Compare commits

..

413 Commits

Author SHA1 Message Date
John Kleinschmidt
9c80e566d5 try this 2025-12-09 14:20:48 -05:00
John Kleinschmidt
890edfb763 fixup install ubuntu 2025-12-09 13:17:48 -05:00
John Kleinschmidt
657bf1586c install ubuntu on WSL 2025-12-09 12:32:50 -05:00
John Kleinschmidt
745467c21f use wsl list verbose 2025-12-05 12:56:47 -05:00
John Kleinschmidt
93eba0403f fixup 2025-12-05 12:31:57 -05:00
John Kleinschmidt
955743c40e see if we can install wsl with powershell 2025-12-05 12:16:57 -05:00
John Kleinschmidt
634e686ee5 build: use WSL on Window for faster builds 2025-12-05 11:49:36 -05:00
electron-roller[bot]
95e87e46ab chore: bump chromium to 144.0.7547.0 (main) (#49058)
* chore: bump chromium in DEPS to 144.0.7543.0

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

* chore: update patches

* chore: update filenames.libcxx.gni

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

* chore: bump chromium in DEPS to 144.0.7545.0

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7547.0

* chore: update patches

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

* fixup Add support for UnownedUserData in GlobalFeatures

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

* fixup BUILD.gn for lint

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

* chore: skip setting LPAC ACLs

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <70381+ckerr@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Samuel Attard <MarshallOfSound@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-12-04 16:40:04 -08:00
Jan Hannemann
90e338df50 fix: run toast creation on background thread (#49106)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

* fix: comments
2025-12-02 15:27:22 -08:00
dependabot[bot]
1b3fc9c174 build(deps): bump actions/checkout from 4.2.2 to 6.0.0 (#49125)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.2.2...1af3b93b6815bc44a9784bd300feb67ff0d1eeb3)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:02:06 -05:00
dependabot[bot]
c51018281f build(deps): bump github/codeql-action from 4.31.5 to 4.31.6 (#49124)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.5 to 4.31.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fdbfb4d275...fe4161a26a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:01:21 -05:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
Keeley Hammond
c7aa0b537d chore: cherry-pick ec6c18478382 from v8 (#48335)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches
2025-09-16 19:08:15 -07:00
Robo
048d620701 fix: remove unneeded handlescope from JS callbacks (#48318)
fix: remove handlescope from JS callbacks
2025-09-16 06:56:38 +09:00
Charles Kerr
15cdae1cf0 refactor: make api::NetLog inherit from gin::Wrappable (#48308)
* refactor: remove unused v8::Isolate* arg from NetLog ctor

* refactor: allocate api::NetLog on cpp heap

* refactor: make electron::api::Session::net_log_ a cppgc::Member<api::NetLog>

* refactor: remove unnecessary EscapableHandleScope

* chore: code style consistency
2025-09-16 06:29:46 +09:00
Shelley Vohr
bac383c219 feat: add fileSystem to ses.setPermissionCheckHandler (#48170)
feat: add fileSystem to ses.setPermissionCheckHandler
2025-09-15 17:00:58 -04:00
John Kleinschmidt
49eb165ef9 ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48319)
cleanup
2025-09-15 16:31:49 -04:00
Charles Kerr
a468ed7f10 refactor: narrow or remove gin arguments (#48300)
* refactor: narrow App:SetJumpList() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow WebContents::AddWorkSpace() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowMessageBox() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowOpenDialog() arg from gin::Arguments* to v8::Isolate*

* refactor: remove unused gin::Arguments* arg from OverrideGlobalPropertyFromIsolatedWorld()

* refactor: narrow WebContents::StartDrag() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow NetLog::StopLogging() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow Protocol::IsProtocolHandled() arg from gin::Arguments* to v8::Isolate*
2025-09-13 08:19:07 +09:00
Calvin
5444738721 fix: set ozone platform for wayland (#48301)
* fix: set ozone platform for wayland

* whoops, includes. thx charles
2025-09-13 08:17:06 +09:00
Charles Kerr
a6959ca97b refactor: allocate api::Debugger on cpp heap (#48266)
* refactor: remove unused isolate arg from Debugger ctor

* refactor: make Debugger ctor, dtor public

needed for cppgc::MakeGarbageCollected()

This is what upstream does, e.g. https://chromium-review.googlesource.com/c/chromium/src/+/6722236

* fixup! refactor: remove unused isolate arg from Debugger ctor

mark Debugger ctor as explicit

* refactor: in EventEmitterMixin, handle both old and new WrapperInfo types

* refactor: make electron::api::Debugger inherit from gin::Wrappable

* refactor: add api::Debugger::GetTypeName()

* refactor: add api::Debugger::GetClassName()
2025-09-11 16:03:17 -04:00
dependabot[bot]
45353ae38c build(deps): bump actions/setup-node from 4.4.0 to 5.0.0 (#48282)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.4.0 to 5.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](49933ea528...a0853c2454)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 21:35:54 -05:00
Charles Kerr
f702327dce refactor: avoid unused inheritance in ServiceWorkerMain (#48279)
ServiceWorkerMain does not need to inherit from EventEmitterMixin
2025-09-10 11:16:35 -05:00
dependabot[bot]
fda3a3d493 build(deps): bump github/codeql-action from 3.29.11 to 3.30.1 (#48283)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.11 to 3.30.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3c3833e0f8...f1f6e5f6af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 09:47:34 -05:00
Michaela Laurencin
dae5dad167 docs: update release timeline for unsupported v35 (#48285) 2025-09-09 15:03:48 -07:00
John Kleinschmidt
940ebb6c7a chore: update patches (#48278) 2025-09-08 15:44:47 -04:00
electron-roller[bot]
793565e4be chore: bump chromium to 141.0.7390.7 (main) (#48212)
* chore: bump chromium in DEPS to 141.0.7381.3

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7382.0

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7384.0

* chore: bump chromium in DEPS to 141.0.7386.0

* [Extensions] Move devtools_page and chrome_url_overrides handlers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6862700

* Reland "[api] Advance deprecation of GetIsolate"

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6875273

* Move "system integrated UI" concept out of NativeTheme.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6867375

* chore: update patches

* Reland "[PermissionOptions] Return PermissionResult in callback for requests"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6851838

* Reland "[exit-time-destructors] Enable by default"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update patches

* [FSA] Revoke Read access after removing file via FileSystemAccess API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6677249

* chore: IWYU

* [DevToolsUIBindings] Accept an object for `dispatchHttpRequest` params

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6877528

* chore: IWYU

* Pass navigation UI parameters on EnterFullscreen in EAM

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6874923

* chore: rm band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch

* Remove unused PreHandleMouseEvent

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6880411

* 6878583: siso: update to version 1.4.1

https://chromium-review.googlesource.com/c/chromium/src/+/6878583

* Fold native_theme_browser into native_theme.

https://chromium-review.googlesource.com/c/chromium/src/+/6882627

* fixup: Reland "[exit-time-destructors] Enable by default

https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update filenames.libcxx.gni

* chore: IWYU

* fixup: chore: IWYU

* fixup: Reland "[exit-time-destructors] Enable by default

* fixup: Reland "[exit-time-destructors] Enable by default

* Remove common_theme.*; place its method in NativeTheme instead.

https://chromium-review.googlesource.com/c/chromium/src/+/6886029

* fixup: Reland "[exit-time-destructors] Enable by default

* Better track when WebPreferences need updates for color-related changes.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6886797

* chore: bump chromium in DEPS to 141.0.7390.7

* 6904664: Reland "Make BrowserContext::GetPath() const"

https://chromium-review.googlesource.com/c/chromium/src/+/6904664

* Restore read access after certain file modification operations

https://chromium-review.googlesource.com/c/chromium/src/+/6861041

* fixup: Move "system integrated UI" concept out of NativeTheme.

* fixup: Reland "[exit-time-destructors] Enable by default

* chore: update patches

* 6906096: Remove GetSysSkColor().

https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* Inline implementation of SysColorChangeListener into the lone user.

https://chromium-review.googlesource.com/c/chromium/src/+/6905083

Also 6906096: Remove GetSysSkColor(). | https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* fixup: 6906096: Remove GetSysSkColor()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-08 12:57:15 +02:00
electron-roller[bot]
1f322ebce3 chore: bump node to v22.19.0 (main) (#48222)
* chore: bump node in DEPS to v22.19.0

* chore: fixup patch indices

* crypto: add tls.setDefaultCACertificates()

https://github.com/nodejs/node/pull/58822

* esm: js-string Wasm builtins in ESM Integration

https://github.com/nodejs/node/pull/59179

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-05 17:16:45 -04:00
Samuel Attard
f009e077f2 build: update spec deps for clean audit (#48238) 2025-09-03 15:05:49 -04:00
Calvin
fed73040e2 docs: move some planned breaking changes to 39 (#48236) 2025-09-01 14:55:11 -07:00
Shelley Vohr
828fd59a72 fix: file-only picker incorrectly allowing some directories (#48198) 2025-08-29 13:14:45 -04:00
Shelley Vohr
e892840975 fix: ensure dragging works again after emitting contextmenu event (#48199) 2025-08-29 10:37:37 -04:00
Shelley Vohr
7373173e44 fix: showMessageDialog should center dialog to parent (#48181) 2025-08-29 09:56:51 +02:00
electron-roller[bot]
5d5e672f17 chore: bump chromium to 141.0.7361.0 (main) (#48054)
* chore: bump chromium in DEPS to 141.0.7352.0

* chore: update patches

* 6830573: Revert 'Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable' | https://chromium-review.googlesource.com/c/chromium/src/+/6830573

* chore: bump chromium in DEPS to 141.0.7354.0

* chore: bump chromium in DEPS to 141.0.7356.0

* chore: bump chromium in DEPS to 141.0.7357.0

* chore: bump chromium in DEPS to 141.0.7359.0

* chore: bump chromium in DEPS to 141.0.7361.0

* 6838518: [Mac] Correctly deallocate sandbox error buffers and prevent crash resulting from nullptr assignment | https://chromium-review.googlesource.com/c/chromium/src/+/6838518

* 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* chore: update patches

* fixup! 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* fixup! 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* fix: unsafe buffer warning in fix_properly_honor_printing_page_ranges.patch

* fix: FTBFS in src_remove_dependency_on_wrapper-descriptor-based_cppheap.patch

This change should be upstreamed.

Fixes this error:

../../third_party/electron_node/src/env.cc:606:3: error: no matching function for call to 'Wrap'
  606 |   v8::Object::Wrap<v8::CppHeapPointerTag::kDefaultTag>(
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1076:14: note: candidate function template not viable: cannot convert argument of incomplete type 'void *' to 'v8::Object::Wrappable *' for 3rd argument
 1076 | void Object::Wrap(v8::Isolate* isolate, const v8::Local<v8::Object>& wrapper,
      |              ^
 1077 |                   v8::Object::Wrappable* wrappable) {
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1084:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const PersistentBase<Object>' for 2nd argument
 1084 | void Object::Wrap(v8::Isolate* isolate, const PersistentBase<Object>& wrapper,
      |              ^                          ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1093:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const BasicTracedReference<Object>' for 2nd argument
 1093 | void Object::Wrap(v8::Isolate* isolate,
      |              ^
 1094 |                   const BasicTracedReference<Object>& wrapper,
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
1 error generated.

* [v8-init] Access crash key only from main thread | https://chromium-review.googlesource.com/c/chromium/src/+/6827167

* chore: e patches all

* chore: remove chore_restore_some_deprecated_wrapper_utility_in_gin.patch from patches

this remove line got re-added when rebasing roller/chromium/main

* chore: e patches all

* fix: include base/time/time.h when using base::Time

* chore: update patches

* Make --host-rules an alias for --host-resolver-rules.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/4867872

* ci: update BUILD_TOOLS_SHA

Refs https://github.com/electron/build-tools/pull/746

* [Fontations] Remove Fontations suffix from font names

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6835930

* temp: debug macOS addon build failure

* Revert "temp: debug macOS addon build failure"

This reverts commit 40bc8abab65dc83e17c4ab97cb6e7522a193fb44.

* test: run tests with Xcode 16.4

* ci: fix tccdb update for macOS 15

* spec: disable opening external application for loadURL

on macOS opening unknown external application will bring
up dialog to choose apps from application store which will
break our other test suites that want to capture screen
for pixel matching.

The loadURL spec that tests bad-scheme://foo is sufficient
that we hit the permission handler for openExternal since
at that point we already know the runtime gave up on handling
the scheme.

* chore: rebase patches

* chore: disable codesiging tests

* ci: update ScreenCaptureApprovals.plist for /bin/bash

* ci: try updating tcc permissions

* ci: update TCC permissions

Refs https://www.rainforestqa.com/blog/macos-tcc-db-deep-dive

* chore: test with 1st quadrant of the window

* chore: adjust for macOS 15 menubar height

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-29 12:31:47 +09:00
LZL
e39943bf45 fix: BrowserWindow add the same BrowserView (#48053)
fix: BrowserWindow add the same BrowserView (#48057)
2025-08-28 10:31:41 +02:00
David Sanders
f331606e07 build: bump NMV to 140 (#48196) 2025-08-27 18:57:00 -07:00
David Sanders
cca55117e4 build: refactor Linux binary stripping to align with upstream (#47932) 2025-08-27 18:56:31 -07:00
Erick Zhao
bf29d2f0bd docs: fix some module headings (#48177) 2025-08-27 14:52:26 -07:00
John Kleinschmidt
fea1a2a987 ci: use free GH arm runners (#47872) 2025-08-27 10:01:36 -04:00
dependabot[bot]
a51c56aca9 build(deps): bump amannn/action-semantic-pull-request from 6.0.1 to 6.1.1 (#48175)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 6.0.1 to 6.1.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](fdd4d3ddf6...48f256284b)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.1.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:52:36 +02:00
dependabot[bot]
89f25e6af3 build(deps): bump github/codeql-action from 3.29.10 to 3.29.11 (#48174)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.10 to 3.29.11.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](96f518a34f...3c3833e0f8)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.11
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:49:43 +02:00
Robo
e0db4046b2 refactor: allocate gin_helper::internal::Event on cpp heap (#48161) 2025-08-27 09:30:50 +09:00
Calvin
3b9130d815 docs: add release timeline for Electron 39 (#48167) 2025-08-26 14:19:56 -07:00
Shelley Vohr
52ed4646d9 chore: remove upstream OSR temp fix (#48162) 2025-08-26 16:22:45 -04:00
John Kleinschmidt
68098c317f build: remove no longer needed arg for siso (#48164)
* build: remove no longer needed arg for siso

* chore: test ffmpeg zip

* build: fix ffmpeg build with siso

* Revert "chore: test ffmpeg zip"

This reverts commit 2bbcc86039.
2025-08-25 16:46:36 -04:00
dependabot[bot]
52e0307cc1 build(deps): bump github/codeql-action from 3.29.7 to 3.29.10 (#48113)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.7 to 3.29.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](51f77329af...96f518a34f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 13:23:15 +02:00
dependabot[bot]
7fffe77909 build(deps-dev): bump stream-json and @types/stream-json (#48114)
Bumps [stream-json](https://github.com/uhop/stream-json) and [@types/stream-json](https://github.com/DefinitelyTyped/DefinitelyTyped/tree/HEAD/types/stream-json). These dependencies needed to be updated together.

Updates `stream-json` from 1.8.0 to 1.9.1
- [Commits](https://github.com/uhop/stream-json/compare/1.8.0...1.9.1)

Updates `@types/stream-json` from 1.7.7 to 1.7.8
- [Release notes](https://github.com/DefinitelyTyped/DefinitelyTyped/releases)
- [Commits](https://github.com/DefinitelyTyped/DefinitelyTyped/commits/HEAD/types/stream-json)

---
updated-dependencies:
- dependency-name: stream-json
  dependency-version: 1.9.1
  dependency-type: direct:development
  update-type: version-update:semver-minor
- dependency-name: "@types/stream-json"
  dependency-version: 1.7.8
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 12:58:38 +02:00
Robo
3ccb1bc0a8 refactor: allocate api::Session on cpp heap (#48141) 2025-08-25 18:52:06 +09:00
Shelley Vohr
0917ed5f6f fix: snapped restoration after minimization (#48142) 2025-08-22 14:37:45 -04:00
Samuel Attard
a67aad0f50 build: use siso instead of reclient (#47534) 2025-08-22 14:17:02 -04:00
reito
ceb6d28fd3 fix: webContent.fromId should be number instead of string (#48059) 2025-08-22 11:40:10 -04:00
Shelley Vohr
e12ab6708e chore: improve failed notification error messages on Windows (#48131) 2025-08-22 11:35:39 -04:00
Shelley Vohr
6101025368 fix: net.isOnline always true in utility processes (#48111)
* fix: net.isOnline always true in utilityProcesses

* Update shell/services/node/node_service.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-08-22 14:30:41 +02:00
dependabot[bot]
97b0280ad4 build(deps): bump amannn/action-semantic-pull-request from 5.5.3 to 6.0.1 (#48115)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 5.5.3 to 6.0.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](0723387faa...fdd4d3ddf6)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-21 10:44:27 +02:00
John Kleinschmidt
1044fe675d build: use new 7z command line switch (#48136)
-snld20 replaces -snld
2025-08-20 17:05:25 -04:00
John Kleinschmidt
42af60cc7e docs: update 38.0 breaking changes (#48117) 2025-08-20 14:15:01 -04:00
John Kleinschmidt
cadba11088 build: fixup docs only condition (#48128) 2025-08-20 12:58:54 -04:00
Shelley Vohr
8aeee3f714 refactor: use XmlWriter for Windows toasts (#48065)
refactor: use XmlWriter for Windows toasts
2025-08-20 16:06:51 +02:00
Robo
dd54e84a58 refactor: allocate api::App on cpp heap (#48118) 2025-08-20 20:35:08 +09:00
John Kleinschmidt
d4b7d9e9cf build: get source cache for docs only pipeline (#48120) 2025-08-20 11:07:00 +02:00
BILL SHEN
83a5ba1e2c feat: add fileBacked and purgeable fields to process.getSystemMemoryInfo() for macOS (#47628)
* fix: Optimize the value of memory.free in the return data of getSystemMemoryInfo().

* fix: Improve the value of memory in the return data of getSystemMemoryInfo().

* fix: complete API doc.

* Update docs/api/process.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* fix: update name to fileBacked.

* fix: fix with code conflict

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
2025-08-20 09:49:41 +02:00
Shelley Vohr
13d955a73e fix: system accent color parsing hex order (#48085)
fix: system accent color parsing
2025-08-19 10:01:41 +02:00
Samuel Attard
fdf29ce838 fix: ensure snapshot is valid (#48101) 2025-08-18 14:35:58 -07:00
Samuel Attard
3770bb31a7 fix: avoid deprecated login item methods (#48090) 2025-08-17 22:00:52 -07:00
dependabot[bot]
ed4a99ba5b build(deps-dev): bump @azure/storage-blob from 12.25.0 to 12.28.0 (#48055)
Bumps [@azure/storage-blob](https://github.com/Azure/azure-sdk-for-js) from 12.25.0 to 12.28.0.
- [Release notes](https://github.com/Azure/azure-sdk-for-js/releases)
- [Changelog](https://github.com/Azure/azure-sdk-for-js/blob/main/documentation/Changelog-for-next-generation.md)
- [Commits](https://github.com/Azure/azure-sdk-for-js/compare/@azure/storage-blob_12.25.0...@azure/storage-blob_12.28.0)

---
updated-dependencies:
- dependency-name: "@azure/storage-blob"
  dependency-version: 12.28.0
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-16 09:39:46 +02:00
Shelley Vohr
0e6c26096f fix: shell.openPath should be non-blocking (#48079)
fix: shell.openPath should be non-blocking
2025-08-15 13:55:31 -07:00
Keeley Hammond
7792ed1efa build: revert bump @octokit/rest from 20.1.2 to 22.0.0 (#48082)
Revert "build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.0 (#48014)"

This reverts commit 13ed526ca7.
2025-08-14 20:50:09 -07:00
Robo
c75c390ccf chore: add uma results in macOS keychain patch (#48080) 2025-08-15 11:10:37 +09:00
Shelley Vohr
4c3c3049e1 build: disallow non-maintainer changes to GitHub Actions workflows (#48038) 2025-08-14 13:54:05 -07:00
Shelley Vohr
68e7b38c05 build: use quick tunnels for ssh debugging (#47938)
* build: use dynamic local tunnels for ssh debugging

* weeee

* that'll do

* chore: pretty output

* build: allow ssh input

---------

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-08-14 07:41:07 -04:00
dependabot[bot]
a051c7c274 build(deps): bump actions/download-artifact from 4.3.0 to 5.0.0 (#48052)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 4.3.0 to 5.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](d3f86a106a...634f93cb29)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-13 14:33:48 +02:00
Shelley Vohr
53003d7af9 fix: app.accessibilitySupportEnabled (#48041)
fix: app.accessibilitySupportEnabled on macOS
2025-08-12 16:51:27 -04:00
David Sanders
63d7f609cd ci: manually fetch author_association in workflow automations (#48013) 2025-08-12 10:30:41 -07:00
electron-roller[bot]
01291623af chore: bump chromium to 141.0.7350.0 (main) (#48032)
* chore: bump chromium in DEPS to 141.0.7349.0

* chore: bump chromium in DEPS to 141.0.7350.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-08-12 11:31:17 +02:00
dependabot[bot]
13ed526ca7 build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.0 (#48014)
Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.2 to 22.0.0.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.2...v22.0.0)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-12 11:18:08 +02:00
Shelley Vohr
afb0ee418c fix: re-entrancy issues in webContents.loadURL() (#48004)
fix: re-entrancy issues in webContents.loadURL()
2025-08-11 11:20:35 -04:00
electron-roller[bot]
55d8b71d72 chore: bump chromium to 141.0.7346.0 (main) (#47983)
* chore: bump chromium in DEPS to 141.0.7341.0

* chore: bump chromium in DEPS to 141.0.7342.0

* chore: update patches

manually resolved conflict in `osr_shared_texture_remove_keyed_mutex_on_win_dxgi.patch` due to https://crrev.com/c/6681354

* 6819541: WebShare: Improve mac share behavior when sharing a URL
https://chromium-review.googlesource.com/c/chromium/src/+/6819541

* Add missing include for SkBitmap

Couldn't quickly find where we lost the full definition in this file's includes. 🤷

* 6771055: [SxS] Move devtools to ContentsContainerView supporting side-by-side.
https://chromium-review.googlesource.com/c/chromium/src/+/6771055

There may be some simplification possible here (set_x, Rect position, ...), but this change is satisfactory to maintain the current behavior.

* 6813689: Switch SystemMemoryInfoKB to use ByteCount
https://chromium-review.googlesource.com/c/chromium/src/+/6813689

* 6818486: Track DevTools feature usage in new badge tracker
https://chromium-review.googlesource.com/c/chromium/src/+/6818486

* chore: bump chromium in DEPS to 141.0.7344.0

* Remove ELECTRON_OZONE_PLATFORM_HINT env var

6819616: Remove OzonePlatformHint | https://chromium-review.googlesource.com/c/chromium/src/+/6819616

See: https://github.com/electron/electron/issues/48001

* chore: update patches

* Add missing include for `base::NumberToString`

* Remove `DESKTOP_STARTUP_ID` code

This was removed upstream in https://chromium-review.googlesource.com/c/chromium/src/+/6819616 and I confirmed with the author that it was an intentional change. Going to mirror upstream and remove it here too.

* chore: bump chromium in DEPS to 141.0.7346.0

* chore: update patches

* 6828465: Reland "Remove BluezDBusThreadManager"
https://chromium-review.googlesource.com/c/chromium/src/+/6828465

* Patch change to Node.js test output

V8 enhanced the stack trace of "thenable" async tasks. A couple of Node.js tests needed to have their snapshots updates to accomodate the extra stack trace frames in the output.

This patch should be upstreamed to Node.js.

See:
6826001: fix thenable async stack trace
https://chromium-review.googlesource.com/c/v8/v8/+/6826001

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-11 12:57:31 +09:00
Calvin
b9ceaabb85 docs: deprecate ELECTRON_OZONE_PLATFORM_HINT env var (#48002) 2025-08-10 21:49:23 +02:00
David Sanders
d6c0691a63 fix: importing from electron/utility in ESM (#47998) 2025-08-09 09:47:47 +02:00
David Sanders
a201d6c541 build: drop @types/webpack-env in favor of webpack/module types (#47798)
* build: drop @types/webpack-env in favor of webpack/module types

* chore: improve type when assigning to global.require
2025-08-08 18:09:23 -07:00
John Kleinschmidt
51add3e847 ci: cleanup use new arc cluster (#47916) 2025-08-08 09:26:10 -04:00
reito
9dcdec5015 feat: paint event move texture data to handle, add colorSpace (#47315)
* feat: paint event move shared texture to handle, add color space

* feat: add breaking change

* fix: properties.

* fix: remove utf8 bom
2025-08-08 10:13:56 +02:00
reito
095e622a6a feat: context bridge support VideoFrame (#47316)
* feat: context bridge support VideoFrame

* docs: add VideoFrame to docs
2025-08-07 16:41:49 -04:00
Shelley Vohr
a0d983e4b5 feat: allow macOS tray to maintain position (#47838)
* feat: allow macOS tray to maintain position

* refactor: just use guid

* test: fixup tests

* docs: clarify UUID format
2025-08-07 19:25:50 +02:00
wujinli
f49a645c06 fix: compilation error when disabling extensions and pdf_viewer (#47964) 2025-08-07 11:18:32 -04:00
John Kleinschmidt
8ab5ac9069 ci: fixup mac runner hang (#47982) 2025-08-07 10:52:26 +02:00
Will Anderson
27a8cc531b chore: Remove redundant IS_WIN check inside electron_main_win.cc (#47967) 2025-08-07 09:54:13 +02:00
David Sanders
26ffc8505c fix: allow importing from electron/utility at runtime (#47968) 2025-08-07 09:53:42 +02:00
electron-roller[bot]
3b0f35a7e8 chore: bump chromium to 140.0.7339.2 (main) (#47929)
* chore: bump chromium in DEPS to 140.0.7330.0

* chore: bump chromium in DEPS to 140.0.7331.0

* chore: update patches

* fix: gn check failing on crashpad.h
Not yet sure what caused this

* fix: predictors::PreconnectManager -> content::PreconnectManager
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* chore: bump chromium in DEPS to 140.0.7333.0

* chore: bump chromium in DEPS to 140.0.7335.0

* chore: bump chromium in DEPS to 140.0.7337.0

* chore: update patches

* chore: restore some gin utility

* 6804057: [Extensions] Validate nodoc is specified as a boolean in schemas
https://chromium-review.googlesource.com/c/chromium/src/+/6804057

* fixup! chore: restore some gin utility

* fixup! fix: predictors::PreconnectManager -> content::PreconnectManager CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected
https://chromium-review.googlesource.com/c/chromium/src/+/6772346

Not certain about what the "correct" argument to pass here is. A quick dive into the CL suggests that passing `false` is safe to keep things working. The blast radius if this assumption is wrong is that "fling" scroll gestures may not work as expected with the OSR.

* 6789383: Uninstall SODA language pack after 30 days of inactivity
https://chromium-review.googlesource.com/c/chromium/src/+/6789383

* chore: update libcxx filenames

* chore: bump chromium in DEPS to 140.0.7339.0

* chore: update patches

* fixup! 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected https://chromium-review.googlesource.com/c/chromium/src/+/6772346

* chore: bump chromium in DEPS to 140.0.7339.2

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-06 20:14:23 -04:00
David Sanders
8769d5ba9e build: check zip manifest for chromedriver.zip (#47972) 2025-08-06 20:04:19 -04:00
dependabot[bot]
7f8b7c3873 build(deps-dev): bump @electron/lint-roller from 3.1.1 to 3.1.2 (#47963)
Bumps [@electron/lint-roller](https://github.com/electron/lint-roller) from 3.1.1 to 3.1.2.
- [Release notes](https://github.com/electron/lint-roller/releases)
- [Changelog](https://github.com/electron/lint-roller/blob/main/.releaserc.json)
- [Commits](https://github.com/electron/lint-roller/compare/v3.1.1...v3.1.2)

---
updated-dependencies:
- dependency-name: "@electron/lint-roller"
  dependency-version: 3.1.2
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-06 11:21:55 +02:00
David Sanders
8bf4260e3e test: add TS smoke test for electron/utility (#47969) 2025-08-06 10:30:39 +02:00
Charles Kerr
7a13c6f175 refactor: avoid deprecated v8::Context::GetIsolate() pt 4 (#47961)
* refactor: remove GetIsolate() calls from SetPrivate()

* refactor: remove excess GetIsolate() calls in PassValueToOtherContextInner()

* refactor: remove GetIsolate() calls from GetPrivate()

* refactor: add a v8::Isolate* local to ProxyFunctionWrapper()

* refactor: remove error_context->GetIsolate() call from PassValueToOtherContextInner()

* refactor: remove GetIsolate() call from ProxyFunctionWrapper()

* refactor: pass source and destination isolate as arg to CreateProxyForAPI()
2025-08-05 20:08:04 -05:00
Keeley Hammond
678fb400fd fix: video scrubbing on playback (#47703)
* fix: fix video scrubbing on playback

* chore: address review feedback

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-05 18:48:52 +02:00
Shelley Vohr
8806499904 fix: offscreen mode under window.open creation (#47868)
fix: offscreen mode under new window creation
2025-08-05 14:56:33 +02:00
dependabot[bot]
637a504e28 build(deps): bump github/codeql-action from 3.29.4 to 3.29.5 (#47962)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.4 to 3.29.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e828ff8d4...51f77329af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-05 14:41:57 +02:00
electron-roller[bot]
40cdfdb1d1 chore: bump node to v22.18.0 (main) (#47937)
* chore: bump node in DEPS to v22.18.0

* crypto: fix inclusion of OPENSSL_IS_BORINGSSL define

https://github.com/nodejs/node/pull/58845

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58960

* permission: propagate permission model flags on spawn

https://github.com/nodejs/node/pull/58853

* esm: syncify default path of ModuleLoader\.load

https://github.com/nodejs/node/pull/57419

* src: remove fast API for InternalModuleStat

https://github.com/nodejs/node/pull/58489

* src: simplify adding fast APIs to ExternalReferenceRegistry

https://github.com/nodejs/node/pull/58896/

* chore: fixup patch indices

* src: fix internalModuleStat v8 fast path

https://github.com/nodejs/node/pull/58054

* test: add tests to ensure that node.1 is kept in sync with cli.md

https://github.com/nodejs/node/pull/58878

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58942

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-04 14:40:36 -04:00
Robo
4ca10a1056 chore: move gin::Handle to gin_helper (#47959)
* chore: move gin::Handle to gin_helper

* chore: fix lint
2025-08-05 02:03:06 +09:00
Robo
9d05454dc7 chore: move gin::DeprecatedWrappable to gin_helper (#47958)
* chore: move gin::DeprecatedWrappable to gin_helper

This is in preparation for migrating to gin::Wrappable
based on cppgc #47922
The upstream class will be deleted soon via roller PR but
the cppgc migration should happen outside the roll, this
change retains the current functionality by copying the
implementation into //electron/shell/common/gin_helper.
The class can be deleted once the cppgc migration is complete.

* chore: fix lint:cpp
2025-08-04 23:28:01 +09:00
dependabot[bot]
0e862bba61 build(deps-dev): bump remark-preset-lint-markdown-style-guide from 4.0.0 to 6.0.1 (#47940)
build(deps-dev): bump remark-preset-lint-markdown-style-guide

Bumps [remark-preset-lint-markdown-style-guide](https://github.com/remarkjs/remark-lint) from 4.0.0 to 6.0.1.
- [Release notes](https://github.com/remarkjs/remark-lint/releases)
- [Changelog](https://github.com/remarkjs/remark-lint/blob/main/changelog.md)
- [Commits](https://github.com/remarkjs/remark-lint/commits)

---
updated-dependencies:
- dependency-name: remark-preset-lint-markdown-style-guide
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-04 14:29:36 +02:00
Shelley Vohr
4232ed2814 fix: crash on window.close() with webContents on blur (#47933)
fix: crash on window.close with WebContentsView on blur
2025-08-04 10:35:29 +02:00
Will Anderson
e7683bdd25 feat: Use DIR_ASSETS path to locate resource bundles (#47439)
* feat: Use DIR_ASSETS path to locate resource bundles

* Use DIR_ASSETS for calculating ASAR relative paths

* Add test to verify 'assets' matches parent dir of 'exe'

* Add Mac-specific test for assets path (but it is failing)

* test: Update app.getPath('assets') to expect an exception on Mac

* docs: Update docs for 'assets' path to indicate that it's only available on Windows + Linux

* fix: Don't define 'assets' mapping on macOS
2025-08-04 12:34:08 +09:00
Sam Maddock
bdaf3b9a2b refactor: replace webFrame.routingId with sync IPC (#47717)
* refactor: replace webFrame.routingId with sync IPC

* fix: GetConstructor missing isolate

* fix: missing isolate
2025-08-02 11:00:42 -04:00
Shelley Vohr
5c98e3609f feat: add {get|set}AccentColor on Windows (#47741)
* feat: add setAccentColor on Windows

* refactor: unify GetSystemAccentColor

* refactor: remove redundant parsing

* chore: fixup documentation

* Update docs/api/browser-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* Update docs/api/base-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

---------

Co-authored-by: Will Anderson <andersonw@dropbox.com>
2025-08-01 22:29:02 +02:00
dependabot[bot]
2cfccac074 build(deps-dev): bump folder-hash from 2.1.2 to 4.1.1 (#47931)
Bumps [folder-hash](https://github.com/marc136/node-folder-hash) from 2.1.2 to 4.1.1.
- [Release notes](https://github.com/marc136/node-folder-hash/releases)
- [Changelog](https://github.com/marc136/node-folder-hash/blob/main/CHANGELOG.md)
- [Commits](https://github.com/marc136/node-folder-hash/compare/v2.1.2...v4.1.1)

---
updated-dependencies:
- dependency-name: folder-hash
  dependency-version: 4.1.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-01 19:16:43 +02:00
electron-roller[bot]
03aad28412 chore: bump chromium to 140.0.7327.0 (main) (#47902)
* chore: bump chromium in DEPS to 140.0.7324.0

* chore: bump chromium in DEPS to 140.0.7325.0

* chore: remove @dsanders11's unused include patch
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6782507

* fix: apply keychain patch to new apple subdir
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* chore: update chromium patches

* chore: update other patches

* chore: bump chromium in DEPS to 140.0.7327.0

* fix: mistake in reapplied patch

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* chore: update patches

* fix: remove OnPrivateNetworkAccessPermissionRequired override
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6769208

* fix: update colorSpace property to use new unified value
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6795085

* fix: include OverlayWindowLiveCaptionButton
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787420

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* fix: format chromium_src/BUILD.gn
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

* fix: format BUILD.gn
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

* chore: include script/ in logged path

* fix: update filenames.libcxx.gni
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787279

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-31 18:11:00 -04:00
Sam Maddock
25e2459f31 feat: webFrameMain.fromFrameToken (#47850)
* feat: webFrameMain.fromFrameToken

* refactor: return null instead of undefined

* docs: mention renderer webFrame property

* chore: undo null->undefined in wfm.fromId api
this will be updated in another pr
2025-07-31 16:41:44 -04:00
Shelley Vohr
18af498cf1 build: roll build-images to 933c7d6 (#47880) 2025-07-31 12:08:45 -04:00
John Kleinschmidt
9f43503b3e chore: revert "ci: fixup mac runners" (#47917)
This reverts commit 06d7a51a58.
2025-07-31 11:08:43 -04:00
Shelley Vohr
ecb1eb0b5d feat: add app.getRecentDocuments() (#45839)
feat: add app.getRecentDocuments()
2025-07-31 16:15:33 +02:00
dependabot[bot]
2c916cfa33 build(deps-dev): bump @octokit/rest from 20.1.1 to 20.1.2 (#47818)
* build(deps-dev): bump @octokit/rest from 20.1.1 to 22.0.0

Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.1 to 22.0.0.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.1...v22.0.0)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump octokit/rest to 20.1.2

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-07-31 14:30:45 +02:00
Shelley Vohr
4c9ab8765b fix: dark mode on Linux default themeing (#47869) 2025-07-31 10:54:55 +02:00
dependabot[bot]
051f78dd1d build(deps): bump actions-cool/issues-helper from 3.6.0 to 3.6.2 (#47905)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.0 to 3.6.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](a610082f8a...50068f49b7)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.6.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-31 10:54:25 +02:00
dependabot[bot]
c796a74467 build(deps): bump github/codeql-action from 3.29.2 to 3.29.4 (#47904)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.2 to 3.29.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](181d5eefc2...4e828ff8d4)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.4
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-31 10:54:03 +02:00
John Kleinschmidt
0d0cbaf7b4 ci: use new arc cluster (#47897) 2025-07-30 13:45:24 -04:00
Charles Kerr
63c452dcc7 refactor: avoid deprecated v8::Context::GetIsolate() calls pt 3 context get isolate pt 3 (#47901)
* refactor: add a v8::Isolate* arg to RendererClientBase::IsWebViewFrame()

Needed for creating gin dictionaries

refactor: add a v8::Isolate* arg to ShouldLoadPreload()

Needed for calling IsWebViewFrame()

* refactor: add a v8::Isolate* arg to electron::util::CompileAndCall()

* refactor: add a v8::Isolate* arg to OnCreatePreloadableV8Context()

* refactor: add a v8::Isolate* arg to InvokeEmitProcessEvent()

* refactor: add a v8::Isolate* arg to ServiceWorkerData's constructor

* refactor: add a v8::Isolate* arg to RendererClientBase::SetupMainWorldOverrides()

* refactor: add a v8::Isolate* arg to RendererClientBase::WilLReleaseScriptContext()

* docs: update docs to avoid v8::Context::GetIsolate()

* refactor: add a v8::Isolate* arg to ElectronSandboxedRendererClient::InitializeBindings()

* refactor: avoid v8::Context::GetIsolate() call in PromiseBase::SettleScope::~SettleScope()
2025-07-30 09:14:38 -05:00
electron-roller[bot]
f6407b4949 chore: bump chromium to 140.0.7314.0 (main) (#47882)
* chore: bump chromium in DEPS to 140.0.7314.0

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

* 6632993: PDF Searchify IPH: Use embedder WebContents for GuestView PDF

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6632993

* 6769214: [ios blink] Set IOSurface shared memory region on all GMB handles

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769214

* chore: update patches

* 6769572: [soft navs]: Move AsyncSameDocumentNavigationStarted to TaskAttributionTracker

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769572

* chore: node gen-libc++-filenames.js

* 6765740: [SxS] Implement support for split view in extensions API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765740

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-28 15:31:54 -07:00
John Kleinschmidt
06d7a51a58 ci: fixup mac runners (#47877)
ci: make sure camera and bluetooth are available on macos

ci: turn off spotlight indexing
2025-07-28 13:37:05 -04:00
Charles Kerr
2255bb620a refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 2) (#47879)
* refactor: add a v8::Isolate* arg to Constructible::GetConstructor()

* refactor: add a v8::Isolate* arg to NodeBindings::Initialize()

This is needed for the GetConstructor() call

* refactor: avoid v8::Context::GetIsolate() call in GetIpcObject() by taking it as an arg

* refactor: avoid v8::Context::GetIsolate() call in ipc_native::EmitIPCEvent() by taking it as an arg
2025-07-28 10:22:27 -05:00
Charles Kerr
084c6ef549 refactor: prefer GetCreationContextChecked(v8::Isolate*) over GetCreationContextChecked() (#47878)
* refactor: pass an isolate when calling GetCreationContextChecked() in V8FunctionInvoker

* refactor: pass an isolate when calling GetCreationContextChecked() in RendererClientBase

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::Completed()

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::CopyResultToCallingContextAndFinalize()

* refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()

* refactor: pass an isolate when calling GetCreationContextChecked() in gin_helper::internal::CallMethodWithArgs()

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalPropertyFromIsolatedWorld()

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalValueFromIsolatedWorld()

* refactor: pass an isolate when calling GetCreationContextChecked() in ProxyFunctionWrapper()

* refactor: pass an isolate when calling GetCreationContextChecked() in PassValueToOtherContextInner()

* fixup! refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()
2025-07-25 09:06:57 -05:00
Shelley Vohr
01faaa30ea fix: window content protection on older Windows versions (#47856) 2025-07-24 12:05:28 -07:00
electron-roller[bot]
c569d5e4ba chore: bump chromium to 140.0.7312.0 (main) (#47862)
* chore: bump chromium in DEPS to 140.0.7312.0

* 6769540: Move NetworkTrafficAnnotationTag out of PreconnectManager.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769540

* 6771377: Roll libc++ from 3eda1e62e799 to 569aa83b4bbc (7 revisions)

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771377

* 6771398: Remove unnecessary std::optional wrappers in ResolveHostClient

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771398

* chore: update patches

* 6776165: Use shared session bus for MPRIS

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6776165

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-23 16:26:30 -07:00
Shelley Vohr
670da27305 ci: add ability to debug SSH sessions in CI (#47819) 2025-07-23 10:57:06 -04:00
dependabot[bot]
5f901174c5 build(deps): bump slackapi/slack-github-action from 2.1.0 to 2.1.1 (#47748)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 2.1.0 to 2.1.1.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](b0fa283ad8...91efab103c)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-version: 2.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-23 11:24:17 +02:00
xufuhang
b39a1fb877 fix: webContents.downloadURL() did not support referer header (#47625)
Signed-off-by: xufuhang <576484918@qq.com>
2025-07-23 10:37:24 +02:00
Robo
2156ccb577 ci: update llvmobjdump package as part of fix sync (#47858) 2025-07-23 17:05:30 +09:00
electron-roller[bot]
9e2f7065a0 chore: bump chromium to 140.0.7309.0 (main) (#47848)
* chore: bump chromium in DEPS to 140.0.7309.0

* 6762172: Replace MSG_ROUTING_NONE with IPC::mojom::kRoutingIdNone.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6762172

* 6759543: [exit-time-destructors] Exclude target with warnings

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759543

* 6765167: Split PreconnectManager into interface and implementation.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765167

* 6766775: [media] Clarify coded and visible size in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6766775

* 6760878: Move PreconnectRequest to //content/public

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6760878

* 6718973: Implement media playback trust check for the video PiP overlay window

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6718973

* chore: add missing include of <iterator> in ada

* chore: update patches

* chore: node gen-libc++-filenames.js

* 6759633: [media] Use format from shared image in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759633

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-22 16:09:47 -07:00
Niklas Wenzel
51bfe07da9 build: extend Chromium options in bug report template (#47829)
* build: extend Chromium options in bug report template

As predicted by @dsanders11 and others, we got a bunch of bug reports with clearly incorrect values for "does this issue appear in Chromium?" because people didn't test or didn't know how to test.

This PR adds an "I didn't know how to test" option.

* build: update wording to use present tense
2025-07-21 15:26:02 -04:00
Shelley Vohr
4699761649 build: improve check-zip-manifest (#47828)
* build: improve check-zip-manifest

* fix: unicode on Windows
2025-07-21 15:20:27 -04:00
electron-roller[bot]
26e1bda335 chore: bump chromium to 140.0.7301.0 (main) (#47747)
* chore: bump chromium in DEPS to 140.0.7296.0

* chore: update patches

* 6702959: Remove OwnedByWidgetPassKey usage from content analysis dialog tests | https://chromium-review.googlesource.com/c/chromium/src/+/6702959

* 6722750: Remove un-used `stream_id` argument for `AidaCodeComplete` | https://chromium-review.googlesource.com/c/chromium/src/+/6722750

* 6696478: Reland Reland [video pip] Add fade in/out animation to controls visibility changes | https://chromium-review.googlesource.com/c/chromium/src/+/6696478

* chore: update libc++-filenames

* build: explicitly include cstdlib in Boyer-Moore patch

* chore: bump chromium in DEPS to 140.0.7297.0

* chore: update patches

* 6729537: [FPF] Pipe flag state from the browser to the renderer | https://chromium-review.googlesource.com/c/chromium/src/+/6729537

* 6727996: [Win] Detect pre-IPC crashes in sandboxed utility processes | https://chromium-review.googlesource.com/c/chromium/src/+/6727996

* 6707182: Move wtf/cross_thread_copier*.* to "blink" namespace | https://chromium-review.googlesource.com/c/chromium/src/+/6707182

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

* chore: bump chromium in DEPS to 140.0.7299.0

* chore: update patches

* chore: update main patches

* build: reset the minimum macOS SDK to 15 to match upstream

This reverts commit 499e987c77.

* 6730215: Remove IPC_MESSAGE_LOG_ENABLED ifdef blocks. | https://chromium-review.googlesource.com/c/chromium/src/+/6730215

* 6690442: Delete ppapi/buildflags/buildflags.h | https://chromium-review.googlesource.com/c/chromium/src/+/6690442

* [wip]: 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

* chore: bump chromium in DEPS to 140.0.7301.0

* chore: update patches

* 6656309: extensions: Port proxy API to desktop Android | https://chromium-review.googlesource.com/c/chromium/src/+/6656309

* 6758510: Reland 'Move GN enable_plugins variable out of //ppapi' | https://chromium-review.googlesource.com/c/chromium/src/+/6758510

* 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

* 6735979: [FSA] Replace `request_writable` with a new enum `FileSystemAccessPermissionMode`. | https://chromium-review.googlesource.com/c/chromium/src/+/6735979

* 6712080: Reland "Turn on gender translation PAK generation everywhere" | https://chromium-review.googlesource.com/c/chromium/src/+/6712080

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

* build: restore minimum macOS SDK to 10, restore patch

This reverts commit a04c579b99.

* fixup! 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

* chore: correct node patches

* fixup! 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-21 09:32:53 -07:00
Shelley Vohr
cf871bce4e build: fix ffmpeg generation on Windows non-x64 (#47768)
* build: fix ffmpeg generation on Windows non-x64

* test: ffmpeg artifact
2025-07-21 11:33:42 -04:00
Charles Kerr
39cca586f6 refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 1) (#47760)
* refactor: avoid redundant GetIsolate() calls in NodeBindings::CreateEnvironment()

Xref: https://chromium-review.googlesource.com/c/v8/v8/+/6563615

* refactor: use v8::Isolate::GetCurrent() in Initialize() methods

* refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

* fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

* refactor: add v8::Isolate* arg to RendererClientBase::DidCreateScriptContext()

* fixup! refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

* fixup! fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

refactor: prefer JavascriptEnvironment::GetIsolate() in the browser layer
2025-07-21 16:34:38 +02:00
Shelley Vohr
2f4a070c39 fix: dialog file filters and macOS app bundles (#47825) 2025-07-21 13:57:50 +02:00
electron-roller[bot]
2b098408a8 chore: bump node to v22.17.1 (main) (#47776)
* chore: bump node in DEPS to v22.17.1

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-18 15:18:18 -04:00
Shelley Vohr
fa844268ec ci: remove kTCCServiceMicrophone change (#47816)
ci: remove kTCCServiceMicrophone change
2025-07-18 10:02:06 +02:00
Shelley Vohr
a29a72c3ab build: update codespace on-create-command (#47810)
build: update codespace on-create-command
2025-07-18 10:01:49 +02:00
Shelley Vohr
4601aeccde chore: clean up NativeWindowMac::UpdateVibrancyRadii (#47665)
chore: clean up NativeWindowMac::UpdateVibrancyRadii
2025-07-17 11:45:24 -04:00
Shelley Vohr
31b18c9830 fix: abnormal behavior of windows background material (#47386)
* fix: abnormal behavior of windows background material

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: update patches

* fix: setting background material after init

---------

Co-authored-by: zoy <zoy-l@outlook.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-17 14:50:12 +02:00
Shelley Vohr
895bf9103e fix: handle missing NativeWindowMac in ElectronNSWindow (#47751)
fix: handle missing NativeWindowMac in ElectronNSWindow
2025-07-17 14:49:37 +02:00
David Sanders
bf51d345c8 build(dev-deps): drop unused @types/webpack dep (#47767) 2025-07-17 11:04:11 +02:00
Shelley Vohr
6eef170d9a test: re-enable native module tests (#46747) 2025-07-17 11:03:15 +02:00
Shelley Vohr
31725b4a86 fix: window accentColor should adhere to native window behavior (#47740)
* fix: window accentColor should adhere to native window behavior

* fix: address review feedback

* chore: remove duplicate UpdateWindowAccentColor call in ctor
2025-07-17 10:59:42 +02:00
John Kleinschmidt
ec748eb915 test: cleanup RenderFrame lifespan tests (#47746)
* test: cleanup RenderFrame lifespan tests

* test: disable navigator.serial tests on arm64 mac

debug the hang

test: disable navigator.bluetooth on arm64 mac

Revert "test: disable navigator.bluetooth on arm64 mac"

This reverts commit 4b53a8485a5ff391832c7da93d859f1aa8722e70.

Revert "debug the hang"

This reverts commit 00338f0d49a7918224822087b4510fa9db0686c3.

Revert "test: disable navigator.serial tests on arm64 mac"

This reverts commit fb515ce447a9d42185e84b17b460e4fb6d1bf71d.

Reapply "test: disable navigator.serial tests on arm64 mac"

This reverts commit 0e5608108ffebbe8b8b27af9ea06aadae2ea85dd.

Reapply "test: disable navigator.bluetooth on arm64 mac"

This reverts commit f4c7d3fc0624a22421cba5d3d75df8c5d4367eea.

fixup

* test: add waitUntil for flaky test
2025-07-16 16:19:55 -04:00
Shelley Vohr
5feb91e2f4 test: fix extensions console flake (#47750) 2025-07-16 18:27:20 +02:00
Shelley Vohr
5128ebeddb test: deflake clipboard read/write specs (#47752) 2025-07-16 18:27:11 +02:00
Calvin
389927dce8 fix: corner smoothing feature gate crash (#47759)
* fix: corner smoothing feature gate crash

* Fix ElectronCornerSmoothing::CSSValueFromComputedStyleInternal
2025-07-16 08:39:17 -07:00
Calvin
67afc10b75 fix: add macos memory query fallback patch to avoid crash (#47765) 2025-07-16 08:18:54 -07:00
Pratyush
f570e6967f docs: fix broken sentence in crashReporter.start() documentation (#47688) 2025-07-16 15:05:45 +02:00
Shelley Vohr
09ab71de43 fix: deprecation warning crash when no Node.js environment available (#47700) 2025-07-16 12:45:59 +02:00
Milan Burda
21b325b034 docs: improve win.setContentProtection() docs (#46596)
* docs: improve win.setContentProtection() docs

* docs: update Windows display affinity value

* docs: update Windows behavior description

* Revert "docs: update Windows behavior description"

This reverts commit 6d1942c53a.

* Revert "docs: update Windows display affinity value"

This reverts commit c15363e75d.

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-07-15 15:16:56 -07:00
Erick Zhao
cc9ca4bee2 docs: add Menu module tutorials (#47268)
* docs: add `Menu` module tutorials

* link API docs to new tutorials

* removed unreferenced fiddles

* add wording for new types

* fix import sort errors

* delete accelerator.md

* fixes
2025-07-15 15:09:32 -07:00
Shelley Vohr
17dba93587 fix: missing SQLite builtin support in Node.js (#47706)
https://github.com/nodejs/node/pull/58122
2025-07-15 15:39:16 +02:00
electron-roller[bot]
603cafad7e chore: bump chromium to 140.0.7281.0 (main) (#47616)
* chore: bump chromium in DEPS to 140.0.7269.2

* chore: bump chromium in DEPS to 140.0.7270.0

* chore: bump chromium in DEPS to 140.0.7271.0

* chore: bump chromium in DEPS to 140.0.7273.0

* 6516731: [ExclusiveAccessForAndroid] remove unneeded includes & deps | https://chromium-review.googlesource.com/c/chromium/src/+/6516731

* 6694809: dbus: Ensure systemd scope is started before using any portal services | https://chromium-review.googlesource.com/c/chromium/src/+/6694809

* chore: patch chromium

* chore: export patches

* chore: bump chromium in DEPS to 140.0.7275.0

* 6677511: [pepper] More pepper removal | https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: export chromium patches

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: bump chromium in DEPS to 140.0.7277.0

* chore: bump chromium in DEPS to 140.0.7279.0

* chore: bump chromium in DEPS to 140.0.7281.0

* 6677314: Plumb enabled client hints in the network requestion to network layer

https://chromium-review.googlesource.com/c/chromium/src/+/6677314

* 6351556: [source-phase-imports] Support Wasm Source Phase Imports

https://chromium-review.googlesource.com/c/chromium/src/+/6351556

* 6700077: [renderer] Avoid calls to deprecated GetIsolate methods

https://chromium-review.googlesource.com/c/chromium/src/+/6700077

* 6692873: Reland "Reland "FSA: Only normalize the hardcoded rules once during initialization""

https://chromium-review.googlesource.com/c/chromium/src/+/6692873

* 6686234: [gin] Cleanup NamedPropertyInterceptor for Wrappable

https://chromium-review.googlesource.com/c/chromium/src/+/6686234

* chore: export patches

* 6667723: Remove content_enable_legacy_ipc GN arg.

https://chromium-review.googlesource.com/c/chromium/src/+/6667723

* 6646566: ui: Move NativeWindowTracker to its own directory

https://chromium-review.googlesource.com/c/chromium/src/+/6646566

* fix: add missing includes

* 6580522: [WAR, DNR] Fix unsafe redirect error to web accessible resource

https://chromium-review.googlesource.com/c/chromium/src/+/6580522

* 6680477: Implement `completeCode` endpoint and expose to DevTools

https://chromium-review.googlesource.com/c/chromium/src/+/6680477

* 6677511: [pepper] More pepper removal

https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6696689: Rename views::WidgetFocusManager -> NativeViewFocusManager

https://chromium-review.googlesource.com/c/chromium/src/+/6696689

* 6702812: Move wtf/text/string_impl*.* to "blink" namespace

https://chromium-review.googlesource.com/c/chromium/src/+/6702812

* chore: fix dialog patch

* 6702431: [animation-trigger] Parse timeline-trigger-name

https://chromium-review.googlesource.com/c/chromium/src/+/6702431

* chore: fixup patch indices

* feat: replace webFrame.routingId with webFrame.frameToken

* feat: WebFrameMain.prototype.frameToken

* test: refactor to use replacement APIs

* chore: fixup pip patch

* test: adjust webFrame tests for frameToken changes

* 6703757: Reland "Enable -fsanitize=array-bounds in non-UBSan builds"

https://chromium-review.googlesource.com/c/chromium/src/+/6703757

* test: switch to frameTokens

* test: routingId is fine to test in the main process

* docs: add routingId to breaking changes

* docs: update plugin-crashed event

* chore: fixup linux dialog patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-14 13:42:37 -07:00
Shelley Vohr
09f269426e test: add response to bluetooth request possibilities (#47725) 2025-07-14 13:12:27 -04:00
Shelley Vohr
3bbb82b42b ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK (#47694)
ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK
2025-07-14 13:11:07 -04:00
Shelley Vohr
a9504abde9 build: roll sysroots (#47710) 2025-07-14 11:27:19 -04:00
BILL SHEN
9f3636ffe2 build: add platform-specific conditions to the source_set in chromium_src (#47627)
* build: Add platform-specific if conditions to the source sets in chromium_src.

* build: Add platform-specific if conditions to the source sets in chromium_src.
2025-07-14 11:25:16 +02:00
Shelley Vohr
4a89068fb7 ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors (#47726)
ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors
2025-07-13 21:05:52 +02:00
John Kleinschmidt
137d4ec329 build: cleanup symlinks in cache (#47727)
* build: cleanup symlinks in cache

* build: ignore broken links

* try --ignore-failed-read

* build: dont deref symlinks

* build: add flag to 7zip to resolve symlink error

Needed to ignore Dangerous symbolic link path was ignored errors

* Revert "build: cleanup symlinks in cache"

This reverts commit 69e53cdc88.
2025-07-11 16:13:12 -04:00
David Sanders
624d085632 build: deep update brace-expansion to resolve an audit alert (#47692) 2025-07-11 09:57:41 +02:00
Robo
600b6b3315 build: reenable v8_enable_temporal_support (#47699)
* build: reenable v8_enable_temporal_support

* ci: test with increased vm map count

* chore: backport PA use fewer vmas by default on linux

* chore: update patches

* Revert "ci: test with increased vm map count"

This reverts commit b626c9a5ab7ad3f01e17d77c330abfd8096a8b02.

* ci: remove logs

---------

Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-11 02:49:54 +09:00
David Sanders
9e67bd3508 ci: update audit CI workflow dependencies (#47691)
* ci: update audit CI workflow dependencies

* ci: bump to @electron/fiddle-core@2.0.1
2025-07-10 19:19:36 +02:00
Shelley Vohr
909fd3d55a ci: set git core.longpaths to true (#47695)
ci: set git core.longpaths to true
2025-07-10 19:13:39 +02:00
Niklas Wenzel
f2429c31c1 build: ask bug reporters to check if it is a Chromium issue (#47702)
* build: ask bug reporters to check if it is a Chromium issue

Inspiration: https://github.com/electron/electron/issues/47672#issuecomment-3051298922

* build: fix options
2025-07-10 08:47:04 -07:00
Shelley Vohr
fbb83be785 refactor: use dbus_thread_linux::GetSharedSessionBus() (#47685)
refactor: use dbus_thread_linux::GetSharedSessionBus()
2025-07-10 10:17:34 +02:00
Shelley Vohr
1eab19fc7c build: remove unused script (#47642) 2025-07-09 10:35:04 -04:00
Shelley Vohr
02f2feabe6 docs: update build prerequisites (#47680) 2025-07-09 12:07:24 +02:00
David Sanders
712262597d build: drop eslint-plugin-unicorn (#47676) 2025-07-08 15:20:56 +02:00
Shelley Vohr
31bc5ca903 fix: default to system accent color on invalid user color (#47660)
fix: default to system accent color on invalid user color"
2025-07-08 11:15:13 +02:00
Shelley Vohr
03a02fc31e fix: fullscreen for windows without rounded corners (#47664) 2025-07-08 11:14:14 +02:00
Shelley Vohr
5ef6897bc7 fix: accent color should reflect system settings without restart (#47629)
fix: accentColor should reflect system settings without restart
2025-07-03 18:13:39 +02:00
Charles Kerr
bc585b6a3f refactor: avoid a few unnecessary strings (#47644)
* perf: replace string temporary with string_view in GetXdgAppId()

* perf: replace string temporary with string_view in ToV8(WindowOpenDisposition)

* perf: replace string temporary with string_view in ToV8(electron::api::WebContents::Type)
2025-07-03 11:08:59 -05:00
David Sanders
4c460df0a4 ci: fix audit workflow alerting on stale results (#47643) 2025-07-03 14:42:04 +02:00
Shelley Vohr
cf193b279b fix: crash on source capture with empty thumbnail size (#47641) 2025-07-03 14:41:19 +02:00
Shelley Vohr
655037fbdf fix: window.open popups are always resizable (#47540)
fix: window.open popups are always resizable

Closes https://github.com/electron/electron/issues/43591.

Per current WHATWG spec, the `window.open` API should always
create a resizable popup window. This change updates the
`parseFeaturesString` function to ensure that windows opened
with `window.open` are always resizable, regardless of the
`resizable` feature string.
2025-07-02 15:02:59 +02:00
Samuel Attard
07338bb1cf build: update yarn to 1.22.22 (#47635) 2025-07-02 12:11:42 +02:00
reito
fb0b77b731 feat: add ColorSpace (#47314) 2025-07-02 00:09:09 -07:00
Keeley Hammond
499e987c77 build: set the minimum macOS SDK to 10.15 (#47634)
* build: set the minumum macOS SDK to 10.15

* build: revert "Update mac_sdk_min to match minimum required SDK version"

This reverts commit 3d4654fc18.
2025-07-01 18:51:08 -07:00
Cas_
f7138344d8 docs: discoverability of chromium switches (#44947)
* docs: document discoverability of chromium switches

* docs: fixed typo

* docs: reference chromium endorsed list of swithes

* docs: reorder command-line-switches

* fix: address review

* fix: typo

* fix: wording

* Update command-line-switches.md

fix: lint space

* fix: Update docs/api/command-line-switches.md

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-07-01 14:31:49 -07:00
dependabot[bot]
b9248e6782 build(deps): bump github/codeql-action from 3.29.0 to 3.29.2 (#47622) 2025-07-01 11:12:15 +02:00
Shelley Vohr
af39dcfb09 refactor: use non-deprecated macOS API in RemoveAsDefaultProtocolClient (#47506)
refactor: use non-deprecated macOS API in RemoveAsDefaultProtocolClient
2025-07-01 10:19:28 +02:00
Samuel Attard
d347632046 build: write abi version to published npm package (#47598) 2025-06-30 15:01:09 -07:00
electron-roller[bot]
4f69c5835e chore: bump chromium to 140.0.7261.0 (main) (#47561)
* chore: bump chromium in DEPS to 140.0.7259.0

* chore: update patches

* Add fade in animation to Picture-in-Picture windows

https://chromium-review.googlesource.com/c/chromium/src/+/6538268

* [v8] Use V8 Apis that don't return JSGlobalObject

Refs https://issues.chromium.org/issues/333672197

* chore: IWYU

* chore: bump chromium in DEPS to 140.0.7261.0

* chore: update patches

* revert: update to siso-chromium image

* [v8] Use v8::Object::WrapGlobal()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6650977

* chore: IWYU

* chore: fix --trace-startup spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-30 12:30:05 -04:00
Taiki Komoda
fa15332587 docs: update automated-testing.md (#47017)
* Update automated-testing.md

* fixed lint error
2025-06-30 10:56:48 +02:00
Shelley Vohr
e299a1d098 feat: support complete WebUSB device properties (#47459)
* feat: support complete WebUSB device properties

* docs: correct type consistency
2025-06-30 10:28:21 +02:00
Charles Kerr
c2302960a8 refactor: reduce scope of temporaries when getting dictionary values (#47581)
refactor: reduce scale of temporaries when getting dictionary values
2025-06-29 21:58:18 +02:00
Charles Kerr
5e862f398e fix: Reland "[accessibility] Platform node lifetime cleanups" (#47590)
Reland "[accessibility] Platform node lifetime cleanups"

https://chromium-review.googlesource.com/c/chromium/src/+/6462552
2025-06-29 21:57:48 +02:00
Shelley Vohr
61c245761c test: fix nan tests on macOS (#47583) 2025-06-29 21:57:44 +02:00
Charles Kerr
7c55b24be2 refactor: avoid copies of large objects in range based for loops (#47588)
* Avoid copies of large objects in range-based for-loops.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6527689

* Avoid copies of large objects in range-based for-loops in Browser::ShowAboutPanel()
2025-06-29 21:32:26 +02:00
Charles Kerr
4af248f2b6 perf: avoid copying a vector when calling ConvertToWeakPtrVector() (#47593) 2025-06-29 21:32:03 +02:00
Erick Zhao
69e9b653ba docs: update example apps (#47597) 2025-06-29 21:31:42 +02:00
electron-roller[bot]
4dccccadbb chore: bump node to v22.17.0 (main) (#47557)
* chore: bump node in DEPS to v22.17.0

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* chore: adjust crypto specs:

- https://github.com/nodejs/node/pull/58117
- https://github.com/nodejs/node/pull/58387

* deps: update libuv to 1.51.0

https://github.com/nodejs/node/pull/58124

* test: fix test-buffer-tostring-range on allocation failure

https://github.com/nodejs/node/pull/58416

* build: use FILE_OFFSET_BITS=64 esp. on 32-bit arch

https://github.com/nodejs/node/pull/58090

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* inspector: add protocol method Network.dataReceived

https://github.com/nodejs/node/pull/58001

* test: force slow JSON.stringify path for overflow

https://github.com/nodejs/node/pull/58181

* chore: fixup patch indices

* 6049967: Remove protocol::Maybe and roll inspector_protocol

https://chromium-review.googlesource.com/c/chromium/src/+/6049967

* chore: fixup crypto test patch

* src: fix module buffer allocation

https://github.com/nodejs/node/pull/57738

* crypto: expose process.features.openssl_is_boringssl

https://github.com/nodejs/node/pull/58387

* util: add internal assignFunctionName() function

https://github.com/nodejs/node/pull/57916

* build: fix pointer compression builds

https://github.com/nodejs/node/pull/58171

* chore: put back config options

* fixup! deps: update libuv to 1.51.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-06-28 16:33:09 +02:00
Charles Kerr
79cd6a2614 refactor: sync IsKillURL() with upstream impl in extension_tab_util.cc (#47580)
Use base::MakeFixedFlatSet()
2025-06-27 15:49:41 -05:00
Charles Kerr
2ba8fe9140 refactor: extract-constant static Windows registry keys in Browser code (#47569)
* refactor: extract-constant for registry key in GetProcessExecPath()

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

* refactor: extract-constant for registry key in Browser::GetLoginItemSettings()

* chore: document the symbolic constants

* refactor: prefer base::wcstring_view::c_str() to data() to make zero-termination clearer
2025-06-27 10:34:55 -05:00
Charles Kerr
b21c4b0f88 refactor: make context bridge's private keys hidden, constexpr string_views (#47562)
* refactor: local functions GetPrivate(), SetPrivate() now take std::string_views

* refactor: make local keys std::string_views instead of C-style char arrays

* refactor: make local keys constexpr

* refactor: move local keys into local anonymous namespace
2025-06-27 09:29:53 -05:00
Charles Kerr
f50ad3d022 refactor: remove stray .c_str() calls for absl::StrFormat() (#47548)
refactor: remove stray .c_str() calls for absl::StrFormat()

StrFormat() understands std::string, std::string_view
2025-06-26 11:41:30 +02:00
Keeley Hammond
7a274a711c fix: revert upstream MacOS mouse event routing (#47560)
* fix: revert upstream MacOS mouse event routing

* fix: reduce patch surface area

* chore: update patches
2025-06-26 11:41:11 +02:00
Niklas Wenzel
bc499ffb8a docs: fix --experimental-network-inspection spelling (#47565)
doc: fix `--experimental-network-inspection` spelling
2025-06-26 11:40:55 +02:00
Niklas Wenzel
0a74e91580 docs: update asar integrity fuse availability (#47528) 2025-06-25 23:15:59 +02:00
electron-roller[bot]
035879357e chore: bump chromium to 139.0.7256.0 (main) (#47481)
* chore: bump chromium in DEPS to 139.0.7242.0

* chore: update render_widget_host_view_mac.patch

no code changes; just updating patch context

Do a cleanup pass on the history swiper code | https://chromium-review.googlesource.com/c/chromium/src/+/6604367

* chore: update mas_avoid_private_macos_api_usage.patch.patch

no code changes; just updating patch context

[tracing] Delete base/trace_event/base_tracing.h | https://chromium-review.googlesource.com/c/chromium/src/+/6624012

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

no manual changes; just updating patch context

[ActorFramework] Refactor Actor Task Management | https://chromium-review.googlesource.com/c/chromium/src/+/6618684

* chore: update fix_move_autopipsettingshelper_behind_branding_buildflag.patch

[pip] Tuck picture-in-picture windows when a file dialog is open | https://chromium-review.googlesource.com/c/chromium/src/+/6449682

Reland "[document pip] Restrict the size that a website can request" | https://chromium-review.googlesource.com/c/chromium/src/+/6372104

* chore: update feat_corner_smoothing_css_rule_and_blink_painting.patch

Xref: corner-shape: constraint radii based on opposite corner overlap | https://chromium-review.googlesource.com/c/chromium/src/+/6592572

* chore: update revert_code_health_clean_up_stale_macwebcontentsocclusion.patch

no manual changes; just updating patch context

* chore: update fix_rename_sqlite_win32_exports_to_avoid_conflicts_with_node_js.patch

no code changes; just updating patch context

* chore: e patches all

* Plumb Verify2QwacBinding and hook it up in QwacWebContentsObserver

https://chromium-review.googlesource.com/c/chromium/src/+/6624719

* [Extensions] Remove host delegate OnMainFrameCreatedForBackgroundPage

https://chromium-review.googlesource.com/c/chromium/src/+/6631123

* Extensions: Rename GetResourceURL to ResolveExtensionURL

https://chromium-review.googlesource.com/c/chromium/src/+/6625053

* [NonClientFrameView] Consolidate NativeFrameViewMac

https://chromium-review.googlesource.com/c/chromium/src/+/6614239

* ICWYU

* [views-ax] Remove dead code WidgetAXTreeIDMap

https://chromium-review.googlesource.com/c/chromium/src/+/6619701

* Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS"

https://chromium-review.googlesource.com/c/chromium/src/+/6630056

* NavigationThrottleRunner2: Remove MaybeAddThrottle

https://chromium-review.googlesource.com/c/chromium/src/+/6628079

* [pip] Tuck picture-in-picture windows when a file dialog is open

https://chromium-review.googlesource.com/c/chromium/src/+/6449682

* build: fix snapshot_blob.bin build error

xref: https://issues.chromium.org/issues/416540976

* chore: e patches all

* build: freeup disk space on macos

* chore: bump chromium in DEPS to 139.0.7244.0

* chore: update printing.patch

no manual changes; just updating patch context

* chore: remove upstreamed ignore_parse_errors_for_resolveshortcutproperties.patch

Prevent Windows crash on unexpected shortcut type | https://chromium-review.googlesource.com/c/chromium/src/+/6633298

* chore: e patches all

* Revert "Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS""

This reverts commit 77c4f967a6.

Revert CL for the high confidence crash culprit for http://crash/28f897bb9743dfe0 | https://chromium-review.googlesource.com/c/chromium/src/+/6641819

* Fix spec's expected base64-encoded PNG strings to match upstream changes.

[rust png] Enable by default. | https://chromium-review.googlesource.com/c/chromium/src/+/6085801

* chore: bump chromium in DEPS to 139.0.7246.0

* chore: e patches all

* chore: bump chromium in DEPS to 139.0.7248.0

* chore: update patches

* siso: Enable Siso by default for non-Google builds

https://chromium-review.googlesource.com/c/chromium/src/+/6638830

Disabling for now until we are ready to build siso on all platforms.

* Revert "revert Don't use static variable for UseExternalPopupMenus"

This reverts commit e91e3894e6.

* Update mac_sdk_min to match minimum required SDK version

https://chromium-review.googlesource.com/c/chromium/src/+/6493969
(cherry picked from commit 3e7cbe912d)

* [video pip] Use default window styling on Mac

https://chromium-review.googlesource.com/c/chromium/src/+/6648665

* Reland "Force the unintentional renderer process creation check by default"

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* chore: bump chromium in DEPS to 139.0.7249.0

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* chore: update patches

* chore: bump chromium in DEPS to 139.0.7250.0

* chore: bump chromium in DEPS to 139.0.7252.0

* chore: bump chromium in DEPS to 139.0.7254.0

* 6638187: browser level TOCTOU check for coordinate target

https://chromium-review.googlesource.com/c/chromium/src/+/6638187

* chore: fixup patch indices

* chore: add missing base/notimplemented includes

* 6652910: [Frame Cleanup] Push down/hide implementation-specific API

https://chromium-review.googlesource.com/c/chromium/src/+/6652910

* chore: bump chromium in DEPS to 139.0.7256.0

* chore: fix lint

* fixup! 6652910: [Frame Cleanup] Push down/hide implementation-specific API

* fix: move HandleScope location

* chore: bump chromium in DEPS to 139.0.7258.0

* fixup! [NonClientFrameView] Consolidate NativeFrameViewMac

* Revert "chore: bump chromium in DEPS to 139.0.7258.0"

This reverts commit 264b2e934f.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-26 00:12:49 +09:00
Felix Rieseberg
e4c37e4b38 docs: Add C++/Linux tutorial (#46822) 2025-06-25 12:57:43 +02:00
672 changed files with 15367 additions and 12321 deletions

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -58,6 +58,16 @@ body:
label: Last Known Working Electron version
description: What is the last version of Electron this worked in, if applicable?
placeholder: 16.0.0
- type: dropdown
attributes:
label: Does the issue also appear in Chromium / Google Chrome?
description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
options:
- I don't know how to test
- "Yes"
- "No"
validations:
required: true
- type: textarea
attributes:
label: Expected Behavior

View File

@@ -1,3 +1,6 @@
> [!IMPORTANT]
> Please note that code reviews and merges will be delayed during our [quiet period in December](https://www.electronjs.org/blog/dec-quiet-period-25) and might not happen until January.
#### Description of Change
<!--

View File

@@ -70,7 +70,11 @@ runs:
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
if [ "$TARGET_PLATFORM" = "win" ]; then
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
else
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
fi
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
@@ -132,6 +136,14 @@ runs:
run: |
cd src
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
target_os="${target_os}_mas"
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -180,7 +192,6 @@ runs:
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -191,11 +202,6 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash

View File

@@ -143,12 +143,11 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matchers
- name: Remove patch conflict problem matcher
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
@@ -173,7 +172,6 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

View File

@@ -6,6 +6,8 @@ runs:
- name: Free Space on MacOS
shell: bash
run: |
echo "Disk usage before cleanup:"
df -h
sudo mkdir -p $TMPDIR/del-target
tmpify() {
@@ -15,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -58,19 +62,30 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
sudo mdutil -a -i off

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -1,122 +0,0 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

View File

@@ -19,16 +19,6 @@
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

View File

@@ -13,13 +13,13 @@ jobs:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Setting Up Dig Site
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
@@ -45,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -15,12 +15,26 @@ jobs:
permissions:
contents: read
steps:
- run: npm install @actions/cache @electron/fiddle-core
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- name: Setup Node.js
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
with:
node-version: 22.17.x
- name: Sparse checkout repository
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
@@ -29,7 +43,7 @@ jobs:
// Only want the most recent workflow run that wasn't skipped or cancelled
const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
const versions = await ElectronVersions.create(undefined, { ignoreCache: true });
const versions = await ElectronVersions.create({ ignoreCache: true });
const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
for (const branch of ["main", ...branches]) {
@@ -69,6 +83,8 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)
@@ -101,7 +117,6 @@ jobs:
}
if (runsWithErrors.length > 0) {
core.setOutput('errorsFound', true);
core.summary.addHeading('⚠️ Runs with Errors');
core.summary.addTable([
[
@@ -128,6 +143,7 @@ jobs:
// Set this as failed so it's easy to scan runs to find failures
if (runsWithErrors.find((run) => !run.isStale)) {
core.setOutput('errorsFound', true);
process.exitCode = 1;
}
} else {
@@ -137,7 +153,7 @@ jobs:
await core.summary.write();
- name: Send Slack message if errors
if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
with:
payload: |
link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -14,7 +14,7 @@ jobs:
permissions:
contents: read
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -23,7 +23,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -37,7 +37,7 @@ jobs:
permissions:
contents: read
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -47,7 +47,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -63,7 +63,7 @@ jobs:
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -72,7 +72,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
required: true
skip-macos:
type: boolean
@@ -57,7 +57,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -76,7 +76,7 @@ jobs:
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -124,7 +124,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -156,7 +156,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -188,7 +188,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -208,7 +208,7 @@ jobs:
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
@@ -248,8 +248,8 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
test-runs-on: macos-14-large
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
is-release: false
@@ -267,8 +267,8 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
test-runs-on: macos-14
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
is-release: false

View File

@@ -10,15 +10,24 @@ permissions: {}
jobs:
issue-commented:
name: Remove blocked/{need-info,need-repro} on comment
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-latest
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Remove label
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
ISSUE_URL: ${{ github.event.issue.html_url }}

View File

@@ -75,7 +75,7 @@ jobs:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
uses: actions-cool/issues-helper@9861779a695cf1898bd984c727f685f351cfc372 # v3.7.2
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -37,18 +37,29 @@ jobs:
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -79,7 +90,6 @@ jobs:
labelExists = true;
} catch {}
const { ElectronVersions } = await import('${{ github.workspace }}/node_modules/@electron/fiddle-core/dist/index.js');
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
@@ -136,7 +146,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
uses: actions-cool/issues-helper@9861779a695cf1898bd984c727f685f351cfc372 # v3.7.2
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -35,7 +35,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -43,12 +43,9 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -63,12 +60,9 @@ jobs:
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -83,12 +77,9 @@ jobs:
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release

104
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,104 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -36,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -47,16 +47,13 @@ jobs:
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -67,16 +64,13 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -87,16 +81,13 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -107,16 +98,13 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -7,22 +7,28 @@ on:
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}
jobs:
check-for-non-maintainer-dependency-change:
name: Check for disallowed non-maintainer change
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.pull_request.author_association) && github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
permissions:
contents: read
pull-requests: write
runs-on: ubuntu-latest
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Check for existing review
id: check-for-review
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -27,7 +27,7 @@ jobs:
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -43,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -27,7 +27,7 @@ jobs:
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -46,7 +46,7 @@ jobs:
shell: bash
run: |
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
gn_version="$(curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
gn_version="$(curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
cipd ensure -ensure-file - -root . <<-CIPD
\$ServiceURL https://chrome-infra-packages.appspot.com/
@@ -62,7 +62,7 @@ jobs:
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
mkdir -p src/buildtools
curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add ESLint problem matcher
@@ -85,8 +85,4 @@ jobs:
run: |
cd src/electron
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -95,7 +95,7 @@ jobs:
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -119,9 +119,9 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
@@ -147,7 +147,15 @@ jobs:
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
uses: ./src/electron/.github/actions/install-build-tools
# Install wsl on windows runners
- name: Install WSL (Windows only)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
dism.exe /online /enable-feature /featurename:Microsoft-Windows-Subsystem-Linux /all /norestart
dism.exe /online /enable-feature /featurename:VirtualMachinePlatform /all /norestart
wsl --install -d Ubuntu
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
@@ -163,7 +171,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -48,7 +48,7 @@ jobs:
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -115,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0

View File

@@ -1,237 +0,0 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
with:
node-version: 20.19.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -69,14 +69,16 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
configure_user_tccdb () {
local values=$1
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
@@ -95,11 +97,14 @@ jobs:
"'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
)
for values in "${userValuesArray[@]}"; do
# Sonoma and higher have a few extra values
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
if [ "$OSTYPE" = "darwin23" ]; then
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
else
@@ -110,12 +115,21 @@ jobs:
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
- name: Set xcode to 16.4
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
@@ -154,12 +168,12 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
@@ -177,12 +191,13 @@ jobs:
run: |
cd src/out/Default
unzip -:o dist.zip
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
run: |
sudo security authorizationdb write com.apple.trust-settings.admin allow
cd src/electron
./script/codesign/generate-identity.sh
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Run Electron Tests
shell: bash
env:
@@ -251,7 +266,7 @@ jobs:
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -50,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -65,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -106,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -121,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}

View File

@@ -14,7 +14,7 @@ jobs:
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
with:
webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
webhook-type: webhook-trigger

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3 # v6.0.0
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@ce28f5bb42b7a9f2c824e633a3f6ee835bab6858 # v3.29.0
uses: github/codeql-action/upload-sarif@fe4161a26a8629af62121b670040955b330f9af2 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -18,7 +18,7 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: semantic-pull-request
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
with:

View File

@@ -17,7 +17,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -28,7 +28,7 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
@@ -41,7 +41,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -40,7 +40,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@1af3b93b6815bc44a9784bd300feb67ff0d1eeb3
with:
path: src/electron
fetch-depth: 0
@@ -51,12 +51,9 @@ jobs:
target-platform: win
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -70,12 +67,9 @@ jobs:
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -89,12 +83,9 @@ jobs:
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release

2
.nvmrc
View File

@@ -1 +1 @@
20
22

File diff suppressed because one or more lines are too long

View File

@@ -9,4 +9,4 @@ npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
yarnPath: .yarn/releases/yarn-4.12.0.cjs
yarnPath: .yarn/releases/yarn-4.11.0.cjs

View File

@@ -480,6 +480,7 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
@@ -527,6 +528,7 @@ source_set("electron_lib") {
"//base",
"//base:i18n",
"//content/public/app",
"//ui/base/unowned_user_data",
]
include_dirs = [
@@ -586,7 +588,13 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -689,7 +697,6 @@ source_set("electron_lib") {
"//components/app_launch_prefetch",
"//components/crash/core/app:crash_export_thunks",
"//third_party/libxml:xml_writer",
"//ui/native_theme:native_theme_browser",
"//ui/wm",
"//ui/wm/public",
]
@@ -756,11 +763,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]
@@ -781,9 +790,13 @@ source_set("electron_lib") {
action("mksnapshot_checksum_gen") {
script = "build/checksum_header.py"
outputs = [ "$target_gen_dir/snapshot_checksum.h" ]
inputs = [ "$root_out_dir/$v8_context_snapshot_filename" ]
args = rebase_path(inputs) + rebase_path(outputs)
args = rebase_path(inputs)
args += rebase_path(outputs)
deps = [ "//tools/v8_context_snapshot" ]
}

10
DEPS
View File

@@ -2,17 +2,17 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'140.0.7339.249',
'144.0.7547.0',
'node_version':
'v22.22.0',
'v24.11.1',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
'74ab5baccc6f7202c8ac69a8d1e152c29dc1ea76',
'mantle_version':
'78d3966b3c331292ea29ec38661b25df0a245948',
'2a8e2123a3931038179ee06105c9e6ec336b12ea',
'engflow_reclient_configs_version':
'955335c30a752e9ef7bff375baab5e0819b6c00d',
@@ -152,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.11.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -37,7 +37,7 @@ For more installation options and troubleshooting tips, see
Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* macOS (Monterey and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 139
node_module_version = 143
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"
@@ -19,6 +19,10 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false

View File

@@ -12,7 +12,7 @@ TEMPLATE_H = """
namespace electron::snapshot_checksum {
const std::string kChecksum = "{checksum}";
inline constexpr std::string_view kChecksum = "{checksum}";
} // namespace electron::snapshot_checksum

View File

@@ -67,10 +67,6 @@ template("mac_xib_bundle_data") {
ibtool_flags = [
"--minimum-deployment-target",
mac_deployment_target,
# TODO(rsesek): Enable this once all the bots are on Xcode 7+.
# "--target-device",
# "mac",
]
}

View File

@@ -23,6 +23,8 @@ static_library("chrome") {
"//chrome/browser/browser_process.h",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
"//chrome/browser/devtools/devtools_eye_dropper.cc",
@@ -142,8 +144,6 @@ static_library("chrome") {
"//chrome/browser/ui/views/overlay/toggle_camera_button.h",
"//chrome/browser/ui/views/overlay/toggle_microphone_button.cc",
"//chrome/browser/ui/views/overlay/toggle_microphone_button.h",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
"//chrome/browser/ui/views/overlay/video_overlay_window_views.cc",
"//chrome/browser/ui/views/overlay/video_overlay_window_views.h",
"//chrome/browser/ui/views/picture_in_picture/picture_in_picture_bounds_change_animation.cc",
@@ -280,6 +280,8 @@ static_library("chrome") {
"//chrome/browser/process_singleton_mac.mm",
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.h",
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.mm",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
]
deps += [ ":system_media_capture_permissions_mac_conflict" ]
}
@@ -381,6 +383,8 @@ static_library("chrome") {
"//chrome/browser/pdf/chrome_pdf_stream_delegate.h",
"//chrome/browser/pdf/pdf_extension_util.cc",
"//chrome/browser/pdf/pdf_extension_util.h",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.cc",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.h",
"//chrome/browser/pdf/pdf_viewer_stream_manager.cc",
"//chrome/browser/pdf/pdf_viewer_stream_manager.h",
"//chrome/browser/plugins/pdf_iframe_navigation_throttle.cc",
@@ -389,6 +393,8 @@ static_library("chrome") {
deps += [
"//components/pdf/browser",
"//components/pdf/renderer",
"//ui/base/interaction",
"//ui/webui/resources/cr_components/help_bubble:mojo_bindings",
]
}
} else {
@@ -502,15 +508,17 @@ source_set("chrome_spellchecker") {
]
}
# These sources create an object file conflict with one in |:chrome|, so they
# must live in a separate target.
# Conflicting sources:
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
source_set("system_media_capture_permissions_mac_conflict") {
sources = [
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
]
deps = [ "//chrome/common" ]
if (is_mac) {
# These sources create an object file conflict with one in |:chrome|, so they
# must live in a separate target.
# Conflicting sources:
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
source_set("system_media_capture_permissions_mac_conflict") {
sources = [
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
]
deps = [ "//chrome/common" ]
}
}

View File

@@ -421,6 +421,7 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.
@@ -564,8 +565,9 @@ and subscribing to the `ready` event if the app is not ready yet.
* `steal` boolean _macOS_ - Make the receiver the active app even if another app is
currently active.
On Linux, focuses on the first visible window. On macOS, makes the application
the active app. On Windows, focuses on the application's first window.
On macOS, makes the application the active app. On Windows, focuses on the application's
first window. On Linux, either focuses on the first visible window (X11) or requests
focus but may instead show a notification or flash the app icon (Wayland).
You should seek to use the `steal` option as sparingly as possible.
@@ -1216,7 +1218,7 @@ This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently disabled.
Returns `boolean` - whether hardware acceleration is currently enabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.

View File

@@ -140,6 +140,10 @@ state is `hidden` in order to minimize power consumption.
move.
* On Linux the type of modal windows will be changed to `dialog`.
* On Linux many desktop environments do not support hiding a modal window.
* On Wayland (Linux) it is generally not possible to programmatically resize windows
after creation, or to position, move, focus, or blur windows without user input.
If your app needs these capabilities, run it in Xwayland by appending the flag
`--ozone-platform=x11`.
## Class: BrowserWindow extends `BaseWindow`
@@ -656,10 +660,15 @@ the [close event](#event-close).
Focuses on the window.
On Wayland (Linux), the desktop environment may show a notification or flash
the app icon if the window or app is not already focused.
#### `win.blur()`
Removes focus from the window.
Not supported on Wayland (Linux).
#### `win.isFocused()`
Returns `boolean` - Whether the window is focused.
@@ -676,6 +685,8 @@ Shows and gives focus to the window.
Shows the window but doesn't focus on it.
Not supported on Wayland (Linux).
#### `win.hide()`
Hides the window.
@@ -824,6 +835,8 @@ Closes the currently open [Quick Look][quick-look] panel.
Resizes and moves the window to the supplied bounds. Any properties that are not supplied will default to their current values.
On Wayland (Linux), has the same limitations as `setSize` and `setPosition`.
```js
const { BrowserWindow } = require('electron')
@@ -866,6 +879,8 @@ See [Setting `backgroundColor`](#setting-the-backgroundcolor-property).
Resizes and moves the window's client area (e.g. the web page) to
the supplied bounds.
On Wayland (Linux), has the same limitations as `setContentSize` and `setPosition`.
#### `win.getContentBounds()`
Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window's client area as `Object`.
@@ -895,6 +910,8 @@ Returns `boolean` - whether the window is enabled.
Resizes the window to `width` and `height`. If `width` or `height` are below any set minimum size constraints the window will snap to its minimum size.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getSize()`
Returns `Integer[]` - Contains the window's width and height.
@@ -907,6 +924,8 @@ Returns `Integer[]` - Contains the window's width and height.
Resizes the window's client area (e.g. the web page) to `width` and `height`.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getContentSize()`
Returns `Integer[]` - Contains the window's client area's width and height.
@@ -1044,12 +1063,16 @@ this method throws an error.
#### `win.moveTop()`
Moves window to top(z-order) regardless of focus
Moves window to top(z-order) regardless of focus.
Not supported on Wayland (Linux).
#### `win.center()`
Moves window to the center of the screen.
Not supported on Wayland (Linux).
#### `win.setPosition(x, y[, animate])`
* `x` Integer
@@ -1058,6 +1081,8 @@ Moves window to the center of the screen.
Moves window to `x` and `y`.
Not supported on Wayland (Linux).
#### `win.getPosition()`
Returns `Integer[]` - Contains the window's current position.
@@ -1227,7 +1252,8 @@ Captures a snapshot of the page within `rect`. Omitting `rect` will capture the
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see [`did-fail-load`](web-contents.md#event-did-fail-load)).
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Same as [`webContents.loadURL(url[, options])`](web-contents.md#contentsloadurlurl-options).

View File

@@ -2,10 +2,13 @@
> Perform copy and paste operations on the system clipboard.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) _Deprecated_ (non-sandboxed only)
> [!NOTE]
> Using the `clipoard` API from the renderer process is deprecated.
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> If you want to call this API from a renderer process,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.

View File

@@ -49,6 +49,10 @@ Disables the disk cache for HTTP requests.
Disable HTTP/2 and SPDY/3.1 protocols.
### --disable-geolocation _macOS_
Disables the Geolocation API. Permission requests for geolocation will be denied internally regardless of the decision made by a handler set via `session.setPermissionRequestHandler`. This functionality is currently implemented only for macOS. Has no effect on other platforms.
### --disable-renderer-backgrounding
Prevents Chromium from lowering the priority of invisible pages' renderer
@@ -86,7 +90,7 @@ Field trials to be forcefully enabled or disabled.
For example: `WebRTC-Audio-Red-For-Opus/Enabled/`
### --host-rules=`rules`
### --host-rules=`rules` _Deprecated_
A comma-separated list of `rules` that control how hostnames are mapped.
@@ -104,9 +108,23 @@ These mappings apply to the endpoint host in a net request (the TCP connect
and host resolver in a direct connection, and the `CONNECT` in an HTTP proxy
connection, and the endpoint host in a `SOCKS` proxy connection).
**Deprecated:** Use the `--host-resolver-rules` switch instead.
### --host-resolver-rules=`rules`
Like `--host-rules` but these `rules` only apply to the host resolver.
A comma-separated list of `rules` that control how hostnames are mapped.
For example:
* `MAP * 127.0.0.1` Forces all hostnames to be mapped to 127.0.0.1
* `MAP *.google.com proxy` Forces all google.com subdomains to be resolved to
"proxy".
* `MAP test.com [::1]:77` Forces "test.com" to resolve to IPv6 loopback. Will
also force the port of the resulting socket address to be 77.
* `MAP * baz, EXCLUDE www.google.com` Remaps everything to "baz", except for
"www.google.com".
These `rules` only apply to the host resolver.
### --ignore-certificate-errors
@@ -179,6 +197,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated
@@ -331,6 +354,22 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
Disable exposition of [Navigator API][] on the global scope from Node.js.
## Chromium Flags
There isn't a documented list of all Chromium switches, but there are a few ways to find them.
The easiest way is through Chromium's flags page, which you can access at `about://flags`. These flags don't directly match switch names, but they show up in the process's command-line arguments.
To see these arguments, enable a flag in `about://flags`, then go to `about://version` in Chromium. You'll find a list of command-line arguments, including `--flag-switches-begin --your --list --flag-switches-end`, which contains the list of your flag enabled switches.
Most flags are included as part of `--enable-features=`, but some are standalone switches, like `--enable-experimental-web-platform-features`.
A complete list of flags exists in [Chromium's flag metadata page](https://source.chromium.org/chromium/chromium/src/+/main:chrome/browser/flag-metadata.json), but this list includes platform, environment and GPU specific, expired and potentially non-functional flags, so many of them might not always work in every situation.
Keep in mind that standalone switches can sometimes be split into individual features, so there's no fully complete list of switches.
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
[app]: app.md
[append-switch]: command-line.md#commandlineappendswitchswitch-value
[debugging-main-process]: ../tutorial/debugging-main-process.md

View File

@@ -157,6 +157,7 @@ has been included below for completeness:
| [Cloneable Types](https://developer.mozilla.org/en-US/docs/Web/API/Web_Workers_API/Structured_clone_algorithm) | Simple | ✅ | ✅ | See the linked document on cloneable types |
| `Element` | Complex | ✅ | ✅ | Prototype modifications are dropped. Sending custom elements will not work. |
| `Blob` | Complex | ✅ | ✅ | N/A |
| `VideoFrame` | Complex | ✅ | ✅ | N/A |
| `Symbol` | N/A | ❌ | ❌ | Symbols cannot be copied across contexts so they are dropped |
If the type you care about is not in the above table, it is probably not supported.

View File

@@ -102,6 +102,10 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
## Caveats
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -34,7 +34,8 @@ See [`Menu`](menu.md) for examples.
* `sublabel` string (optional) _macOS_ - Available in macOS >= 14.4
* `toolTip` string (optional) _macOS_ - Hover text for this menu item.
* `accelerator` string (optional) - An [Accelerator](../tutorial/keyboard-shortcuts.md#accelerators) string.
* `icon` ([NativeImage](native-image.md) | string) (optional)
* `icon` ([NativeImage](native-image.md) | string) (optional) - Can be a
[NativeImage](native-image.md) or the file path of an icon.
* `enabled` boolean (optional) - If false, the menu item will be greyed out and
unclickable.
* `acceleratorWorksWhenHidden` boolean (optional) _macOS_ - default is `true`, and when `false` will prevent the accelerator from triggering the item if the item is not visible.

View File

@@ -2,10 +2,15 @@
## Class: Menu
> Create native application menus and context menus.
> Create application menus and context menus.
Process: [Main](../glossary.md#main-process)
The presentation of menus varies depending on the operating system:
- Under Windows and Linux, menus are visually similar to Chromium.
- Under macOS, these will be native menus.
> [!TIP]
> See also: [A detailed guide about how to implement menus in your application](../tutorial/menus.md).

View File

@@ -202,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
Returns `NativeImage`
Creates a new `NativeImage` instance from the `NSImage` that maps to the
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
documentation for a list of possible values.
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
The `hslShift` is applied to the image with the following rules:
@@ -231,6 +230,15 @@ echo -e '#import <Cocoa/Cocoa.h>\nint main() { NSLog(@"%@", SYSTEM_IMAGE_NAME);
where `SYSTEM_IMAGE_NAME` should be replaced with any value from [this list](https://developer.apple.com/documentation/appkit/nsimagename?language=objc).
For SF Symbols, usage looks as follows:
```js
const image = nativeImage.createFromNamedImage('square.and.pencil')
```
where `'square.and.pencil'` is the symbol name from the
[SF Symbols app](https://developer.apple.com/sf-symbols/).
## Class: NativeImage
> Natively wrap images such as tray, dock, and application icons.

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session

View File

@@ -0,0 +1,58 @@
# sharedTexture
> Import shared textures into Electron and converts platform specific handles into [`VideoFrame`](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame). Supports all Web rendering systems, and can be transferred across Electron processes. Read [here](https://github.com/electron/electron/blob/main/shell/common/api/shared_texture/README.md) for more information.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
## Methods
The `sharedTexture` module has the following methods:
**Note:** Experimental APIs are marked as such and could be removed in the future.
### `sharedTexture.importSharedTexture(options)` _Experimental_
* `options` Object - Options for importing shared textures.
* `textureInfo` [SharedTextureImportTextureInfo](structures/shared-texture-import-texture-info.md) - The information of the shared texture to import.
* `allReferencesReleased` Function (optional) - Called when all references in all processes are released. You should keep the imported texture valid until this callback is called.
Imports the shared texture from the given options.
> [!NOTE]
> This method is only available in the main process.
Returns `SharedTextureImported` - The imported shared texture.
### `sharedTexture.sendSharedTexture(options, ...args)` _Experimental_
* `options` Object - Options for sending shared texture.
* `frame` [WebFrameMain](web-frame-main.md) - The target frame to transfer the shared texture to. For `WebContents`, you can pass `webContents.mainFrame`. If you provide a `webFrameMain` that is not a main frame, you'll need to enable `webPreferences.nodeIntegrationInSubFrames` for this, since this feature requires [IPC](https://www.electronjs.org/docs/latest/api/web-frame-main#frameipc-readonly) between main and the frame.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments to pass to the renderer process.
Send the imported shared texture to a renderer process. You must register a receiver at renderer process before calling this method. This method has a 1000ms timeout. Ensure the receiver is set and the renderer process is alive before calling this method.
> [!NOTE]
> This method is only available in the main process.
Returns `Promise<void>` - Resolves when the transfer is complete.
### `sharedTexture.setSharedTextureReceiver(callback)` _Experimental_
* `callback` Function\<Promise\<void\>\> - The function to receive the imported shared texture.
* `receivedSharedTextureData` Object - The data received from the main process.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments passed from the main process.
Set a callback to receive imported shared textures from the main process.
> [!NOTE]
> This method is only available in the renderer process.
## Properties
The `sharedTexture` module has the following properties:
### `sharedTexture.subtle` _Experimental_
A [`SharedTextureSubtle`](structures/shared-texture-subtle.md) property, provides subtle APIs for interacting with shared texture for advanced users.

View File

@@ -72,6 +72,9 @@
some GTK+3 desktop environments. Default is `false`.
* `transparent` boolean (optional) - Makes the window [transparent](../../tutorial/custom-window-styles.md#transparent-windows).
Default is `false`. On Windows, does not work unless the window is frameless.
When you add a [`View`](../view.md) to a `BaseWindow`, you'll need to call
[`view.setBackgroundColor`](../view.md#viewsetbackgroundcolorcolor) with a transparent
background color on that view to make its background transparent as well.
* `type` string (optional) - The type of window, default is normal window. See more about
this below.
* `visualEffectState` string (optional) _macOS_ - Specify how the material

View File

@@ -0,0 +1,195 @@
# ColorSpace Object
* `primaries` string - The color primaries of the color space. Can be one of the following values:
* `bt709` - BT709 primaries (also used for sRGB)
* `bt470m` - BT470M primaries
* `bt470bg` - BT470BG primaries
* `smpte170m` - SMPTE170M primaries
* `smpte240m` - SMPTE240M primaries
* `film` - Film primaries
* `bt2020` - BT2020 primaries
* `smptest428-1` - SMPTEST428-1 primaries
* `smptest431-2` - SMPTEST431-2 primaries
* `p3` - P3 primaries
* `xyz-d50` - XYZ D50 primaries
* `adobe-rgb` - Adobe RGB primaries
* `apple-generic-rgb` - Apple Generic RGB primaries
* `wide-gamut-color-spin` - Wide Gamut Color Spin primaries
* `ebu-3213-e` - EBU 3213-E primaries
* `custom` - Custom primaries
* `invalid` - Invalid primaries
* `transfer` string - The transfer function of the color space. Can be one of the following values:
* `bt709` - BT709 transfer function
* `bt709-apple` - BT709 Apple transfer function
* `gamma18` - Gamma 1.8 transfer function
* `gamma22` - Gamma 2.2 transfer function
* `gamma24` - Gamma 2.4 transfer function
* `gamma28` - Gamma 2.8 transfer function
* `smpte170m` - SMPTE170M transfer function
* `smpte240m` - SMPTE240M transfer function
* `linear` - Linear transfer function
* `log` - Log transfer function
* `log-sqrt` - Log Square Root transfer function
* `iec61966-2-4` - IEC61966-2-4 transfer function
* `bt1361-ecg` - BT1361 ECG transfer function
* `srgb` - sRGB transfer function
* `bt2020-10` - BT2020-10 transfer function
* `bt2020-12` - BT2020-12 transfer function
* `pq` - PQ (Perceptual Quantizer) transfer function
* `smptest428-1` - SMPTEST428-1 transfer function
* `hlg` - HLG (Hybrid Log-Gamma) transfer function
* `srgb-hdr` - sRGB HDR transfer function
* `linear-hdr` - Linear HDR transfer function
* `custom` - Custom transfer function
* `custom-hdr` - Custom HDR transfer function
* `scrgb-linear-80-nits` - scRGB Linear 80 nits transfer function
* `invalid` - Invalid transfer function
* `matrix` string - The color matrix of the color space. Can be one of the following values:
* `rgb` - RGB matrix
* `bt709` - BT709 matrix
* `fcc` - FCC matrix
* `bt470bg` - BT470BG matrix
* `smpte170m` - SMPTE170M matrix
* `smpte240m` - SMPTE240M matrix
* `ycocg` - YCoCg matrix
* `bt2020-ncl` - BT2020 NCL matrix
* `ydzdx` - YDzDx matrix
* `gbr` - GBR matrix
* `invalid` - Invalid matrix
* `range` string - The color range of the color space. Can be one of the following values:
* `limited` - Limited color range (RGB values ranging from 16 to 235)
* `full` - Full color range (RGB values from 0 to 255)
* `derived` - Range defined by the transfer function and matrix
* `invalid` - Invalid range
## Common `ColorSpace` definitions
### Standard Color Spaces
**sRGB**:
```js
const cs = {
primaries: 'bt709',
transfer: 'srgb',
matrix: 'rgb',
range: 'full'
}
```
**Display P3**:
```js
const cs = {
primaries: 'p3',
transfer: 'srgb',
matrix: 'rgb',
range: 'full'
}
```
**XYZ D50**:
```js
const cs = {
primaries: 'xyz-d50',
transfer: 'linear',
matrix: 'rgb',
range: 'full'
}
```
### HDR Color Spaces
**Extended sRGB** (extends sRGB to all real values):
```js
const cs = {
primaries: 'bt709',
transfer: 'srgb-hdr',
matrix: 'rgb',
range: 'full'
}
```
**scRGB Linear** (linear transfer function for all real values):
```js
const cs = {
primaries: 'bt709',
transfer: 'linear-hdr',
matrix: 'rgb',
range: 'full'
}
```
**scRGB Linear 80 Nits** (with an SDR white level of 80 nits):
```js
const cs = {
primaries: 'bt709',
transfer: 'scrgb-linear-80-nits',
matrix: 'rgb',
range: 'full'
}
```
**HDR10** (BT.2020 primaries with PQ transfer function):
```js
const cs = {
primaries: 'bt2020',
transfer: 'pq',
matrix: 'rgb',
range: 'full'
}
```
**HLG** (BT.2020 primaries with HLG transfer function):
```js
const cs = {
primaries: 'bt2020',
transfer: 'hlg',
matrix: 'rgb',
range: 'full'
}
```
### Video Color Spaces
**Rec. 601** (SDTV):
```js
const cs = {
primaries: 'smpte170m',
transfer: 'smpte170m',
matrix: 'smpte170m',
range: 'limited'
}
```
**Rec. 709** (HDTV):
```js
const cs = {
primaries: 'bt709',
transfer: 'bt709',
matrix: 'bt709',
range: 'limited'
}
```
**JPEG** (typical color space for JPEG images):
```js
const cs = {
primaries: 'bt709',
transfer: 'srgb',
matrix: 'smpte170m',
range: 'full'
}
```

View File

@@ -2,9 +2,13 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In OSR case, it is expected to have the full section area.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.
* `contentRect` [Rectangle](rectangle.md) - The region of the video frame that capturer would like to populate. In OSR case, it is the same with `dirtyRect` that needs to be painted.
* `timestamp` number - The time in microseconds since the capture start.
* `metadata` Object - Extra metadata. See comments in src\media\base\video_frame_metadata.h for accurate details.
@@ -12,13 +16,6 @@
* `regionCaptureRect` [Rectangle](rectangle.md) (optional) - May reflect the frame's contents origin if region capture is used internally.
* `sourceSize` [Rectangle](rectangle.md) (optional) - Full size of the source frame.
* `frameCount` number (optional) - The increasing count of captured frame. May contain gaps if frames are dropped between two consecutively received frames.
* `sharedTextureHandle` Buffer _Windows_ _macOS_ - The handle to the shared texture.
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle data.
* `release` Function - Release the resources. The `texture` cannot be directly passed to another process, users need to maintain texture lifecycles in
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important
that you call `texture.release()` as soon as you're done with the texture.
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important that you call `texture.release()` as soon as you're done with the texture.

View File

@@ -8,6 +8,7 @@
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` Integer - The exit code of the process, unless `reason` is
`launch-failed`, in which case `exitCode` will be a platform-specific
launch failure error code.

View File

@@ -0,0 +1,12 @@
# SharedTextureHandle Object
* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process.
* `ioSurface` Buffer (optional) _macOS_ - IOSurfaceRef holds the shared texture. Note that this IOSurface is local to current process (not global).
* `nativePixmap` Object (optional) _Linux_ - Structure contains planes of shared texture.
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
* `supportsZeroCopyWebGpuImport` boolean _Linux_ - Indicates whether supports zero copy import to WebGPU.

View File

@@ -0,0 +1,12 @@
# SharedTextureImportTextureInfo Object
* `pixelFormat` string - The pixel format of the texture.
* `bgra` - 32bpp BGRA (byte-order), 1 plane.
* `rgba` - 32bpp RGBA (byte-order), 1 plane.
* `rgbaf16` - Half float RGBA, 1 plane.
* `nv12` - 12bpp with Y plane followed by a 2x2 interleaved UV plane.
* `colorSpace` [ColorSpace](color-space.md) (optional) - The color space of the texture.
* `codedSize` [Size](size.md) - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) (optional) - A subsection of [0, 0, codedSize.width, codedSize.height]. In common cases, it is the full section area.
* `timestamp` number (optional) - A timestamp in microseconds that will be reflected to `VideoFrame`.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle.

View File

@@ -0,0 +1,9 @@
# SharedTextureImportedSubtle Object
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release the resources. If you transferred and get multiple `SharedTextureImported` objects, you have to `release` every one of them. The resource on the GPU process will be destroyed when the last one is released.
* `callback` Function (optional) - Callback when the GPU command buffer finishes using this shared texture. It provides a precise event to safely release dependent resources. For example, if this object is created by `finishTransferSharedTexture`, you can use this callback to safely release the original one that called `startTransferSharedTexture` in other processes. You can also release the source shared texture that was used to `importSharedTexture` safely.
* `startTransferSharedTexture` Function\<[SharedTextureTransfer](shared-texture-transfer.md)\> - Create a `SharedTextureTransfer` that can be serialized and transferred to other processes.
* `getFrameCreationSyncToken` Function\<[SharedTextureSyncToken](shared-texture-sync-token.md)\> - This method is for advanced users. If used, it is typically called after `finishTransferSharedTexture`, and should be passed to the object which was called `startTransferSharedTexture` to prevent the source object release the underlying resource before the target object actually acquire the reference at gpu process asyncly.
* `setReleaseSyncToken` Function - This method is for advanced users. If used, this object's underlying resource will not be released until the set sync token is fulfilled at gpu process. By using sync tokens, users are not required to use release callbacks for lifetime management.
* `syncToken` [SharedTextureSyncToken](shared-texture-sync-token.md) - The sync token to set.

View File

@@ -0,0 +1,6 @@
# SharedTextureImported Object
* `textureId` string - The unique identifier of the imported shared texture.
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release this object's reference of the imported shared texture. The underlying resource will be alive until every reference is released.
* `subtle` [SharedTextureImportedSubtle](shared-texture-imported-subtle.md) - Provides subtle APIs to interact with the imported shared texture for advanced users.

View File

@@ -0,0 +1,6 @@
# SharedTextureSubtle Object
* `importSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Imports the shared texture from the given options. Returns the imported shared texture.
* `textureInfo` [SharedTextureImportTextureInfo](shared-texture-import-texture-info.md) - The information of shared texture to import.
* `finishTransferSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Finishes the transfer of the shared texture and gets the transferred shared texture. Returns the imported shared texture from the transfer object.
* `transfer` [SharedTextureTransfer](shared-texture-transfer.md) - The transfer object of the shared texture.

View File

@@ -0,0 +1,3 @@
# SharedTextureSyncToken Object
* `syncToken` string - The opaque data for sync token.

View File

@@ -0,0 +1,10 @@
# SharedTextureTransfer Object
* `transfer` string _Readonly_ - The opaque transfer data of the shared texture. This can be transferred across Electron processes.
* `syncToken` string _Readonly_ - The opaque sync token data for frame creation.
* `pixelFormat` string _Readonly_ - The pixel format of the transferring texture.
* `codedSize` [Size](size.md) _Readonly_ - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) _Readonly_ - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In common cases, it is the full section area.
* `timestamp` number _Readonly_ - A timestamp in microseconds that will be reflected to `VideoFrame`.
Use `sharedTexture.subtle.finishTransferSharedTexture` to get [`SharedTextureImportedSubtle`](shared-texture-imported-subtle.md) back.

View File

@@ -1,17 +1,35 @@
# USBDevice Object
* `configuration` Object (optional) - A [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) object containing information about the currently selected configuration of a USB device.
* `configurationValue` Integer - the configuration value of this configuration.
* `configurationName` string - the name provided by the device to describe this configuration.
* `interfaces` Object[] - An array of [USBInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBInterface) objects containing information about an interface provided by the USB device.
* `interfaceNumber` Integer - the interface number of this interface.
* `alternate` Object - the currently selected alternative configuration of this interface.
* `alternateSetting` Integer - the alternate setting number of this interface.
* `interfaceClass` Integer - the class of this interface. See [USB.org](https://www.usb.org/defined-class-codes) for class code descriptions.
* `interfaceSubclass` Integer - the subclass of this interface.
* `interfaceProtocol` Integer - the protocol supported by this interface.
* `interfaceName` string (optional) - the name of the interface, if one is provided by the device.
* `endpoints` Object[] - an array containing instances of the [USBEndpoint interface](https://developer.mozilla.org/en-US/docs/Web/API/USBEndpoint) describing each of the endpoints that are part of this interface.
* `endpointNumber` Integer - this endpoint's "endpoint number" which is a value from 1 to 15.
* `direction` string - the direction in which this endpoint transfers data - can be either 'in' or 'out'.
* `type` string - the type of this endpoint - can be either 'bulk', 'interrupt', or 'isochronous'.
* `packetSize` Integer - the size of the packets that data sent through this endpoint will be divided into.
* `alternates` Object[] - an array containing instances of the [USBAlternateInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBAlternateInterface) interface describing each of the alternative configurations possible for this interface.
* `configurations` Object[] - An array of [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) interfaces for controlling a paired USB device.
* `deviceClass` Integer - The device class for the communication interface supported by the device.
* `deviceId` string - Unique identifier for the device.
* `vendorId` Integer - The USB vendor ID.
* `productId` Integer - The USB product ID.
* `productName` string (optional) - Name of the device.
* `serialNumber` string (optional) - The USB device serial number.
* `manufacturerName` string (optional) - The manufacturer name of the device.
* `usbVersionMajor` Integer - The USB protocol major version supported by the device
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device
* `deviceClass` Integer - The device class for the communication interface supported by the device
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device.
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device.
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
* `manufacturerName` string (optional) - The manufacturer name of the device.
* `productId` Integer - The USB product ID.
* `productName` string (optional) - Name of the device.
* `serialNumber` string (optional) - The USB device serial number.
* `usbVersionMajor` Integer - The USB protocol major version supported by the device.
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device.
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device.
* `vendorId` Integer - The USB vendor ID.

View File

@@ -89,6 +89,11 @@
paint event. Defaults to `false`. See the
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
more details.
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
the specified `preload` script in a separate JavaScript context. Defaults
to `true`. The context that the `preload` script runs in will only have

View File

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
The `systemPreferences` object emits the following events:
### Event: 'accent-color-changed' _Windows_
### Event: 'accent-color-changed' _Windows_ _Linux_
Returns:
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
or global value of a `key` previously set with `setUserDefault`.
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
### `systemPreferences.getAccentColor()`
Returns `string` - The users current system wide accent color preference in RGBA
hexadecimal form.

View File

@@ -1079,7 +1079,7 @@ Emitted when the [mainFrame](web-contents.md#contentsmainframe-readonly), an `<i
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors.
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Loads the `url` in the window. The `url` must contain the protocol prefix,
e.g. the `http://` or `file://`. If the load should bypass http cache then

View File

@@ -12,6 +12,50 @@ This document uses the following convention to categorize breaking changes:
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
## Planned Breaking API Changes (40.0)
### Deprecated: `clipboard` API access from renderer processes
Using the `clipboard` API directly in the renderer process is deprecated.
If you want to call this API from a renderer process, place the API call in
your preload script and expose it using the [contextBridge](https://www.electronjs.org/docs/latest/api/context-bridge) API.
### Behavior Changed: MacOS dSYM files now compressed with tar.xz
Debug symbols for MacOS (dSYM) now use xz compression in order to handle larger file sizes. `dsym.zip` files are now
`dsym.tar.xz` files. End users using debug symbols may need to update their zip utilities.
## Planned Breaking API Changes (39.0)
### Deprecated: `--host-rules` command line switch
Chromium is deprecating the `--host-rules` switch.
You should use `--host-resolver-rules` instead.
### Behavior Changed: window.open popups are always resizable
Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
To restore previous behavior:
```js
webContents.setWindowOpenHandler((details) => {
return {
action: 'allow',
overrideBrowserWindowOptions: {
resizable: details.features.includes('resizable=yes')
}
}
})
```
### Behavior Changed: shared texture OSR `paint` event data structure
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
## Planned Breaking API Changes (38.0)
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable

View File

@@ -12,6 +12,15 @@ The ASAR format was created primarily to improve performance on Windows when
reading large quantities of small files (e.g. when loading your app's JavaScript
dependency tree from `node_modules`).
### ASAR integrity
ASAR integrity is an security feature that validates the contents of your app's
ASAR archives at runtime. When enabled, your Electron app will verify the
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
hashes, the app will forcefully terminate.
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
### code signing
Code signing is a process where an app developer digitally signs their code to

View File

@@ -5,7 +5,7 @@ slug: asar-integrity
hide_title: false
---
ASAR integrity is an experimental feature that validates the contents of your app's
ASAR integrity is a security feature that validates the contents of your app's
[ASAR archives](./asar-archives.md) at runtime.
## Version support
@@ -77,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
### Using Electron tooling
Electron Forge and Electron Packager do this setup automatically for you with no additional
configuration. The minimum required versions for ASAR integrity are:
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
* `@electron/packager@18.3.1`
* `@electron/forge@7.4.0`

View File

@@ -74,46 +74,22 @@ describe('keyboard input', () => {
Furthermore, WebdriverIO allows you to access Electron APIs to get static information about your application:
```js @ts-nocheck
import { browser, $, expect } from '@wdio/globals'
import { browser } from '@wdio/globals'
describe('when the make smaller button is clicked', () => {
it('should decrease the window height and width by 10 pixels', async () => {
const boundsBefore = await browser.electron.browserWindow('getBounds')
expect(boundsBefore.width).toEqual(210)
expect(boundsBefore.height).toEqual(310)
await $('.make-smaller').click()
const boundsAfter = await browser.electron.browserWindow('getBounds')
expect(boundsAfter.width).toEqual(200)
expect(boundsAfter.height).toEqual(300)
})
})
```
or to retrieve other Electron process information:
```js @ts-nocheck
import fs from 'node:fs'
import path from 'node:path'
import { browser, expect } from '@wdio/globals'
const packageJson = JSON.parse(fs.readFileSync(path.join(__dirname, '..', 'package.json'), { encoding: 'utf-8' }))
const { name, version } = packageJson
describe('electron APIs', () => {
it('should retrieve app metadata through the electron API', async () => {
const appName = await browser.electron.app('getName')
expect(appName).toEqual(name)
const appVersion = await browser.electron.app('getVersion')
expect(appVersion).toEqual(version)
})
it('should pass args through to the launched application', async () => {
// custom args are set in the wdio.conf.js file as they need to be set before WDIO starts
const argv = await browser.electron.mainProcess('argv')
expect(argv).toContain('--foo')
expect(argv).toContain('--bar=baz')
describe('trigger message modal', async () => {
it('message modal can be triggered from a test', async () => {
await browser.electron.execute(
(electron, param1, param2, param3) => {
const appWindow = electron.BrowserWindow.getFocusedWindow()
electron.dialog.showMessageBox(appWindow, {
message: 'Hello World!',
detail: `${param1} + ${param2} + ${param3} = ${param1 + param2 + param3}`
})
},
1,
2,
3
)
})
})
```
@@ -206,7 +182,7 @@ npm install --save-dev @playwright/test
```
:::caution Dependencies
This tutorial was written with `@playwright/test@1.41.1`. Check out
This tutorial was written with `@playwright/test@1.52.0`. Check out
[Playwright's releases][playwright-releases] page to learn about
changes that might affect the code below.
:::
@@ -218,10 +194,10 @@ To point this API to your Electron app, you can pass the path to your main proce
entry point (here, it is `main.js`).
```js {5} @ts-nocheck
const { test, _electron: electron } = require('@playwright/test')
import { test, _electron as electron } from '@playwright/test'
test('launch app', async () => {
const electronApp = await electron.launch({ args: ['main.js'] })
const electronApp = await electron.launch({ args: ['.'] })
// close app
await electronApp.close()
})
@@ -231,10 +207,10 @@ After that, you will access to an instance of Playwright's `ElectronApp` class.
is a powerful class that has access to main process modules for example:
```js {5-10} @ts-nocheck
const { test, _electron: electron } = require('@playwright/test')
import { test, _electron as electron } from '@playwright/test'
test('get isPackaged', async () => {
const electronApp = await electron.launch({ args: ['main.js'] })
const electronApp = await electron.launch({ args: ['.'] })
const isPackaged = await electronApp.evaluate(async ({ app }) => {
// This runs in Electron's main process, parameter here is always
// the result of the require('electron') in the main app script.
@@ -250,10 +226,10 @@ It can also create individual [Page][playwright-page] objects from Electron Brow
For example, to grab the first BrowserWindow and save a screenshot:
```js {6-7} @ts-nocheck
const { test, _electron: electron } = require('@playwright/test')
import { test, _electron as electron } from '@playwright/test'
test('save screenshot', async () => {
const electronApp = await electron.launch({ args: ['main.js'] })
const electronApp = await electron.launch({ args: ['.'] })
const window = await electronApp.firstWindow()
await window.screenshot({ path: 'intro.png' })
// close app
@@ -265,7 +241,7 @@ Putting all this together using the Playwright test-runner, let's create a `exam
test file with a single test and assertion:
```js title='example.spec.js' @ts-nocheck
const { test, expect, _electron: electron } = require('@playwright/test')
import { test, expect, _electron as electron } from '@playwright/test'
test('example test', async () => {
const electronApp = await electron.launch({ args: ['.'] })

View File

@@ -94,7 +94,7 @@ If the extension works on Chrome but not on Electron, file a bug in Electron's
[issue tracker][issue-tracker] and describe which part
of the extension is not working as expected.
[devtools-extension]: https://developer.chrome.com/extensions/devtools
[devtools-extension]: https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools
[session]: ../api/session.md
[react-devtools]: https://chrome.google.com/webstore/detail/react-developer-tools/fmkadmapgofadopljbjfkapdkoienihi
[load-extension]: ../api/extensions-api.md#extensionsloadextensionpath-options

View File

@@ -9,10 +9,11 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
| Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
| ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | TBD | ✅ |
| 40.0.0 | 2025-Oct-30 | 2025-Dec-03 | 2026-Jan-13 | 2026-Jun-30 | M144 | TBD | ✅ |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
| 37.0.0 | 2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
| 34.0.0 | 2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
| 33.0.0 | 2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
@@ -121,22 +122,3 @@ and that number is reduced to two in major version 10, the three-argument versio
continue to work until, at minimum, major version 12. Past the minimum two-version
threshold, we will attempt to support backwards compatibility beyond two versions
until the maintainers feel the maintenance burden is too high to continue doing so.
### End-of-life
When a release branch reaches the end of its support cycle, the series
will be deprecated in NPM and a final end-of-support release will be
made. This release will add a warning to inform that an unsupported
version of Electron is in use.
These steps are to help app developers learn when a branch they're
using becomes unsupported, but without being excessively intrusive
to end users.
If an application has exceptional circumstances and needs to stay
on an unsupported series of Electron, developers can silence the
end-of-support warning by omitting the final release from the app's
`package.json` `devDependencies`. For example, since the 1-6-x series
ended with an end-of-support 1.6.18 release, developers could choose
to stay in the 1-6-x series without warnings with `devDependency` of
`"electron": 1.6.0 - 1.6.17`.

View File

@@ -4,11 +4,24 @@
## What are fuses?
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
From a security perspective, it makes sense to disable certain unused Electron features
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
subset of "living off the land" attacks.
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
We also don't want Electron consumers forking to achieve this goal, as building from source and
maintaining a fork is a massive technical challenge and costs a lot of time and money.
## Current Fuses
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
Because they are flipped at package time before you code sign your app, the OS becomes responsible
for ensuring those bits aren't flipped back via OS-level code signing validation
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
on Windows).
## Current fuses
### `runAsNode`
@@ -16,7 +29,11 @@ Fuses are the solution to this problem, at a high level they are "magic bits" in
**@electron/fuses:** `FuseV1Options.RunAsNode`
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
as expected, as it depends on this environment variable to function. Instead, we recommend that you
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
standalone Node.js process (e.g. a SQLite server process).
### `cookieEncryption`
@@ -24,7 +41,12 @@ The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variab
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
### `nodeOptions`
@@ -32,7 +54,11 @@ The cookieEncryption fuse toggles whether the cookie store on disk is encrypted
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
Most apps can safely disable this fuse.
### `nodeCliInspect`
@@ -40,7 +66,9 @@ The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
inspector. Most apps can safely disable this fuse.
### `embeddedAsarIntegrityValidation`
@@ -48,9 +76,12 @@ The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. f
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
Most apps can safely enable this fuse.
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
### `onlyLoadAppFromAsar`
@@ -58,7 +89,15 @@ For more information on how to use asar integrity validation please read the [As
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
By default, Electron will search for this code in the following order:
1. `app.asar`
1. `app`
1. `default_app.asar`
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
it is impossible to load non-validated code.
### `loadBrowserProcessSpecificV8Snapshot`
@@ -66,11 +105,17 @@ The onlyLoadAppFromAsar fuse changes the search system that Electron uses to loc
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
initialized heaps and then load them back in to avoid the cost of initializing the heap.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
Other processes will use the V8 snapshot file that they normally do.
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
Using separate snapshots for renderer processes and the main process can improve security, especially
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
### `grantFileProtocolExtraPrivileges`
@@ -78,19 +123,25 @@ Using separate snapshots for renderer processes and the main process can improve
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
are given privileges beyond what they would receive in a traditional web browser. This behavior was
core to Electron apps in original versions of Electron, but is no longer required as apps should be
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
If you aren't serving pages from `file://`, you should disable this fuse.
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
* `file://` protocol pages can use `fetch` to load other assets over `file://`
* `file://` protocol pages can use service workers
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
* `file://` protocol pages have universal access granted to child frames also running on `file://`
protocols regardless of sandbox settings
## How do I flip the fuses?
## How do I flip fuses?
### The easy way
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
```js @ts-nocheck
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -106,29 +157,37 @@ flipFuses(
)
```
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
app using the `@electron/fuses` CLI.
```bash
npx @electron/fuses read --app /Applications/Foo.app
```
>[!NOTE]
> If you are using Electron Forge to distribute your application, you can flip fuses using
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
> which comes pre-installed with all templates.
### The hard way
#### Quick Glossary
> [!IMPORTANT]
> Glossary:
>
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
> * **Fuse Schema**: The format/allowed values for the fuse wire
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
* **Fuse Schema**: The format / allowed values for the fuse wire
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
sequence of bytes that represent the state of the fuses you want.
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
```text
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
```
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -136,6 +195,6 @@ Somewhere in the Electron binary there will be a sequence of bytes that look lik
* "1" (0x31) indicates the fuse is enabled
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

View File

@@ -110,4 +110,10 @@ the item is a Markdown file located in the root of the project:
![Drag and drop](../images/drag-and-drop.gif)
## Dragging files into your app
You can use the standard
[Drag and Drop web API](https://developer.mozilla.org/en-US/docs/Web/API/HTML_Drag_and_Drop_API)
for dragging and dropping files into your app.
[`contextBridge`]: ../api/context-bridge.md

View File

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
You should at least follow these steps to improve the security of your application:
1. [Only load secure content](#1-only-load-secure-content)
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
4. [Enable process sandboxing](#4-enable-process-sandboxing)
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -118,13 +118,6 @@ You should at least follow these steps to improve the security of your applicati
19. [Check which fuses you can change](#19-check-which-fuses-you-can-change)
20. [Do not expose Electron APIs to untrusted web content](#20-do-not-expose-electron-apis-to-untrusted-web-content)
To automate the detection of misconfigurations and insecure patterns, it is
possible to use
[Electronegativity](https://github.com/doyensec/electronegativity). For
additional details on potential weaknesses and implementation bugs when
developing applications using Electron, please refer to this
[guide for developers and auditors](https://doyensec.com/resources/us-17-Carettoni-Electronegativity-A-Study-Of-Electron-Security-wp.pdf).
### 1. Only load secure content
Any resources not included with your application should be loaded using a
@@ -299,7 +292,7 @@ const { session } = require('electron')
const { URL } = require('node:url')
session
.fromPartition('some-partition')
.defaultSession
.setPermissionRequestHandler((webContents, permission, callback) => {
const parsedUrl = new URL(webContents.getURL())
@@ -316,6 +309,8 @@ session
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
### 6. Do not disable `webSecurity`
:::info
@@ -406,6 +401,8 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
#### CSP meta tag
CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
@@ -818,10 +815,10 @@ that your application might have the rights for.
#### How?
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
flipping these fuses easy. Check out the README of that module for more details on usage and
potential error cases, and refer to
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
### 20. Do not expose Electron APIs to untrusted web content

View File

@@ -52,6 +52,7 @@ auto_filenames = {
"docs/api/service-workers.md",
"docs/api/session.md",
"docs/api/share-menu.md",
"docs/api/shared-texture.md",
"docs/api/shell.md",
"docs/api/structures",
"docs/api/system-preferences.md",
@@ -82,6 +83,7 @@ auto_filenames = {
"docs/api/structures/browser-window-options.md",
"docs/api/structures/certificate-principal.md",
"docs/api/structures/certificate.md",
"docs/api/structures/color-space.md",
"docs/api/structures/cookie.md",
"docs/api/structures/cpu-usage.md",
"docs/api/structures/crash-report.md",
@@ -143,6 +145,13 @@ auto_filenames = {
"docs/api/structures/service-worker-info.md",
"docs/api/structures/shared-dictionary-info.md",
"docs/api/structures/shared-dictionary-usage-info.md",
"docs/api/structures/shared-texture-handle.md",
"docs/api/structures/shared-texture-import-texture-info.md",
"docs/api/structures/shared-texture-imported-subtle.md",
"docs/api/structures/shared-texture-imported.md",
"docs/api/structures/shared-texture-subtle.md",
"docs/api/structures/shared-texture-sync-token.md",
"docs/api/structures/shared-texture-transfer.md",
"docs/api/structures/shared-worker-info.md",
"docs/api/structures/sharing-item.md",
"docs/api/structures/shortcut-details.md",
@@ -174,6 +183,7 @@ auto_filenames = {
"lib/renderer/api/context-bridge.ts",
"lib/renderer/api/crash-reporter.ts",
"lib/renderer/api/ipc-renderer.ts",
"lib/renderer/api/shared-texture.ts",
"lib/renderer/api/web-frame.ts",
"lib/renderer/api/web-utils.ts",
"lib/renderer/common-init.ts",
@@ -255,6 +265,7 @@ auto_filenames = {
"lib/browser/api/service-worker-main.ts",
"lib/browser/api/session.ts",
"lib/browser/api/share-menu.ts",
"lib/browser/api/shared-texture.ts",
"lib/browser/api/system-preferences.ts",
"lib/browser/api/touch-bar.ts",
"lib/browser/api/tray.ts",
@@ -310,6 +321,7 @@ auto_filenames = {
"lib/renderer/api/exports/electron.ts",
"lib/renderer/api/ipc-renderer.ts",
"lib/renderer/api/module-list.ts",
"lib/renderer/api/shared-texture.ts",
"lib/renderer/api/web-frame.ts",
"lib/renderer/api/web-utils.ts",
"lib/renderer/common-init.ts",
@@ -350,6 +362,7 @@ auto_filenames = {
"lib/renderer/api/exports/electron.ts",
"lib/renderer/api/ipc-renderer.ts",
"lib/renderer/api/module-list.ts",
"lib/renderer/api/shared-texture.ts",
"lib/renderer/api/web-frame.ts",
"lib/renderer/api/web-utils.ts",
"lib/renderer/ipc-renderer-bindings.ts",

View File

@@ -194,6 +194,8 @@ filenames = {
"shell/common/api/electron_api_clipboard_mac.mm",
"shell/common/api/electron_api_native_image_mac.mm",
"shell/common/asar/archive_mac.mm",
"shell/common/asar/integrity_digest.h",
"shell/common/asar/integrity_digest.mm",
"shell/common/application_info_mac.mm",
"shell/common/language_util_mac.mm",
"shell/common/mac/main_application_bundle.h",
@@ -456,7 +458,6 @@ filenames = {
"shell/browser/net/system_network_context_manager.h",
"shell/browser/net/url_loader_network_observer.cc",
"shell/browser/net/url_loader_network_observer.h",
"shell/browser/net/web_request_api_interface.h",
"shell/browser/network_hints_handler_impl.cc",
"shell/browser/network_hints_handler_impl.h",
"shell/browser/notifications/notification.cc",
@@ -564,6 +565,7 @@ filenames = {
"shell/common/api/electron_api_native_image.cc",
"shell/common/api/electron_api_native_image.h",
"shell/common/api/electron_api_net.cc",
"shell/common/api/electron_api_shared_texture.cc",
"shell/common/api/electron_api_shell.cc",
"shell/common/api/electron_api_testing.cc",
"shell/common/api/electron_api_url_loader.cc",
@@ -580,6 +582,7 @@ filenames = {
"shell/common/asar/asar_util.h",
"shell/common/asar/scoped_temporary_file.cc",
"shell/common/asar/scoped_temporary_file.h",
"shell/common/callback_util.h",
"shell/common/color_util.cc",
"shell/common/color_util.h",
"shell/common/crash_keys.cc",
@@ -629,8 +632,6 @@ filenames = {
"shell/common/gin_converters/usb_device_info_converter.h",
"shell/common/gin_converters/value_converter.cc",
"shell/common/gin_converters/value_converter.h",
"shell/common/gin_helper/arguments.cc",
"shell/common/gin_helper/arguments.h",
"shell/common/gin_helper/callback.cc",
"shell/common/gin_helper/callback.h",
"shell/common/gin_helper/cleaned_up_at_exit.cc",

View File

@@ -7,21 +7,17 @@ hunspell_dictionaries = [
"//third_party/hunspell_dictionaries/da-DK-3-0.bdic",
"//third_party/hunspell_dictionaries/de-DE-3-0.bdic",
"//third_party/hunspell_dictionaries/el-GR-3-0.bdic",
"//third_party/hunspell_dictionaries/en-AU-10-0.bdic",
"//third_party/hunspell_dictionaries/en-AU-10-1.bdic",
"//third_party/hunspell_dictionaries/en-CA-10-0.bdic",
"//third_party/hunspell_dictionaries/en-CA-10-1.bdic",
"//third_party/hunspell_dictionaries/en-GB-10-0.bdic",
"//third_party/hunspell_dictionaries/en-GB-10-1.bdic",
"//third_party/hunspell_dictionaries/en-GB-oxendict-10-0.bdic",
"//third_party/hunspell_dictionaries/en-GB-oxendict-10-1.bdic",
"//third_party/hunspell_dictionaries/en-US-10-0.bdic",
"//third_party/hunspell_dictionaries/en-US-10-1.bdic",
"//third_party/hunspell_dictionaries/es-ES-3-0.bdic",
"//third_party/hunspell_dictionaries/et-EE-3-0.bdic",
"//third_party/hunspell_dictionaries/fa-IR-9-0.bdic",
"//third_party/hunspell_dictionaries/fo-FO-3-0.bdic",
"//third_party/hunspell_dictionaries/fr-FR-3-0.bdic",
"//third_party/hunspell_dictionaries/gl-1-0.bdic",
"//third_party/hunspell_dictionaries/he-IL-3-0.bdic",
"//third_party/hunspell_dictionaries/hi-IN-3-0.bdic",
"//third_party/hunspell_dictionaries/hr-HR-3-0.bdic",
@@ -59,6 +55,7 @@ hunspell_dictionaries = [
hunspell_licenses = [
"//third_party/hunspell_dictionaries/COPYING",
"//third_party/hunspell_dictionaries/COPYING.Apache",
"//third_party/hunspell_dictionaries/COPYING.GPL3",
"//third_party/hunspell_dictionaries/COPYING.LESSER",
"//third_party/hunspell_dictionaries/COPYING.LGPL",
"//third_party/hunspell_dictionaries/COPYING.MIT",

View File

@@ -217,6 +217,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
"//third_party/libc++/src/include/__atomic/contention_t.h",
"//third_party/libc++/src/include/__atomic/fence.h",
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
"//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -262,6 +263,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__chrono/gps_clock.h",
"//third_party/libc++/src/include/__chrono/hh_mm_ss.h",
"//third_party/libc++/src/include/__chrono/high_resolution_clock.h",
"//third_party/libc++/src/include/__chrono/is_clock.h",
"//third_party/libc++/src/include/__chrono/leap_second.h",
"//third_party/libc++/src/include/__chrono/literals.h",
"//third_party/libc++/src/include/__chrono/local_info.h",
@@ -328,6 +330,8 @@ libcxx_headers = [
"//third_party/libc++/src/include/__configuration/abi.h",
"//third_party/libc++/src/include/__configuration/availability.h",
"//third_party/libc++/src/include/__configuration/compiler.h",
"//third_party/libc++/src/include/__configuration/experimental.h",
"//third_party/libc++/src/include/__configuration/hardening.h",
"//third_party/libc++/src/include/__configuration/language.h",
"//third_party/libc++/src/include/__configuration/platform.h",
"//third_party/libc++/src/include/__coroutine/coroutine_handle.h",
@@ -840,7 +844,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cmath",
"//third_party/libc++/src/include/__cxx03/codecvt",
"//third_party/libc++/src/include/__cxx03/complex",
"//third_party/libc++/src/include/__cxx03/complex.h",
"//third_party/libc++/src/include/__cxx03/condition_variable",
"//third_party/libc++/src/include/__cxx03/csetjmp",
"//third_party/libc++/src/include/__cxx03/csignal",
@@ -853,25 +856,20 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cstring",
"//third_party/libc++/src/include/__cxx03/ctgmath",
"//third_party/libc++/src/include/__cxx03/ctime",
"//third_party/libc++/src/include/__cxx03/ctype.h",
"//third_party/libc++/src/include/__cxx03/cuchar",
"//third_party/libc++/src/include/__cxx03/cwchar",
"//third_party/libc++/src/include/__cxx03/cwctype",
"//third_party/libc++/src/include/__cxx03/deque",
"//third_party/libc++/src/include/__cxx03/errno.h",
"//third_party/libc++/src/include/__cxx03/exception",
"//third_party/libc++/src/include/__cxx03/experimental/__config",
"//third_party/libc++/src/include/__cxx03/experimental/utility",
"//third_party/libc++/src/include/__cxx03/ext/__hash",
"//third_party/libc++/src/include/__cxx03/ext/hash_map",
"//third_party/libc++/src/include/__cxx03/ext/hash_set",
"//third_party/libc++/src/include/__cxx03/fenv.h",
"//third_party/libc++/src/include/__cxx03/float.h",
"//third_party/libc++/src/include/__cxx03/forward_list",
"//third_party/libc++/src/include/__cxx03/fstream",
"//third_party/libc++/src/include/__cxx03/functional",
"//third_party/libc++/src/include/__cxx03/future",
"//third_party/libc++/src/include/__cxx03/inttypes.h",
"//third_party/libc++/src/include/__cxx03/iomanip",
"//third_party/libc++/src/include/__cxx03/ios",
"//third_party/libc++/src/include/__cxx03/iosfwd",
@@ -898,11 +896,8 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/sstream",
"//third_party/libc++/src/include/__cxx03/stack",
"//third_party/libc++/src/include/__cxx03/stdatomic.h",
"//third_party/libc++/src/include/__cxx03/stdbool.h",
"//third_party/libc++/src/include/__cxx03/stddef.h",
"//third_party/libc++/src/include/__cxx03/stdexcept",
"//third_party/libc++/src/include/__cxx03/stdint.h",
"//third_party/libc++/src/include/__cxx03/stdio.h",
"//third_party/libc++/src/include/__cxx03/stdlib.h",
"//third_party/libc++/src/include/__cxx03/streambuf",
"//third_party/libc++/src/include/__cxx03/string",
@@ -910,7 +905,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/string_view",
"//third_party/libc++/src/include/__cxx03/strstream",
"//third_party/libc++/src/include/__cxx03/system_error",
"//third_party/libc++/src/include/__cxx03/tgmath.h",
"//third_party/libc++/src/include/__cxx03/thread",
"//third_party/libc++/src/include/__cxx03/type_traits",
"//third_party/libc++/src/include/__cxx03/typeindex",
@@ -923,7 +917,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/vector",
"//third_party/libc++/src/include/__cxx03/version",
"//third_party/libc++/src/include/__cxx03/wchar.h",
"//third_party/libc++/src/include/__cxx03/wctype.h",
"//third_party/libc++/src/include/__debug_utils/randomize_range.h",
"//third_party/libc++/src/include/__debug_utils/sanitizers.h",
"//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
@@ -1034,14 +1027,12 @@ libcxx_headers = [
"//third_party/libc++/src/include/__fwd/get.h",
"//third_party/libc++/src/include/__fwd/ios.h",
"//third_party/libc++/src/include/__fwd/istream.h",
"//third_party/libc++/src/include/__fwd/map.h",
"//third_party/libc++/src/include/__fwd/mdspan.h",
"//third_party/libc++/src/include/__fwd/memory.h",
"//third_party/libc++/src/include/__fwd/memory_resource.h",
"//third_party/libc++/src/include/__fwd/ostream.h",
"//third_party/libc++/src/include/__fwd/pair.h",
"//third_party/libc++/src/include/__fwd/queue.h",
"//third_party/libc++/src/include/__fwd/set.h",
"//third_party/libc++/src/include/__fwd/span.h",
"//third_party/libc++/src/include/__fwd/sstream.h",
"//third_party/libc++/src/include/__fwd/stack.h",
@@ -1117,6 +1108,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__locale_dir/support/freebsd.h",
"//third_party/libc++/src/include/__locale_dir/support/fuchsia.h",
"//third_party/libc++/src/include/__locale_dir/support/linux.h",
"//third_party/libc++/src/include/__locale_dir/support/netbsd.h",
"//third_party/libc++/src/include/__locale_dir/support/no_locale/characters.h",
"//third_party/libc++/src/include/__locale_dir/support/no_locale/strtonum.h",
"//third_party/libc++/src/include/__locale_dir/support/windows.h",
@@ -1367,21 +1359,17 @@ libcxx_headers = [
"//third_party/libc++/src/include/__tree",
"//third_party/libc++/src/include/__tuple/find_index.h",
"//third_party/libc++/src/include/__tuple/ignore.h",
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
"//third_party/libc++/src/include/__tuple/tuple_element.h",
"//third_party/libc++/src/include/__tuple/tuple_like.h",
"//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
"//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
"//third_party/libc++/src/include/__tuple/tuple_size.h",
"//third_party/libc++/src/include/__tuple/tuple_types.h",
"//third_party/libc++/src/include/__type_traits/add_cv_quals.h",
"//third_party/libc++/src/include/__type_traits/add_pointer.h",
"//third_party/libc++/src/include/__type_traits/add_reference.h",
"//third_party/libc++/src/include/__type_traits/aligned_storage.h",
"//third_party/libc++/src/include/__type_traits/aligned_union.h",
"//third_party/libc++/src/include/__type_traits/alignment_of.h",
"//third_party/libc++/src/include/__type_traits/can_extract_key.h",
"//third_party/libc++/src/include/__type_traits/common_reference.h",
"//third_party/libc++/src/include/__type_traits/common_type.h",
"//third_party/libc++/src/include/__type_traits/conditional.h",
@@ -1410,7 +1398,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_array.h",
"//third_party/libc++/src/include/__type_traits/is_assignable.h",
"//third_party/libc++/src/include/__type_traits/is_base_of.h",
"//third_party/libc++/src/include/__type_traits/is_bounded_array.h",
"//third_party/libc++/src/include/__type_traits/is_callable.h",
"//third_party/libc++/src/include/__type_traits/is_char_like_type.h",
"//third_party/libc++/src/include/__type_traits/is_class.h",
@@ -1429,6 +1416,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
"//third_party/libc++/src/include/__type_traits/is_function.h",
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
"//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1446,7 +1434,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_reference.h",
"//third_party/libc++/src/include/__type_traits/is_reference_wrapper.h",
"//third_party/libc++/src/include/__type_traits/is_referenceable.h",
"//third_party/libc++/src/include/__type_traits/is_replaceable.h",
"//third_party/libc++/src/include/__type_traits/is_same.h",
"//third_party/libc++/src/include/__type_traits/is_scalar.h",
"//third_party/libc++/src/include/__type_traits/is_signed.h",
@@ -1460,16 +1447,18 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_trivially_destructible.h",
"//third_party/libc++/src/include/__type_traits/is_trivially_lexicographically_comparable.h",
"//third_party/libc++/src/include/__type_traits/is_trivially_relocatable.h",
"//third_party/libc++/src/include/__type_traits/is_unbounded_array.h",
"//third_party/libc++/src/include/__type_traits/is_union.h",
"//third_party/libc++/src/include/__type_traits/is_unqualified.h",
"//third_party/libc++/src/include/__type_traits/is_unsigned.h",
"//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
"//third_party/libc++/src/include/__type_traits/is_void.h",
"//third_party/libc++/src/include/__type_traits/is_volatile.h",
"//third_party/libc++/src/include/__type_traits/is_within_lifetime.h",
"//third_party/libc++/src/include/__type_traits/lazy.h",
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
"//third_party/libc++/src/include/__type_traits/make_signed.h",
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
"//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1501,6 +1490,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/cmp.h",
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
"//third_party/libc++/src/include/__utility/declval.h",
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/element_count.h",
"//third_party/libc++/src/include/__utility/empty.h",
"//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1511,6 +1501,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/integer_sequence.h",
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
"//third_party/libc++/src/include/__utility/is_valid_range.h",
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/move.h",
"//third_party/libc++/src/include/__utility/no_destroy.h",
"//third_party/libc++/src/include/__utility/pair.h",
@@ -1522,6 +1513,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/small_buffer.h",
"//third_party/libc++/src/include/__utility/swap.h",
"//third_party/libc++/src/include/__utility/to_underlying.h",
"//third_party/libc++/src/include/__utility/try_key_extraction.h",
"//third_party/libc++/src/include/__utility/unreachable.h",
"//third_party/libc++/src/include/__variant/monostate.h",
"//third_party/libc++/src/include/__vector/comparison.h",
@@ -1649,7 +1641,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/sstream",
"//third_party/libc++/src/include/stack",
"//third_party/libc++/src/include/stdatomic.h",
"//third_party/libc++/src/include/stdbool.h",
"//third_party/libc++/src/include/stddef.h",
"//third_party/libc++/src/include/stdexcept",
"//third_party/libc++/src/include/stdio.h",

View File

@@ -1,11 +1,14 @@
import { Menu } from 'electron/main';
import { EventEmitter } from 'events';
import * as fs from 'fs';
const bindings = process._linkedBinding('electron_browser_app');
const commandLine = process._linkedBinding('electron_common_command_line');
const { app } = bindings;
Object.setPrototypeOf(app, EventEmitter.prototype);
// Only one app object permitted.
export default app;

View File

@@ -46,11 +46,11 @@ Menu.prototype._isCommandIdEnabled = function (id) {
};
Menu.prototype._shouldCommandIdWorkWhenHidden = function (id) {
return this.commandsMap[id] ? !!this.commandsMap[id].acceleratorWorksWhenHidden : false;
return this.commandsMap[id]?.acceleratorWorksWhenHidden ?? false;
};
Menu.prototype._isCommandIdVisible = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].visible : false;
return this.commandsMap[id]?.visible ?? false;
};
Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator) {
@@ -61,12 +61,12 @@ Menu.prototype._getAcceleratorForCommandId = function (id, useDefaultAccelerator
};
Menu.prototype._shouldRegisterAcceleratorForCommandId = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].registerAccelerator : false;
return this.commandsMap[id]?.registerAccelerator ?? false;
};
if (process.platform === 'darwin') {
Menu.prototype._getSharingItemForCommandId = function (id) {
return this.commandsMap[id] ? this.commandsMap[id].sharingItem : null;
return this.commandsMap[id]?.sharingItem ?? null;
};
}

View File

@@ -31,6 +31,7 @@ export const browserModuleList: ElectronInternal.ModuleEntry[] = [
{ name: 'screen', loader: () => require('./screen') },
{ name: 'ServiceWorkerMain', loader: () => require('./service-worker-main') },
{ name: 'session', loader: () => require('./session') },
{ name: 'sharedTexture', loader: () => require('./shared-texture') },
{ name: 'ShareMenu', loader: () => require('./share-menu') },
{ name: 'systemPreferences', loader: () => require('./system-preferences') },
{ name: 'TouchBar', loader: () => require('./touch-bar') },

View File

@@ -0,0 +1,191 @@
import ipcMain from '@electron/internal/browser/api/ipc-main';
import * as ipcMainInternalUtils from '@electron/internal/browser/ipc-main-internal-utils';
import { IPC_MESSAGES } from '@electron/internal/common/ipc-messages';
import { randomUUID } from 'crypto';
const transferTimeout = 1000;
const sharedTextureNative = process._linkedBinding('electron_common_shared_texture');
const managedSharedTextures = new Map<string, SharedTextureImportedWrapper>();
type AllReleasedCallback = (imported: Electron.SharedTextureImported) => void;
type SharedTextureImportedWrapper = {
texture: Electron.SharedTextureImported;
allReferencesReleased: AllReleasedCallback | undefined;
mainReference: boolean;
rendererFrameReferences: Map<number, { count: number, reference: Electron.WebFrameMain }>;
}
ipcMain.handle(IPC_MESSAGES.IMPORT_SHARED_TEXTURE_RELEASE_RENDERER_TO_MAIN, (event: Electron.IpcMainInvokeEvent, textureId: string) => {
const frameTreeNodeId = event.frameTreeNodeId ?? event.sender.mainFrame.frameTreeNodeId;
wrapperReleaseFromRenderer(textureId, frameTreeNodeId);
});
let checkManagedSharedTexturesInterval: NodeJS.Timeout | null = null;
function scheduleCheckManagedSharedTextures () {
if (checkManagedSharedTexturesInterval === null) {
checkManagedSharedTexturesInterval = setInterval(checkManagedSharedTextures, 1000);
}
}
function unscheduleCheckManagedSharedTextures () {
if (checkManagedSharedTexturesInterval !== null) {
clearInterval(checkManagedSharedTexturesInterval);
checkManagedSharedTexturesInterval = null;
}
}
function checkManagedSharedTextures () {
const texturesToRemoveTracking = new Set<string>();
for (const [, wrapper] of managedSharedTextures) {
for (const [frameTreeNodeId, entry] of wrapper.rendererFrameReferences) {
const frame = entry.reference;
if (!frame || frame.isDestroyed()) {
console.error(`The imported shared texture ${wrapper.texture.textureId} is referenced by a destroyed webContent/webFrameMain, this means a imported shared texture in renderer process is not released before the process is exited. Releasing that dangling reference now.`);
wrapper.rendererFrameReferences.delete(frameTreeNodeId);
}
}
if (wrapper.rendererFrameReferences.size === 0 && !wrapper.mainReference) {
texturesToRemoveTracking.add(wrapper.texture.textureId);
wrapper.texture.subtle.release(() => {
wrapper.allReferencesReleased?.(wrapper.texture);
});
}
}
for (const id of texturesToRemoveTracking) {
managedSharedTextures.delete(id);
}
if (managedSharedTextures.size === 0) {
unscheduleCheckManagedSharedTextures();
}
}
function wrapperReleaseFromRenderer (id: string, frameTreeNodeId: number) {
const wrapper = managedSharedTextures.get(id);
if (!wrapper) {
throw new Error(`Shared texture with id ${id} not found`);
}
const entry = wrapper.rendererFrameReferences.get(frameTreeNodeId);
if (!entry) {
throw new Error(`Shared texture ${id} is not referenced by renderer frame ${frameTreeNodeId}`);
}
entry.count -= 1;
if (entry.count === 0) {
wrapper.rendererFrameReferences.delete(frameTreeNodeId);
} else {
wrapper.rendererFrameReferences.set(frameTreeNodeId, entry);
}
// Actually release the texture if no one is referencing it
if (wrapper.rendererFrameReferences.size === 0 && !wrapper.mainReference) {
managedSharedTextures.delete(id);
wrapper.texture.subtle.release(() => {
wrapper.allReferencesReleased?.(wrapper.texture);
});
}
}
function wrapperReleaseFromMain (id: string) {
const wrapper = managedSharedTextures.get(id);
if (!wrapper) {
throw new Error(`Shared texture with id ${id} not found`);
}
// Actually release the texture if no one is referencing it
wrapper.mainReference = false;
if (wrapper.rendererFrameReferences.size === 0) {
managedSharedTextures.delete(id);
wrapper.texture.subtle.release(() => {
wrapper.allReferencesReleased?.(wrapper.texture);
});
}
}
async function sendSharedTexture (options: Electron.SendSharedTextureOptions, ...args: any[]) {
const imported = options.importedSharedTexture;
const transfer = imported.subtle.startTransferSharedTexture();
let timeoutHandle: NodeJS.Timeout | null = null;
const timeoutPromise = new Promise<never>((resolve, reject) => {
timeoutHandle = setTimeout(() => {
reject(new Error(`transfer shared texture timed out after ${transferTimeout}ms, ensure you have registered receiver at renderer process.`));
}, transferTimeout);
});
const targetFrame: Electron.WebFrameMain | undefined = options.frame;
if (!targetFrame) {
throw new Error('`frame` should be provided');
}
const invokePromise: Promise<Electron.SharedTextureSyncToken> = ipcMainInternalUtils.invokeInWebFrameMain<Electron.SharedTextureSyncToken>(
targetFrame,
IPC_MESSAGES.IMPORT_SHARED_TEXTURE_TRANSFER_MAIN_TO_RENDERER,
transfer,
imported.textureId,
...args
);
try {
const syncToken = await Promise.race([invokePromise, timeoutPromise]);
imported.subtle.setReleaseSyncToken(syncToken);
const wrapper = managedSharedTextures.get(imported.textureId);
if (!wrapper) {
throw new Error(`Shared texture with id ${imported.textureId} not found`);
}
const key = targetFrame.frameTreeNodeId;
const existing = wrapper.rendererFrameReferences.get(key);
if (existing) {
existing.count += 1;
wrapper.rendererFrameReferences.set(key, existing);
} else {
wrapper.rendererFrameReferences.set(key, { count: 1, reference: targetFrame });
}
} finally {
if (timeoutHandle) {
clearTimeout(timeoutHandle);
}
}
// Schedule a check to see if any texture is referenced by any dangling renderer
scheduleCheckManagedSharedTextures();
}
function importSharedTexture (options: Electron.ImportSharedTextureOptions) {
const id = randomUUID();
const imported = sharedTextureNative.importSharedTexture(Object.assign(options.textureInfo, { id }));
const ret: Electron.SharedTextureImported = {
textureId: id,
subtle: imported,
getVideoFrame: imported.getVideoFrame,
release: () => {
wrapperReleaseFromMain(id);
}
};
const wrapper: SharedTextureImportedWrapper = {
texture: ret,
allReferencesReleased: options.allReferencesReleased,
mainReference: true,
rendererFrameReferences: new Map()
};
managedSharedTextures.set(id, wrapper);
return ret;
}
const sharedTexture = {
subtle: sharedTextureNative,
importSharedTexture,
sendSharedTexture
};
export default sharedTexture;

View File

@@ -882,7 +882,7 @@ export function create (options = {}): Electron.WebContents {
return new (WebContents as any)(options);
}
export function fromId (id: string) {
export function fromId (id: number) {
return binding.fromId(id);
}

View File

@@ -36,3 +36,27 @@ export function invokeInWebContents<T> (sender: Electron.WebContents, command: s
sender._sendInternal(command, requestId, ...args);
});
}
export function invokeInWebFrameMain<T> (sender: Electron.WebFrameMain, command: string, ...args: any[]) {
return new Promise<T>((resolve, reject) => {
const requestId = ++nextId;
const channel = `${command}_RESPONSE_${requestId}`;
const frameTreeNodeId = sender.frameTreeNodeId;
ipcMainInternal.on(channel, function handler (event, error: Error, result: any) {
if (event.type === 'frame' && event.frameTreeNodeId !== frameTreeNodeId) {
console.error(`Reply to ${command} sent by unexpected WebFrameMain (${event.frameTreeNodeId})`);
return;
}
ipcMainInternal.removeListener(channel, handler);
if (error) {
reject(error);
} else {
resolve(result);
}
});
sender._sendInternal(command, requestId, ...args);
});
}

View File

@@ -91,6 +91,12 @@ export function parseFeatures (features: string) {
delete parsed[key];
}
// Per spec - https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev
// windows are always resizable.
if (parsed.resizable !== undefined) {
delete parsed.resizable;
}
if (parsed.left !== undefined) parsed.x = parsed.left;
if (parsed.top !== undefined) parsed.y = parsed.top;

View File

@@ -428,9 +428,8 @@ export class ClientRequest extends Writable implements Electron.ClientRequest {
this._started = true;
const stringifyValues = (obj: Record<string, { name: string, value: string | string[] }>) => {
const ret: Record<string, string> = {};
for (const k of Object.keys(obj)) {
const kv = obj[k];
ret[kv.name] = kv.value.toString();
for (const { name, value } of Object.values(obj)) {
ret[name] = value.toString();
}
return ret;
};

View File

@@ -25,4 +25,7 @@ export const enum IPC_MESSAGES {
INSPECTOR_CONFIRM = 'INSPECTOR_CONFIRM',
INSPECTOR_CONTEXT_MENU = 'INSPECTOR_CONTEXT_MENU',
INSPECTOR_SELECT_FILE = 'INSPECTOR_SELECT_FILE',
IMPORT_SHARED_TEXTURE_TRANSFER_MAIN_TO_RENDERER = 'IMPORT_SHARED_TEXTURE_TRANSFER_MAIN_TO_RENDERER',
IMPORT_SHARED_TEXTURE_RELEASE_RENDERER_TO_MAIN = 'IMPORT_SHARED_TEXTURE_RELEASE_RENDERER_TO_MAIN',
}

View File

@@ -746,7 +746,7 @@ export const wrapFsWithAsar = (fs: Record<string, any>) => {
context.readdirResults.push(dirent);
if (dirent!.isDirectory() || stat === 1) {
context.pathsQueue.push(path.join(dirent!.path, dirent!.name));
context.pathsQueue.push(path.join(dirent!.parentPath, dirent!.name));
}
}
}

View File

@@ -1,21 +1,45 @@
import * as deprecate from '@electron/internal/common/deprecate';
import { IPC_MESSAGES } from '@electron/internal/common/ipc-messages';
import * as ipcRendererUtils from '@electron/internal/renderer/ipc-renderer-internal-utils';
const clipboard = process._linkedBinding('electron_common_clipboard');
const clipboard = {} as Electron.Clipboard;
const originalClipboard = process._linkedBinding('electron_common_clipboard');
const warnDeprecatedAccess = function (method: keyof Electron.Clipboard) {
return deprecate.warnOnceMessage(`Accessing 'clipboard.${method}' from the renderer process is
deprecated and will be removed. Please use the 'contextBridge' API to access
the clipboard API from the renderer.`);
};
const makeDeprecatedMethod = function (method: keyof Electron.Clipboard): any {
const warnDeprecated = warnDeprecatedAccess(method);
return (...args: any[]) => {
warnDeprecated();
return (originalClipboard[method] as any)(...args);
};
};
const makeRemoteMethod = function (method: keyof Electron.Clipboard): any {
return (...args: any[]) => ipcRendererUtils.invokeSync(IPC_MESSAGES.BROWSER_CLIPBOARD_SYNC, method, ...args);
const warnDeprecated = warnDeprecatedAccess(method);
return (...args: any[]) => {
warnDeprecated();
return ipcRendererUtils.invokeSync(IPC_MESSAGES.BROWSER_CLIPBOARD_SYNC, method, ...args);
};
};
if (process.platform === 'linux') {
// On Linux we could not access clipboard in renderer process.
for (const method of Object.keys(clipboard) as (keyof Electron.Clipboard)[]) {
for (const method of Object.keys(originalClipboard) as (keyof Electron.Clipboard)[]) {
clipboard[method] = makeRemoteMethod(method);
}
} else if (process.platform === 'darwin') {
// Read/write to find pasteboard over IPC since only main process is notified of changes
clipboard.readFindText = makeRemoteMethod('readFindText');
clipboard.writeFindText = makeRemoteMethod('writeFindText');
} else {
for (const method of Object.keys(originalClipboard) as (keyof Electron.Clipboard)[]) {
if (process.platform === 'darwin' && (method === 'readFindText' || method === 'writeFindText')) {
clipboard[method] = makeRemoteMethod(method);
} else {
clipboard[method] = makeDeprecatedMethod(method);
}
}
}
export default clipboard;

View File

@@ -4,6 +4,7 @@ export const rendererModuleList: ElectronInternal.ModuleEntry[] = [
{ name: 'contextBridge', loader: () => require('./context-bridge') },
{ name: 'crashReporter', loader: () => require('./crash-reporter') },
{ name: 'ipcRenderer', loader: () => require('./ipc-renderer') },
{ name: 'sharedTexture', loader: () => require('./shared-texture') },
{ name: 'webFrame', loader: () => require('./web-frame') },
{ name: 'webUtils', loader: () => require('./web-utils') }
];

View File

@@ -0,0 +1,45 @@
import { IPC_MESSAGES } from '@electron/internal/common/ipc-messages';
import ipcRenderer from '@electron/internal/renderer/api/ipc-renderer';
import { ipcRendererInternal } from '@electron/internal/renderer/ipc-renderer-internal';
const sharedTextureNative = process._linkedBinding('electron_common_shared_texture');
const transferChannelName = IPC_MESSAGES.IMPORT_SHARED_TEXTURE_TRANSFER_MAIN_TO_RENDERER;
type SharedTextureReceiverCallback = (data: Electron.ReceivedSharedTextureData, ...args: any[]) => Promise<void>;
let sharedTextureReceiverCallback: SharedTextureReceiverCallback | null = null;
ipcRendererInternal.on(transferChannelName, async (event, requestId, ...args) => {
const replyChannel = `${transferChannelName}_RESPONSE_${requestId}`;
try {
const transfer = args[0] as Electron.SharedTextureTransfer;
const textureId = args[1] as string;
const imported = sharedTextureNative.finishTransferSharedTexture(Object.assign(transfer, { id: textureId }));
const syncToken = imported.getFrameCreationSyncToken();
event.sender.send(replyChannel, null, syncToken);
const wrapper: Electron.SharedTextureImported = {
textureId,
subtle: imported,
getVideoFrame: imported.getVideoFrame,
release: () => {
imported.release(async () => {
await ipcRenderer.invoke(IPC_MESSAGES.IMPORT_SHARED_TEXTURE_RELEASE_RENDERER_TO_MAIN, textureId);
});
}
};
const data: Electron.ReceivedSharedTextureData = { importedSharedTexture: wrapper };
await sharedTextureReceiverCallback?.(data, ...args.slice(2));
} catch (error) {
event.sender.send(replyChannel, error);
}
});
const sharedTexture = {
subtle: sharedTextureNative,
setSharedTextureReceiver: (callback: SharedTextureReceiverCallback) => {
sharedTextureReceiverCallback = callback;
}
};
export default sharedTexture;

View File

@@ -15,6 +15,10 @@ export const moduleList: ElectronInternal.ModuleEntry[] = [
name: 'nativeImage',
loader: () => require('@electron/internal/common/api/native-image')
},
{
name: 'sharedTexture',
loader: () => require('@electron/internal/renderer/api/shared-texture')
},
{
name: 'webFrame',
loader: () => require('@electron/internal/renderer/api/web-frame')

View File

@@ -5,7 +5,9 @@ const proc = require('child_process');
const electron = require('./');
const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
let childClosed = false;
child.on('close', function (code, signal) {
childClosed = true;
if (code === null) {
console.error(electron, 'exited with signal', signal);
process.exit(1);
@@ -15,7 +17,7 @@ child.on('close', function (code, signal) {
const handleTerminationSignal = function (signal) {
process.on(signal, function signalHandler () {
if (!child.killed) {
if (!childClosed) {
child.kill(signal);
}
});
@@ -23,3 +25,4 @@ const handleTerminationSignal = function (signal) {
handleTerminationSignal('SIGINT');
handleTerminationSignal('SIGTERM');
handleTerminationSignal('SIGUSR2');

View File

@@ -9,7 +9,7 @@
},
"dependencies": {
"@electron/get": "^2.0.0",
"@types/node": "^22.7.7",
"@types/node": "^24.9.0",
"extract-zip": "^2.0.1"
},
"engines": {

Some files were not shown because too many files have changed in this diff Show More