edges. Default is `true`.
* `vibrancy` string (optional) _macOS_ - Add a type of vibrancy effect to
the window, only on macOS. Can be `appearance-based`, `titlebar`, `selection`,
`menu`, `popover`, `sidebar`, `header`, `sheet`, `window`, `hud`, `fullscreen-ui`,

View File

@@ -7,7 +7,7 @@
* `depthPerComponent` number - The number of bits per color component.
* `detected` boolean - `true` if the display is detected by the system.
* `displayFrequency` number - The display refresh rate.
* `id` number - Unique identifier associated with the display. A value of of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `id` number - Unique identifier associated with the display. A value of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `internal` boolean - `true` for an internal display and `false` for an external display.
* `label` string - User-friendly label, determined by the platform.
* `maximumCursorSize` [Size](size.md) - Maximum cursor size in native pixels.

View File

@@ -1,13 +1,15 @@
# NotificationAction Object
* `type` string - The type of action, can be `button`.
* `type` string - The type of action, can be `button` or `selection`. `selection` is only supported on Windows.
* `text` string (optional) - The label for the given action.
* `items` string[] (optional) _Windows_ - The list of items for the `selection` action `type`.
## Platform / Action Support
| Action Type | Platform Support | Usage of `text` | Default `text` | Limitations |
|-------------|------------------|-----------------|----------------|-------------|
| `button` | macOS | Used as the label for the button | "Show" (or a localized string by system default if first of such `button`, otherwise empty) | Only the first one is used. If multiple are provided, those beyond the first will be listed as additional actions (displayed when mouse active over the action button). Any such action also is incompatible with `hasReply` and will be ignored if `hasReply` is `true`. |
| `button` | macOS, Windows | Used as the label for the button | "Show" on macOS (localized) if first `button`, otherwise empty; Windows uses provided `text` | macOS: Only the first one is used as primary; others shown as additional actions (hover). Incompatible with `hasReply` (beyond first ignored). |
| `selection` | Windows | Used as the label for the submit button for the selection menu | "Select" | Requires an `items` array property specifying option labels. Emits the `action` event with `(index, selectedIndex)` where `selectedIndex` is the chosen option (>= 0). Ignored on platforms that do not support selection actions. |
### Button support on macOS
@@ -15,6 +17,37 @@ In order for extra notification buttons to work on macOS your app must meet the
following criteria.
* App is signed
* App has it's `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
* App has its `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
If either of these requirements are not met the button won't appear.
### Selection support on Windows
To add a selection (combo box) style action, include an action with `type: 'selection'`, a `text` label for the submit button, and an `items` array of strings:
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const items = ['One', 'Two', 'Three']
const n = new Notification({
title: 'Choose an option',
actions: [{
type: 'selection',
text: 'Apply',
items
}]
})
n.on('action', (e) => {
console.log(`User triggered action at index: ${e.actionIndex}`)
if (e.selectionIndex > 0) {
console.log(`User chose selection item '${items[e.selectionIndex]}'`)
}
})
n.show()
})
```
When the user activates the selection action, the notification's `action` event will be emitted with two parameters: `actionIndex` (the action's index in the `actions` array) and `selectedIndex` (the zero-based index of the chosen item, or `-1` if unavailable). On non-Windows platforms selection actions are ignored.

View File

@@ -2,7 +2,10 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.

View File

@@ -8,6 +8,7 @@
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` Integer - The exit code of the process, unless `reason` is
`launch-failed`, in which case `exitCode` will be a platform-specific
launch failure error code.

View File

@@ -0,0 +1,12 @@
# SharedTextureImportTextureInfo Object
* `pixelFormat` string - The pixel format of the texture.
* `bgra` - 32bpp BGRA (byte-order), 1 plane.
* `rgba` - 32bpp RGBA (byte-order), 1 plane.
* `rgbaf16` - Half float RGBA, 1 plane.
* `nv12` - 12bpp with Y plane followed by a 2x2 interleaved UV plane.
* `colorSpace` [ColorSpace](color-space.md) (optional) - The color space of the texture.
* `codedSize` [Size](size.md) - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) (optional) - A subsection of [0, 0, codedSize.width, codedSize.height]. In common cases, it is the full section area.
* `timestamp` number (optional) - A timestamp in microseconds that will be reflected to `VideoFrame`.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle.

View File

@@ -0,0 +1,9 @@
# SharedTextureImportedSubtle Object
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release the resources. If you transferred and get multiple `SharedTextureImported` objects, you have to `release` every one of them. The resource on the GPU process will be destroyed when the last one is released.
* `callback` Function (optional) - Callback when the GPU command buffer finishes using this shared texture. It provides a precise event to safely release dependent resources. For example, if this object is created by `finishTransferSharedTexture`, you can use this callback to safely release the original one that called `startTransferSharedTexture` in other processes. You can also release the source shared texture that was used to `importSharedTexture` safely.
* `startTransferSharedTexture` Function\<[SharedTextureTransfer](shared-texture-transfer.md)\> - Create a `SharedTextureTransfer` that can be serialized and transferred to other processes.
* `getFrameCreationSyncToken` Function\<[SharedTextureSyncToken](shared-texture-sync-token.md)\> - This method is for advanced users. If used, it is typically called after `finishTransferSharedTexture`, and should be passed to the object which was called `startTransferSharedTexture` to prevent the source object release the underlying resource before the target object actually acquire the reference at gpu process asyncly.
* `setReleaseSyncToken` Function - This method is for advanced users. If used, this object's underlying resource will not be released until the set sync token is fulfilled at gpu process. By using sync tokens, users are not required to use release callbacks for lifetime management.
* `syncToken` [SharedTextureSyncToken](shared-texture-sync-token.md) - The sync token to set.

View File

@@ -0,0 +1,6 @@
# SharedTextureImported Object
* `textureId` string - The unique identifier of the imported shared texture.
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release this object's reference of the imported shared texture. The underlying resource will be alive until every reference is released.
* `subtle` [SharedTextureImportedSubtle](shared-texture-imported-subtle.md) - Provides subtle APIs to interact with the imported shared texture for advanced users.

View File

@@ -0,0 +1,6 @@
# SharedTextureSubtle Object
* `importSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Imports the shared texture from the given options. Returns the imported shared texture.
* `textureInfo` [SharedTextureImportTextureInfo](shared-texture-import-texture-info.md) - The information of shared texture to import.
* `finishTransferSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Finishes the transfer of the shared texture and gets the transferred shared texture. Returns the imported shared texture from the transfer object.
* `transfer` [SharedTextureTransfer](shared-texture-transfer.md) - The transfer object of the shared texture.

View File

@@ -0,0 +1,3 @@
# SharedTextureSyncToken Object
* `syncToken` string - The opaque data for sync token.

View File

@@ -0,0 +1,10 @@
# SharedTextureTransfer Object
* `transfer` string _Readonly_ - The opaque transfer data of the shared texture. This can be transferred across Electron processes.
* `syncToken` string _Readonly_ - The opaque sync token data for frame creation.
* `pixelFormat` string _Readonly_ - The pixel format of the transferring texture.
* `codedSize` [Size](size.md) _Readonly_ - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) _Readonly_ - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In common cases, it is the full section area.
* `timestamp` number _Readonly_ - A timestamp in microseconds that will be reflected to `VideoFrame`.
Use `sharedTexture.subtle.finishTransferSharedTexture` to get [`SharedTextureImportedSubtle`](shared-texture-imported-subtle.md) back.

View File

@@ -21,7 +21,9 @@
associated with the window, making it compatible with the Chromium
OS-level sandbox and disabling the Node.js engine. This is not the same as
the `nodeIntegration` option and the APIs available to the preload script
are more limited. Read more about the option [here](../../tutorial/sandbox.md).
are more limited. Default is `true` since Electron 20. The sandbox will
automatically be disabled when `nodeIntegration` is set to `true`.
Read more about the option [here](../../tutorial/sandbox.md).
* `session` [Session](../session.md#class-session) (optional) - Sets the session used by the
page. Instead of passing the Session object directly, you can also choose to
use the `partition` option instead, which accepts a partition string. When
@@ -38,7 +40,7 @@
* `javascript` boolean (optional) - Enables JavaScript support. Default is `true`.
* `webSecurity` boolean (optional) - When `false`, it will disable the
same-origin policy (usually using testing websites by people), and set
`allowRunningInsecureContent` to `true` if this options has not been set
`allowRunningInsecureContent` to `true` if this option has not been set
by user. Default is `true`.
* `allowRunningInsecureContent` boolean (optional) - Allow an https page to run
JavaScript, CSS or plugins from http URLs. Default is `false`.
@@ -87,6 +89,11 @@
paint event. Defaults to `false`. See the
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
more details.
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
the specified `preload` script in a separate JavaScript context. Defaults
to `true`. The context that the `preload` script runs in will only have
@@ -149,6 +156,8 @@
`WebContents` when the preferred size changes. Default is `false`.
* `transparent` boolean (optional) - Whether to enable background transparency for the guest page. Default is `true`. **Note:** The guest page's text and background colors are derived from the [color scheme](https://developer.mozilla.org/en-US/docs/Web/CSS/color-scheme) of its root element. When transparency is enabled, the text color will still change accordingly but the background will remain transparent.
* `enableDeprecatedPaste` boolean (optional) _Deprecated_ - Whether to enable the `paste` [execCommand](https://developer.mozilla.org/en-US/docs/Web/API/Document/execCommand). Default is `false`.
* `focusOnNavigation` boolean (optional) - Whether to focus the WebContents
when navigating. Default is `true`.
[chrome-content-scripts]: https://developer.chrome.com/extensions/content_scripts#execution-environment
[runtime-enabled-features]: https://source.chromium.org/chromium/chromium/src/+/main:third_party/blink/renderer/platform/runtime_enabled_features.json5

View File

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
The `systemPreferences` object emits the following events:
### Event: 'accent-color-changed' _Windows_
### Event: 'accent-color-changed' _Windows_ _Linux_
Returns:
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
or global value of a `key` previously set with `setUserDefault`.
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
### `systemPreferences.getAccentColor()`
Returns `string` - The users current system wide accent color preference in RGBA
hexadecimal form.

View File

@@ -36,6 +36,12 @@ Process: [Main](../glossary.md#main-process)<br />
`com.apple.security.cs.allow-unsigned-executable-memory` entitlements. This will allow the utility process
to load unsigned libraries. Unless you specifically need this capability, it is best to leave this disabled.
Default is `false`.
* `disclaim` boolean (optional) _macOS_ - With this flag, the utility process will disclaim
responsibility for the child process. This causes the operating system to consider the child
process as a separate entity for purposes of security policies like Transparency, Consent, and
Control (TCC). When responsibility is disclaimed, the parent process will not be attributed
for any TCC requests initiated by the child process. This is useful when launching processes
that run third-party or otherwise untrusted code. Default is `false`.
* `respondToAuthRequestsFromMainProcess` boolean (optional) - With this flag, all HTTP 401 and 407 network
requests created via the [net module](net.md) will allow responding to them via the
[`app#login`](app.md#event-login) event in the main process instead of the default

View File

@@ -62,7 +62,7 @@ console.log(webContents)
### `webContents.getAllWebContents()`
Returns `WebContents[]` - An array of all `WebContents` instances. This will contain web contents
for all windows, webviews, opened devtools, and devtools extension background pages.
for all windows, webviews, opened DevTools, and DevTools extension background pages.
### `webContents.getFocusedWebContents()`
@@ -383,7 +383,7 @@ Emitted after a server side redirect occurs during navigation. For example a 30
redirect.
This event cannot be prevented, if you want to prevent redirects you should
checkout out the `will-redirect` event above.
check out the `will-redirect` event above.
#### Event: 'did-navigate'
@@ -933,7 +933,7 @@ copying data between CPU and GPU memory, with Chromium's hardware acceleration s
Only a limited number of textures can exist at the same time, so it's important that you call `texture.release()` as soon as you're done with the texture.
By managing the texture lifecycle by yourself, you can safely pass the `texture.textureInfo` to other processes through IPC.
More details can be found in the [offscreen rendering tutorial](../tutorial/offscreen-rendering.md). To learn about how to handle the texture in native code, refer to [offscreen rendering's code documentation.](https://github.com/electron/electron/blob/main/shell/browser/osr/README.md).
More details can be found in the [offscreen rendering tutorial](../tutorial/offscreen-rendering.md). To learn about how to handle the texture in native code, refer to [offscreen rendering's code documentation.](../../shell/browser/osr/README.md).
```js
const { BrowserWindow } = require('electron')
@@ -958,7 +958,7 @@ win.loadURL('https://github.com')
#### Event: 'devtools-reload-page'
Emitted when the devtools window instructs the webContents to reload
Emitted when the DevTools window instructs the webContents to reload
#### Event: 'will-attach-webview'
@@ -1079,7 +1079,7 @@ Emitted when the [mainFrame](web-contents.md#contentsmainframe-readonly), an `<i
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors.
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Loads the `url` in the window. The `url` must contain the protocol prefix,
e.g. the `http://` or `file://`. If the load should bypass http cache then
@@ -1465,7 +1465,7 @@ Ignore application menu shortcuts while this web contents is focused.
without a recognized 'action' value will result in a console error and have
the same effect as returning `{action: 'deny'}`.
Called before creating a window a new window is requested by the renderer, e.g.
Called before creating a window when a new window is requested by the renderer, e.g.
by `window.open()`, a link with `target="_blank"`, shift+clicking on a link, or
submitting a form with `<form target="_blank">`. See
[`window.open()`](window-open.md) for more details and how to use this in
@@ -1865,66 +1865,20 @@ Removes the specified path from DevTools workspace.
* `devToolsWebContents` WebContents
Uses the `devToolsWebContents` as the target `WebContents` to show devtools.
Uses the `devToolsWebContents` as the target `WebContents` to show DevTools.
The `devToolsWebContents` must not have done any navigation, and it should not
be used for other purposes after the call.
By default Electron manages the devtools by creating an internal `WebContents`
By default, Electron manages the DevTools by creating an internal `WebContents`
with native view, which developers have very limited control of. With the
`setDevToolsWebContents` method, developers can use any `WebContents` to show
the devtools in it, including `BrowserWindow`, `BrowserView` and `<webview>`
tag.
the DevTools in it, such as [`BrowserWindow`](./browser-window.md) or [`WebContentsView`](./web-contents-view.md).
Note that closing the devtools does not destroy the `devToolsWebContents`, it
is caller's responsibility to destroy `devToolsWebContents`.
Note that closing the DevTools does not destroy the `devToolsWebContents`, it
is the caller's responsibility to destroy `devToolsWebContents` manually.
An example of showing devtools in a `<webview>` tag:
```html
<html>
<head>
<style type="text/css">
* { margin: 0; }
#browser { height: 70%; }
#devtools { height: 30%; }
</style>
</head>
<body>
<webview id="browser" src="https://github.com"></webview>
<webview id="devtools" src="about:blank"></webview>
<script>
const { ipcRenderer } = require('electron')
const emittedOnce = (element, eventName) => new Promise(resolve => {
element.addEventListener(eventName, event => resolve(event), { once: true })
})
const browserView = document.getElementById('browser')
const devtoolsView = document.getElementById('devtools')
const browserReady = emittedOnce(browserView, 'dom-ready')
const devtoolsReady = emittedOnce(devtoolsView, 'dom-ready')
Promise.all([browserReady, devtoolsReady]).then(() => {
const targetId = browserView.getWebContentsId()
const devtoolsId = devtoolsView.getWebContentsId()
ipcRenderer.send('open-devtools', targetId, devtoolsId)
})
</script>
</body>
</html>
```
```js
// Main process
const { ipcMain, webContents } = require('electron')
ipcMain.on('open-devtools', (event, targetContentsId, devtoolsContentsId) => {
const target = webContents.fromId(targetContentsId)
const devtools = webContents.fromId(devtoolsContentsId)
target.setDevToolsWebContents(devtools)
target.openDevTools()
})
```
An example of showing devtools in a `BrowserWindow`:
An example of showing DevTools in a `BrowserWindow`:
```js title='main.js'
const { app, BrowserWindow } = require('electron')
@@ -1944,31 +1898,31 @@ app.whenReady().then(() => {
#### `contents.openDevTools([options])`
* `options` Object (optional)
* `mode` string - Opens the devtools with specified dock state, can be
* `mode` string - Opens the DevTools with specified dock state, can be
`left`, `right`, `bottom`, `undocked`, `detach`. Defaults to last used dock state.
In `undocked` mode it's possible to dock back. In `detach` mode it's not.
* `activate` boolean (optional) - Whether to bring the opened devtools window
* `activate` boolean (optional) - Whether to bring the opened DevTools window
to the foreground. The default is `true`.
* `title` string (optional) - A title for the DevTools window (only in `undocked` or `detach` mode).
Opens the devtools.
Opens the DevTools.
When `contents` is a `<webview>` tag, the `mode` would be `detach` by default,
explicitly passing an empty `mode` can force using last used dock state.
On Windows, if Windows Control Overlay is enabled, Devtools will be opened with `mode: 'detach'`.
On Windows, if Windows Control Overlay is enabled, DevTools will be opened with `mode: 'detach'`.
#### `contents.closeDevTools()`
Closes the devtools.
Closes the DevTools view.
#### `contents.isDevToolsOpened()`
Returns `boolean` - Whether the devtools is opened.
Returns `boolean` - Whether the DevTools view is opened.
#### `contents.isDevToolsFocused()`
Returns `boolean` - Whether the devtools view is focused .
Returns `boolean` - Whether the DevTools view is focused .
#### `contents.getDevToolsTitle()`
@@ -2214,7 +2168,7 @@ Returns `boolean` - If _offscreen rendering_ is enabled returns whether it is cu
* `fps` Integer
If _offscreen rendering_ is enabled sets the frame rate to the specified number.
Only values between 1 and 240 are accepted.
When `webPreferences.offscreen.useSharedTexture` is `false` only values between 1 and 240 are accepted.
#### `contents.getFrameRate()`
@@ -2410,11 +2364,12 @@ A [`NavigationHistory`](navigation-history.md) used by this webContents.
#### `contents.hostWebContents` _Readonly_
A [`WebContents`](web-contents.md) instance that might own this `WebContents`.
A `WebContents | null` property that represents a [`WebContents`](web-contents.md)
instance that might own this `WebContents`.
#### `contents.devToolsWebContents` _Readonly_
A `WebContents | null` property that represents the of DevTools `WebContents` associated with a given `WebContents`.
A `WebContents | null` property that represents the DevTools `WebContents` associated with a given `WebContents`.
> [!NOTE]
> Users should never store this object because it may become `null`

View File

@@ -197,7 +197,7 @@ dispatch errors of isolated worlds to foreign worlds.
* `info` Object
* `securityOrigin` string (optional) - Security origin for the isolated world.
* `csp` string (optional) - Content Security Policy for the isolated world.
* `name` string (optional) - Name for isolated world. Useful in devtools.
* `name` string (optional) - Name for isolated world. Useful in DevTools.
Set the security origin, content security policy and name of the isolated world.

View File

@@ -12,6 +12,19 @@ This document uses the following convention to categorize breaking changes:
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
## Planned Breaking API Changes (40.0)
### Deprecated: `clipboard` API access from renderer processes
Using the `clipboard` API directly in the renderer process is deprecated.
If you want to call this API from a renderer process, place the API call in
your preload script and expose it using the [contextBridge](https://www.electronjs.org/docs/latest/api/context-bridge) API.
### Behavior Changed: MacOS dSYM files now compressed with tar.xz
Debug symbols for MacOS (dSYM) now use xz compression in order to handle larger file sizes. `dsym.zip` files are now
`dsym.tar.xz` files. End users using debug symbols may need to update their zip utilities.
## Planned Breaking API Changes (39.0)
### Deprecated: `--host-rules` command line switch
@@ -37,19 +50,41 @@ webContents.setWindowOpenHandler((details) => {
})
```
### Behavior Changed: `NSAudioCaptureUsageDescription` should be included in your app's Info.plist file to use `desktopCapturer` (🍏 macOS ≥14.2)
Per [Chromium update](https://source.chromium.org/chromium/chromium/src/+/ad17e8f8b93d5f34891b06085d373a668918255e) which enables Apple's newer [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps#Configure-the-sample-code-project) by default, you now must have `NSAudioCaptureUsageDescription` defined in your `Info.plist` to use `desktopCapturer`.
Electron's `desktopCapturer` will create a dead audio stream if the new permission is absent however no errors or warnings will occur. This is partially a side-effect of Chromium not falling back to the older `Screen & System Audio Recording` permissions system if the new system fails.
To restore previous behavior:
```js
// main.js (right beneath your require/import statments)
app.commandLine.appendSwitch(
'disable-features',
'MacCatapLoopbackAudioForScreenShare'
)
```
### Behavior Changed: shared texture OSR `paint` event data structure
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
See [here](https://www.electronjs.org/docs/latest/api/structures/offscreen-shared-texture) for more details.
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
## Planned Breaking API Changes (38.0)
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable
The default value of the `--ozone-plaftform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
The default value of the `--ozone-platform` flag [changed to `auto`](https://chromium-review.googlesource.com/c/chromium/src/+/6775426).
You should use the `XDG_SESSION_TYPE=wayland` environment variable instead to use Wayland.
Electron now defaults to running as a native Wayland app when launched in a Wayland session (when `XDG_SESSION_TYPE=wayland`).
Users can force XWayland by passing `--ozone-platform=x11`.
### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overridden and now reflects the actual desktop environment.
### Removed: macOS 11 support
@@ -130,7 +165,7 @@ window is not currently visible.
`app.commandLine` was only meant to handle chromium switches (which aren't case-sensitive) and switches passed via `app.commandLine` will not be passed down to any of the child processes.
If you were using `app.commandLine` to control the behavior of the main process, you should do this via `process.argv`.
If you were using `app.commandLine` to control the behavior of the main process, you should do this via `process.argv`.
### Deprecated: `NativeImage.getBitmap()`
@@ -160,7 +195,7 @@ from upstream Chromium.
### Deprecated: `null` value for `session` property in `ProtocolResponse`
Previously, setting the ProtocolResponse.session property to `null`
Would create a random independent session. This is no longer supported.
would create a random independent session. This is no longer supported.
Using single-purpose sessions here is discouraged due to overhead costs;
however, old code that needs to preserve this behavior can emulate it by
@@ -171,7 +206,7 @@ and then using it in `ProtocolResponse.session`.
When calling `Session.clearStorageData(options)`, the `options.quota`
property is deprecated. Since the `syncable` type was removed, there
is only type left -- `'temporary'` -- so specifying it is unnecessary.
is only one type left -- `'temporary'` -- so specifying it is unnecessary.
### Deprecated: Extension methods and events on `session`
@@ -500,7 +535,7 @@ more information.
### Removed: The `--disable-color-correct-rendering` switch
This switch was never formally documented but it's removal is being noted here regardless. Chromium itself now has better support for color spaces so this flag should not be needed.
This switch was never formally documented but its removal is being noted here regardless. Chromium itself now has better support for color spaces so this flag should not be needed.
### Behavior Changed: `BrowserView.setAutoResize` behavior on macOS
@@ -1191,7 +1226,7 @@ more details.
### API Changed: `webContents.printToPDF()`
`webContents.printToPDF()` has been modified to conform to [`Page.printToPDF`](https://chromedevtools.github.io/devtools-protocol/tot/Page/#method-printToPDF) in the Chrome DevTools Protocol. This has been changes in order to
`webContents.printToPDF()` has been modified to conform to [`Page.printToPDF`](https://chromedevtools.github.io/devtools-protocol/tot/Page/#method-printToPDF) in the Chrome DevTools Protocol. This has been changed in order to
address changes upstream that made our previous implementation untenable and rife with bugs.
**Arguments Changed**
@@ -2658,6 +2693,18 @@ Replace with: https://atom.io/download/electron
The following list includes the breaking API changes made in Electron 2.0.
### `autoUpdater`
```js
// Deprecated
autoUpdater.setFeedURL(url, headers)
// Replace with
autoUpdater.setFeedURL({
url,
headers
})
```
### `BrowserWindow`
```js

View File

@@ -6,30 +6,104 @@ Follow the guidelines below for building **Electron itself**, for the purposes o
## Platform prerequisites
Check the build prerequisites for your platform before proceeding
Check the build prerequisites for your platform before proceeding:
* [macOS](build-instructions-macos.md#prerequisites)
* [Linux](build-instructions-linux.md#prerequisites)
* [Windows](build-instructions-windows.md#prerequisites)
## Build Tools
## Setting up `@electron/build-tools` (recommended)
[Electron's Build Tools](https://github.com/electron/build-tools) automate much of the setup for compiling Electron from source with different configurations and build targets. If you wish to set up the environment manually, the instructions are listed below.
[Electron Build Tools](https://github.com/electron/build-tools) automate much of the setup for
compiling Electron from source with different configurations and build targets.
Most of the [manual setup](#manual-setup-advanced) instructions can be replaced by simpler Build Tools commands.
> [!TIP]
> Build Tools also gives you access to [remote execution and caching of build actions](./reclient.md),
> which will dramatically improve build times.
Electron Build Tools can be installed globally from npm:
```sh
npm install -g @electron/build-tools
```
Once installed, the `e` command should be globally available in your command line. The `e init`
command bootstraps a local checkout of Electron:
```sh
# The 'Hello, World!' of build-tools: get and build `main`
# Choose the directory where Electron's source and build files will reside.
# You can specify any path you like; this command defaults to `$PWD/electron`.
# If you're going to use multiple branches, you may want something like:
# `--root=~/electron/branch` (e.g. `~/electron-gn/main`)
e init --root=~/electron --bootstrap testing
```
The `--bootstrap` flag also runs `e sync` (synchronizes source code branches from
[`DEPS`](../../DEPS) using
[`gclient`](https://chromium.googlesource.com/chromium/tools/depot_tools.git/+/HEAD/README.gclient.md))
and `e build` (compiles the Electron binary into the `${root}/src/out` folder).
> [!IMPORTANT]
>
> Sometime after the initial `e sync` phase, you will be asked to run `e d rbe login` to auth into
> remote build execution and proceed into the build. This may take about 20-30 minutes!
Once the build is done compiling, you can test it by running `e start` (or by loading it into
[Electron Fiddle](http://electronjs.org/fiddle)).
### Navigating the project
Some quick tips on building once your checkout is set up:
* **Directory structure:** Within the project, Chromium code is synced to `${root}/src/` while Electron's code (i.e. code in
https://github.com/electron/electron) lives in `${root}/src/electron/`. Note that both directories
have their own git repositories.
* **Updating your checkout:** Run git commands such as `git checkout <branch>` and `git pull` from `${root}/src/electron`.
Whenever you update your commit `HEAD`, make sure to `e sync` before `e build` to sync dependencies
such as Chromium and Node.js. This is especially relevant because the Chromium version in
[`DEPS`](../../DEPS) changes frequently.
* **Rebuilding:** When making changes to code in `${root}/src/electron/` in a local branch, you only need to re-run `e build`.
* **Adding patches:** When contributing changes in `${root}/src/` outside of `${root}/src/electron/`, you need to do so
via Electron's [patch system](./patches.md). The `e patches` command can export all relevant patches to
`${root}/src/electron/patches/` once your code change is ready.
> [!IMPORTANT]
> Unless you're applying upstream patches, you should treat `${root}/src/` as a read-only folder and
> spend most of your development time in `${root}/src/electron/`. You should not need to make any
> changes or run `git` commands in `${root}/src/`.
> [!TIP]
> Detailed documentation for all available `e` commands can be found in the
> repository's [README.md](https://github.com/electron/build-tools/blob/main/README.md). You can
> also run `e --help` to list all commands and use the `--help` flag on any command to get more
> usage info.
> [!TIP]
> For more information on project structure, see the [Source Code Directory Structure](./source-code-directory-structure.md)
> guide.
<details>
<!-- markdownlint-disable-next-line MD033 -->
<summary><strong>Manual setup (advanced)</strong></summary>
## Manual setup (advanced)
Electron uses [GN](https://gn.googlesource.com/gn) for project generation and
[ninja](https://ninja-build.org/) for building. Project configurations can
be found in the `.gn` and `.gni` files.
[siso](https://chromium.googlesource.com/build/+/refs/heads/main/siso/README.md) for building.
Project configurations can be found in the `.gn` and `.gni` files in the `electron/electron` repo.
## GN Files
### GN files
The following `gn` files contain the main rules for building Electron:
* `BUILD.gn` defines how Electron itself is built and
includes the default configurations for linking with Chromium.
* `build/args/{testing,release,all}.gn` contain the default build arguments for
building Electron.
* [`BUILD.gn`](../../BUILD.gn) defines how Electron itself
is built and includes the default configurations for linking with Chromium.
* [`build/args/{testing,release,all}.gn`](https://github.com/electron/electron/tree/main/build/args)
contain the default build arguments for building Electron.
## GN prerequisites
### GN prerequisites
You'll need to install [`depot_tools`][depot-tools], the toolset
used for fetching Chromium and its dependencies.
@@ -56,7 +130,7 @@ $ mkdir -p "${GIT_CACHE_PATH}"
# This will use about 16G.
```
## Getting the code
### Getting the code
```sh
$ mkdir electron && cd electron
@@ -68,7 +142,7 @@ $ gclient sync --with_branch_heads --with_tags
> Instead of `https://github.com/electron/electron`, you can use your own fork
> here (something like `https://github.com/<username>/electron`).
### A note on pulling/pushing
#### A note on pulling/pushing
If you intend to `git pull` or `git push` from the official `electron`
repository in the future, you now need to update the respective folder's
@@ -83,12 +157,13 @@ $ git branch --set-upstream-to=origin/main
$ cd -
```
:memo: `gclient` works by checking a file called `DEPS` inside the
`src/electron` folder for dependencies (like Chromium or Node.js).
> [!TIP]
> `gclient` works by checking a file called `DEPS` inside the
`${root}/src/electron` folder for dependencies (like Chromium or Node.js).
Running `gclient sync -f` ensures that all dependencies required
to build Electron match that file.
So, in order to pull, you'd run the following commands:
In order to pull, you'd run the following commands:
```sh
$ cd src/electron
@@ -96,7 +171,7 @@ $ git pull
$ gclient sync -f
```
## Building
### Building
**Set the environment variable for chromium build tools**
@@ -156,7 +231,7 @@ $ gn gen out/Release --args="import(\`"//electron/build/args/release.gn\`")"
```
> [!NOTE]
> This will generate a `out/Testing` or `out/Release` build directory under `src/` with the testing or release build depending upon the configuration passed above. You can replace `Testing|Release` with another names, but it should be a subdirectory of `out`.
> This will generate a `out/Testing` or `out/Release` build directory under `${root}/src/` with the testing or release build depending upon the configuration passed above. You can replace `Testing|Release` with another names, but it should be a subdirectory of `out`.
Also you shouldn't have to run `gn gen` again—if you want to change the build arguments, you can run `gn args out/Testing` to bring up an editor. To see the list of available build configuration options, run `gn args out/Testing --list`.
@@ -189,7 +264,7 @@ $ ./out/Testing/electron.exe
$ ./out/Testing/electron
```
### Packaging
#### Packaging
To package the electron build as a distributable zip file:
@@ -197,7 +272,7 @@ To package the electron build as a distributable zip file:
$ ninja -C out/Release electron:electron_dist_zip
```
### Cross-compiling
#### Cross-compiling
To compile for a platform that isn't the same as the one you're building on,
set the `target_cpu` and `target_os` GN arguments. For example, to compile an
@@ -223,7 +298,7 @@ and [`target_cpu`][target_cpu values].
[target_os values]: https://gn.googlesource.com/gn/+/main/docs/reference.md#built_in-predefined-variables-target_os_the-desired-operating-system-for-the-build-possible-values
[target_cpu values]: https://gn.googlesource.com/gn/+/main/docs/reference.md#built_in-predefined-variables-target_cpu_the-desired-cpu-architecture-for-the-build-possible-values
#### Windows on Arm (experimental)
#### Windows on Arm
To cross-compile for Windows on Arm, [follow Chromium's guide](https://chromium.googlesource.com/chromium/src/+/refs/heads/main/docs/windows_build_instructions.md#Visual-Studio) to get the necessary dependencies, SDK and libraries, then build with `ELECTRON_BUILDING_WOA=1` in your environment before running `gclient sync`.
@@ -241,12 +316,12 @@ gclient sync -f --with_branch_heads --with_tags
Next, run `gn gen` as above with `target_cpu="arm64"`.
## Tests
### Tests
To run the tests, you'll first need to build the test modules against the
same version of Node.js that was built as part of the build process. To
generate build headers for the modules to compile against, run the following
under `src/` directory.
under `${root}/src/` directory.
```sh
$ ninja -C out/Testing electron:node_headers
@@ -262,7 +337,7 @@ $ npm run test -- \
--enable-logging -g 'BrowserWindow module'
```
## Sharing the git cache between multiple machines
### Sharing the git cache between multiple machines
It is possible to share the gclient git cache with other machines by exporting it as
SMB share on linux, but only one process/machine can be using the cache at a
@@ -284,11 +359,14 @@ This can be set quickly in powershell (ran as administrator):
New-ItemProperty -Path "HKLM:\System\CurrentControlSet\Services\Lanmanworkstation\Parameters" -Name DirectoryCacheLifetime -Value 0 -PropertyType DWORD -Force
```
</details>
## Troubleshooting
### gclient sync complains about rebase
### `sync` complains about rebase
If `gclient sync` is interrupted the git tree may be left in a bad state, leading to a cryptic message when running `gclient sync` in the future:
If `e sync` (or `gclient sync`) is interrupted, the git tree may be left in a bad state, leading to
a cryptic message when running `sync` in the future:
```plaintext
2> Conflict while rebasing this branch.
@@ -296,17 +374,19 @@ If `gclient sync` is interrupted the git tree may be left in a bad state, leadin
2> See man git-rebase for details.
```
If there are no git conflicts or rebases in `src/electron`, you may need to abort a `git am` in `src`:
If there are no git conflicts or rebases in `${root}/src/electron`, you may need to abort a `git am`
in `${root}/src`:
```sh
$ cd ../
$ git am --abort
$ cd electron
$ gclient sync -f
$ e sync -f
```
This may also happen if you have checked out a branch (as opposed to having a detached head) in `electron/src/`
or some other dependencys repository. If that is the case, a `git checkout --detach HEAD` in the appropriate repository should do the trick.
This may also happen if you have checked out a branch (as opposed to having a detached head) in `${root}/src/`
or some other dependencys repository. If that is the case, a `git checkout --detach HEAD` in the
appropriate repository should do the trick.
### I'm being asked for a username/password for chromium-internal.googlesource.com
@@ -315,16 +395,6 @@ If you see a prompt for `Username for 'https://chrome-internal.googlesource.com'
your locally installed version of Visual Studio (by default, `depot_tools` will
try to download a Google-internal version that only Googlers have access to).
### `e` Module not found
If `e` is not recognized despite running `npm i -g @electron/build-tools`, ie:
```sh
Error: Cannot find module '/Users/<user>/.electron_build_tools/src/e'
```
We recommend installing Node through [nvm](https://github.com/nvm-sh/nvm). This allows for easier Node version management, and is often a fix for missing `e` modules.
### RBE authentication randomly fails with "Token not valid"
This could be caused by the local clock time on the machine being off by a small amount. Use [time.is](https://time.is/) to check.

View File

@@ -6,77 +6,17 @@ Follow the guidelines below for building **Electron itself** on Linux, for the p
## Prerequisites
* At least 25GB disk space and 8GB RAM.
* Python >= 3.9.
* [Node.js](https://nodejs.org/download/) >= 22.12.0
* [clang](https://clang.llvm.org/get_started.html) 3.4 or later.
* Development headers of GTK 3 and libnotify.
Due to Electron's dependency on Chromium, prerequisites and dependencies for Electron change over time. [Chromium's documentation on building on Linux](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/linux/build_instructions.md) has up to date information for building Chromium on Linux. This documentation can generally
be followed for building Electron on Linux as well.
On Ubuntu >= 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libasound2-dev libcap-dev \
libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python3-dbusmock openjdk-8-jre
```
On Ubuntu < 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libgnome-keyring-dev \
libasound2-dev libcap-dev libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python-dbusmock openjdk-8-jre
```
On RHEL / CentOS, install the following libraries:
```sh
$ sudo yum install clang dbus-devel gtk3-devel libnotify-devel \
libgnome-keyring-devel xorg-x11-server-utils libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock openjdk-8-jre
```
On Fedora, install the following libraries:
```sh
$ sudo dnf install clang dbus-devel gperf gtk3-devel \
libnotify-devel libgnome-keyring-devel libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock
```
On Arch Linux / Manjaro, install the following libraries:
```sh
$ sudo pacman -Syu base-devel clang libdbus gtk2 libnotify \
libgnome-keyring alsa-lib libcap libcups libxtst \
libxss nss gcc-multilib curl gperf bison \
python2 python-dbusmock jdk8-openjdk
```
Other distributions may offer similar packages for installation via package
managers such as pacman. Or one can compile from source code.
Additionally, Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) can be referenced to get the current dependencies that Electron requires in addition to what Chromium installs via [build/install-deps.sh](https://chromium.googlesource.com/chromium/src/+/HEAD/build/install-build-deps.sh).
### Cross compilation
If you want to build for an `arm` target you should also install the following
dependencies:
If you want to build for an `arm` target, you can use Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) to install the additional dependencies by passing the `--arm argument`:
```sh
$ sudo apt-get install libc6-dev-armhf-cross linux-libc-dev-armhf-cross \
g++-arm-linux-gnueabihf
```
Similarly for `arm64`, install the following:
```sh
$ sudo apt-get install libc6-dev-arm64-cross linux-libc-dev-arm64-cross \
g++-aarch64-linux-gnu
$ sudo install-deps.sh --arm
```
And to cross-compile for `arm` or targets, you should pass the

View File

@@ -6,7 +6,7 @@ Follow the guidelines below for building **Electron itself** on macOS, for the p
## Prerequisites
* macOS >= 11.6.0
* macOS >= 12
* [Xcode](https://developer.apple.com/technologies/tools/). The exact version
needed depends on what branch you are building, but the latest version of
Xcode is generally a good bet for building `main`.
@@ -40,7 +40,7 @@ If you are on arm64 architecture, the build script may be pointing to the wrong
### Certificates fail to verify
installing [`certifi`](https://pypi.org/project/certifi/) will fix the following error:
Installing [`certifi`](https://pypi.org/project/certifi/) will fix the following error:
```sh
________ running 'python3 src/tools/clang/scripts/update.py' in '/Users/<user>/electron'

View File

@@ -6,7 +6,7 @@ This is not a comprehensive end-all guide to creating an Electron Browser API, r
## Add your files to Electron's project configuration
Electron uses [GN](https://gn.googlesource.com/gn) as a meta build system to generate files for its compiler, [Ninja](https://ninja-build.org/). This means that in order to tell Electron to compile your code, we have to add your API's code and header file names into [`filenames.gni`](https://github.com/electron/electron/blob/main/filenames.gni).
Electron uses [GN](https://gn.googlesource.com/gn) as a meta build system to generate files for its compiler, [Ninja](https://ninja-build.org/). This means that in order to tell Electron to compile your code, we have to add your API's code and header file names into [`filenames.gni`](../../filenames.gni).
You will need to append your API file names alphabetically into the appropriate files like so:
@@ -127,7 +127,7 @@ void Initialize(v8::Local<v8::Object> exports,
## Link your Electron API with Node
In the [`typings/internal-ambient.d.ts`](https://github.com/electron/electron/blob/main/typings/internal-ambient.d.ts) file, we need to append a new property onto the `Process` interface like so:
In the [`typings/internal-ambient.d.ts`](../../typings/internal-ambient.d.ts) file, we need to append a new property onto the `Process` interface like so:
```ts title='typings/internal-ambient.d.ts' @ts-nocheck
interface Process {
@@ -141,7 +141,7 @@ At the very bottom of your `api_name.cc` file:
NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{api_name},Initialize)
```
In your [`shell/common/node_bindings.cc`](https://github.com/electron/electron/blob/main/shell/common/node_bindings.cc) file, add your node binding name to Electron's built-in modules.
In your [`shell/common/node_bindings.cc`](../../shell/common/node_bindings.cc) file, add your node binding name to Electron's built-in modules.
```cpp title='shell/common/node_bindings.cc'
#define ELECTRON_BROWSER_MODULES(V) \
@@ -159,7 +159,7 @@ We will need to create a new TypeScript file in the path that follows:
`"lib/browser/api/{electron_browser_{api_name}}.ts"`
An example of the contents of this file can be found [here](https://github.com/electron/electron/blob/main/lib/browser/api/native-theme.ts).
An example of the contents of this file can be found [here](../../lib/browser/api/native-theme.ts).
### Expose your module to TypeScript

View File

@@ -28,7 +28,7 @@ with breakpoints inside Electron's source code.
format.
* **ProcMon**: The [free SysInternals tool][sys-internals] allows you to inspect
a processes parameters, file handles, and registry operations.
a process's parameters, file handles, and registry operations.
## Attaching to and Debugging Electron

View File

@@ -185,7 +185,7 @@ $ git push origin my-branch
### Step 9: Opening the Pull Request
From within GitHub, opening a new pull request will present you with a template
that should be filled out. It can be found [here](https://github.com/electron/electron/blob/main/.github/PULL_REQUEST_TEMPLATE.md).
that should be filled out. It can be found [here](../../.github/PULL_REQUEST_TEMPLATE.md).
If you do not adequately complete this template, your PR may be delayed in being merged as maintainers
seek more information or clarify ambiguities.
@@ -218,8 +218,7 @@ seem unfamiliar, refer to this
#### Approval and Request Changes Workflow
All pull requests require approval from a
[Code Owner](https://github.com/electron/electron/blob/main/.github/CODEOWNERS)
All pull requests require approval from a [Code Owner](../../.github/CODEOWNERS)
of the area you modified in order to land. Whenever a maintainer reviews a pull
request they may request changes. These may be small, such as fixing a typo, or
may involve substantive changes. Such requests are intended to be helpful, but

View File

@@ -4,12 +4,40 @@ The source code of Electron is separated into a few parts, mostly
following Chromium on the separation conventions.
You may need to become familiar with
[Chromium's multi-process architecture](https://dev.chromium.org/developers/design-documents/multi-process-architecture)
[Chromium's multi-process architecture](https://www.chromium.org/developers/design-documents/multi-process-architecture/)
to understand the source code better.
## Structure of Source Code
## Project structure
```diff
Electron is a complex project containing multiple upstream dependencies, which are tracked in source
control via the [`DEPS`](../../DEPS) file. When
[initializing a local Electron checkout](./build-instructions-gn.md), Electron's source code is just one
of many nested folders within the project root.
The project contains a single `src` folder that corresponds to a specific git checkout of
[Chromium's `src` folder](https://source.chromium.org/chromium/chromium/src). In addition, Electron's
repository code is contained in `src/electron` (with its own nested git repository), and other
Electron-specific third-party dependencies (e.g. [nan](https://github.com/nodejs/nan) or
[node](https://github.com/nodejs/node)) are located in `src/third_party` (along with all other
Chromium third-party dependencies, such as WebRTC or ANGLE).
For all code outside of `src/electron`, Electron-specific code changes are maintained via git patches.
See the [Patches](./patches.md) development guide for more information.
```plaintext
Project Root
└── src
├── electron
├── third_party
│   ├── nan
│   ├── electron_node
│   └── ...other third party deps
└── ...other folders
```
## Structure of Electron source code
```plaintext
Electron
├── build/ - Build configuration files needed to build with GN.
├── buildflags/ - Determines the set of features that can be conditionally built.
@@ -25,24 +53,23 @@ Electron
├── lib/ - JavaScript/TypeScript source code.
| ├── browser/ - Main process initialization code.
| | ├── api/ - API implementation for main process modules.
| | └── remote/ - Code related to the remote module as it is
| | used in the main process.
| ├── common/ - Relating to logic needed by both main and renderer processes.
| | └── api/ - API implementation for modules that can be used in
| | both the main and renderer processes
| ├── isolated_renderer/ - Handles creation of isolated renderer processes when
| | contextIsolation is enabled.
| ├── node/ - Initialization code for Node.js in the main process.
│   ├── preload_realm/ - Initialization code for sandboxed renderer preload scripts.
│   │   └── api/ - API implementation for preload scripts.
| ├── renderer/ - Renderer process initialization code.
| | ├── api/ - API implementation for renderer process modules.
| | ├── extension/ - Code related to use of Chrome Extensions
| | | in Electron's renderer process.
| | ├── remote/ - Logic that handles use of the remote module in
| | | the main process.
| | └── web-view/ - Logic that handles the use of webviews in the
| | renderer process.
| ├── sandboxed_renderer/ - Logic that handles creation of sandboxed renderer
| | | processes.
| | └── api/ - API implementation for sandboxed renderer processes.
│   ├── utility/ - Utility process initialization code.
│   │   └── api/ - API implementation for utility process modules.
| └── worker/ - Logic that handles proper functionality of Node.js
| environments in Web Workers.
├── patches/ - Patches applied on top of Electron's core dependencies
@@ -67,27 +94,30 @@ Electron
| | └── resources/ - Icons, platform-dependent files, etc.
| ├── renderer/ - Code that runs in renderer process.
| | └── api/ - The implementation of renderer process APIs.
| ── common/ - Code that used by both the main and renderer processes,
| | including some utility functions and code to integrate node's
| | message loop into Chromium's message loop.
| └── api/ - The implementation of common APIs, and foundations of
| Electron's built-in modules.
| ── common/ - Code that used by both the main and renderer processes,
| | | including some helper functions and code to integrate node's
| | | message loop into Chromium's message loop.
| | └── api/ - The implementation of common APIs, and foundations of
| | Electron's built-in modules.
│   ├── services/node/ - Provides a Node.js runtime to utility processes.
│   └── utility - Code that runs in the utility process.
├── spec/ - Components of Electron's test suite run in the main process.
├── typings/ - Internal TypeScript types that aren't exported in electron.d.ts.
└── BUILD.gn - Building rules of Electron.
```
## Structure of Other Directories
## Structure of other Electron directories
* **.github** - GitHub-specific config files including issues templates, CI with GitHub Actions and CODEOWNERS.
* **dist** - Temporary directory created by `script/create-dist.py` script
when creating a distribution.
* **node_modules** - Third party node modules used for building.
* **npm** - Logic for installation of Electron via npm.
* **out** - Temporary output directory of `ninja`.
* **out** - Temporary output directory for `siso`.
* **script** - Scripts used for development purpose like building, packaging,
testing, etc.
```diff
```plaintext
script/ - The set of all scripts Electron runs for a variety of purposes.
├── codesign/ - Fakes codesigning for Electron apps; used for testing.
├── lib/ - Miscellaneous python utility scripts.

View File

@@ -99,7 +99,7 @@ Using `autoUpdater` as an example:
## Methods
### `autoUpdater.setFeedURL(url[, requestHeaders])`
### `autoUpdater.setFeedURL(options)`
```
### Classes

Some files were not shown because too many files have changed in this diff Show More