Compare commits

..

228 Commits

Author SHA1 Message Date
trop[bot]
1079f3bbfa fix: prevent GBytes leak in GdkPixbufFromSkBitmap on Linux/GTK (#49897)
Inside gtk_util::GdkPixbufFromSkBitmap, g_bytes_new() was called
inline as an argument to gdk_pixbuf_new_from_bytes(), which per
GTK docs does not take ownership of the GBytes - it adds its own
internal reference. The caller's GBytes* was never stored or
unreffed, leaking 4 x width x height bytes of pixel data on every
call.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: redeemer <marcin.probola@gmail.com>
2026-02-21 17:11:52 +01:00
trop[bot]
d91adea56f build: use spawn instead of spawnSync for build (#49828)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 15:58:03 -05:00
trop[bot]
b2b584a320 chore: add Copilot CLI instructions (#49823)
chore: add copilot-instructions

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 13:25:08 -05:00
trop[bot]
1778a26c46 build: generate artifact attestions for released assets (#49781)
* build: generate artifact attestions for released assets (#48239)

* build: generate artifact attestions for released assets

* chore: address review feedback

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
(cherry picked from commit dec7f937ae)

Co-authored-by: Samuel Attard <sam@electronjs.org>

* build: fixup attestation for release assets (#49732)

* build: fixup attestation for release assets

* Generate artifact attestation for generated artifacts

* set id-token for attestation

* Add artifact-metadata permission for attestation

* add permissions for testing attestations

* Revert "add permissions for testing attestations"

This reverts commit 0284bed175.

* Revert "set id-token for attestation"

This reverts commit 69a1b13a18.

* Revert "Generate artifact attestation for generated artifacts"

This reverts commit ee0536eceb.

(cherry picked from commit 0852893910)

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update publish workflow

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sam@electronjs.org>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-16 10:51:09 +01:00
Keeley Hammond
9fed98cee5 chore: cherry-pick e045399a1ecb from chromium (#49792)
* chore: cherry-pick e045399a1ecb from chromium

* chore: update patch

* chore: fix older method in patch
2026-02-13 10:27:37 +01:00
trop[bot]
d4d1596d2f fix: menu state in macOS dock menus (#49627)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-04 18:54:16 +01:00
trop[bot]
356bba8060 fix: duplicate fullscreen macOS menu item (#49596)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-02 11:50:01 -05:00
trop[bot]
ecbe8ee08a test: remove split dependency (#49556)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 11:49:51 -08:00
trop[bot]
8fb777dab0 revert: use deprecated setAllowedFileTypes in macOS dialogs (#49471)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove stray import

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-23 11:25:38 -05:00
electron-roller[bot]
c8af46e054 chore: bump node to v22.22.0 (38-x-y) (#49388)
* chore: bump node in DEPS to v22.22.0

* chore: update patches

* chore: fixup sandboxed pointers patch

(cherry picked from commit f52fbdbe51)

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782
(cherry picked from commit 87bc8ebd34)
(cherry picked from commit 2b6f185521)

* chore:remove zero-fill sandbox patch component

xref https://github.com/electron/electron/pull/49452

(cherry picked from commit bdb87f9dbb)

* fixup! chore:remove zero-fill sandbox patch component

(cherry picked from commit 6a4e4e3821)
Co-Authored-By: Robo <hop2deep@gmail.com>

* test: correct conditional secure heap flags test

xref:  https://github.com/nodejs/node/pull/60385
(cherry picked from commit 1304ff2d83)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-23 10:48:43 -05:00
trop[bot]
e342216d9e ci: detect patch needs update error with problem matcher (#49410)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-21 20:45:00 -08:00
trop[bot]
90b4003ad5 build: roll build-image to a82b87d (#49451)
* build: roll build-image to a82b87d

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* build: roll build-tools SHA to 4430e4a

(cherry picked from commit b989c070c6)

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-21 15:18:11 +01:00
trop[bot]
ab3292cf81 chore: improvements to script/run-clang-tidy.ts (#49344)
* chore: disable color output for clang-tidy in CI

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: small QoL improvements to run-clang-tidy.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: add --fix option to script/run-clang-tidy.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-12 11:01:25 +01:00
John Kleinschmidt
75ee26902b build: use @electron-ci/dev-root for package.json default (#49326)
* build: use @electron-ci/dev-root for package.json default

(cherry picked from commit bab6bd3dae)

* fxiup

(cherry picked from commit 218300e57f)
2026-01-08 10:10:58 -06:00
trop[bot]
a586dd3045 build: fixup release notes generation (#49306)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-01-05 14:55:26 -06:00
trop[bot]
bd1561a5b5 ci: disallow non-maintainer changes to Yarn files (#49248)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-05 10:37:58 -05:00
David Sanders
bc8ecdf96f build: disallow non-maintainer changes to GitHub Actions workflows (#49232)
build: disallow non-maintainer changes to GitHub Actions workflows (#48038)

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-12-18 16:23:04 -08:00
trop[bot]
2515880814 build: drop dugite as a dependency (#49207)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-12-16 15:56:45 -05:00
trop[bot]
4c06de632e build: upgrade yarn to 4.12.0 (#49182)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-12-11 10:34:02 -05:00
John Kleinschmidt
6b2861d063 build: upgrade github-app-auth to 3.2.0 (#49162)
build: upgrade github-app-auth to 3.2.0 (#49152)
2025-12-10 10:51:26 -05:00
trop[bot]
9692c9ea58 ci: don't build yarn modules for linux arm (#49085)
This should fix the oom errors

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-12-01 11:42:47 -08:00
trop[bot]
ecb6b6c1c1 ci: use clang problem matcher with nan spec runner (#49100)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-11-27 11:11:39 +01:00
trop[bot]
269a5393c0 fix: ensure menu-did-close is emitted for application menus (#49094)
fix: ensure menu-did-close is emitted for application menus

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-26 18:35:54 -06:00
Shelley Vohr
822fb2cd4d fix: systemPreferences.getAccentColor inverted color (#49066) 2025-11-25 15:47:09 -06:00
John Kleinschmidt
32fcfe4505 test: fixup test failures on linux (#49068)
* test: fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests
(cherry picked from commit cc3c999148)

* test:rebuild native modules

(cherry picked from commit bb8e2a924b)

* fix: wait for devtools blur event in focus test to avoid race condition

(cherry picked from commit 6fd2575cbc)

* fix: wait for devtools blur event in focus test to avoid race condition

(cherry picked from commit ea830139af)

---------

Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-25 20:49:33 +01:00
trop[bot]
933f0d50d1 docs: update linux build instructions (#49061)
* docs: update linux build instructions

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-24 13:50:40 -06:00
trop[bot]
4bd6182e83 fix: only call popup closecallback for top-level menu (#49047)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-23 21:35:11 +01:00
John Kleinschmidt
3e6dd7f771 build: update to yarn v4 (#48995)
* build: update to yarn v4

(cherry picked from commit 6adec744f3)

* chore: fixup types after yarn v4 migration

* chore: update nan yarn.lock file

* build: automatically install git for dugite
2025-11-20 10:13:44 -05:00
trop[bot]
9b89d19b1b fix: revert the parent window remained interactive after the modal window was opened (#49020)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: bill.shen <15865969+cucbin@users.noreply.github.com>
2025-11-19 16:59:27 -05:00
Keeley Hammond
38cb7ab080 chore: cherry-pick 62af07e96173 from v8 (#49009)
* chore: cherry-pick 62af07e96173 from v8

* chore: update patches

* test: move to macos-14-large (needed for Intel)
2025-11-18 15:47:15 -08:00
Robo
f6f0843536 chore: cherry-pick 9fcb46c from v8 (#48984) 2025-11-17 09:44:53 +01:00
trop[bot]
4cc7821d01 build: limit workflow gh token permissions (#48968)
* build: limit workflow gh token permissions

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* feedback

Co-authored-by: Samuel Attard <sattard@anthropic.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2025-11-15 11:32:26 +01:00
Samuel Attard
17c909924c chore: cherry-pick 4cf9311810b0 from v8 (#48950)
* chore: cherry-pick 4cf9311810b0 from v8

* chore: update patches

---------

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-13 14:57:06 -08:00
Fedor Indutny
40d65d5a9f fix: crash on windows when UTF-8 is in path (#48947)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 14:49:48 -08:00
Nikita Skovoroda
b32853b8aa fix: devtools crashing on Linux in detach mode (#48926)
Backport of https://github.com/electron/electron/pull/48600
(8756e82b5f24dcda13225968c3655d37f73d195e)

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 15:28:25 -05:00
trop[bot]
5e9c442b2a fix: restore window's canHide property on macOS (#48900)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: bill.shen <15865969+cucbin@users.noreply.github.com>
2025-11-13 15:24:27 -05:00
trop[bot]
c550d938c4 feat: add bypassCustomProtocolHandlers option to net.request (#48881)
* feat: add bypassCustomProtocolHandlers option to net.request

Co-authored-by: Kai <udbmnm@163.com>

* style: fix lint errors in api-protocol-spec

Co-authored-by: Kai <udbmnm@163.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kai <udbmnm@163.com>
2025-11-13 10:34:11 -05:00
trop[bot]
9f19d58510 feat: add app.isHardwareAccelerationEnabled() (#48681)
* feat: add app.isHardwareAccelerationEnabled()

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: address review feedback

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 10:33:11 -05:00
trop[bot]
41bcdd71fe fix: the parent window remained interactive after the modal window was opened (#48866)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bill Shen <15865969+cucbin@users.noreply.github.com>
2025-11-13 16:08:29 +01:00
trop[bot]
ca1b9e1c2e ci: exclude top-level docs files from full CI (#48897)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 21:06:44 +01:00
trop[bot]
a9ce0cdf52 fix: ESM-from-CJS import when CJK is in path (#48876)
* fix: ESM-from-CJS import when CJK is in path

Upstream fix: https://github.com/nodejs/node/pull/60575

Co-authored-by: Fedor Indutny <indutny@signal.org>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Fedor Indutny <indutny@signal.org>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-11 12:21:58 +01:00
Shelley Vohr
3e77a1a359 feat: enable resetting accent color (#48853) 2025-11-10 16:45:40 -05:00
trop[bot]
074cedd561 feat: Focus DevTools when breakpoint is triggered (#48701)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Michał Pichliński <michal.pichlinski@here.io>
2025-11-10 16:41:46 -05:00
trop[bot]
6140359cd3 fix: oom crash in v8 when optimizing wasm (#48817)
* fix: oom crash in v8 when optimizing wasm

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-08 10:52:10 +01:00
trop[bot]
a924f1a629 fix: CSD window frame tiles properly on Wayland (#48836)
fix: CSD window frame tiles properly on Linux

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2025-11-07 18:41:47 +01:00
trop[bot]
3d5f13a44a fix(reland): allow disabling all NSMenuItems (#48829)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: add guard for type

Co-authored-by: George Xu <george.xu@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: George Xu <george.xu@slack-corp.com>
2025-11-07 10:37:00 +01:00
trop[bot]
88a4d1c593 fix: revert allow disabling all NSMenuItems, fix menu crash (#48801)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-11-06 10:56:16 -08:00
trop[bot]
fea4fadeda build: use --keep-non-patch flag with git am (#48806)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-11-06 12:00:11 +01:00
trop[bot]
60ff1a18ac fix: draw smoothing round rect corner (#48780)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bill Shen <15865969+cucbin@users.noreply.github.com>
2025-11-05 18:26:38 -05:00
trop[bot]
4b13582af0 fix: release mouse buttons on focus loss on Wayland (#48757)
* fix: release mouse buttons on focus loss on Wayland

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* chore: update patches after trop

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-04 12:18:56 +01:00
electron-roller[bot]
3083fab4e4 chore: bump node to v22.21.1 (38-x-y) (#48615)
* chore: bump node in DEPS to v22.21.0

* chore: bump node in DEPS to v22.21.1

* chore: update patches

* lib,src: refactor assert to load error source from memory

nodejs/node#59751

* src: add percentage support to --max-old-space-size

nodejs/node#59082

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-30 17:05:42 +01:00
trop[bot]
112489328c fix: allow disabling all NSMenuItems (#48710)
fix: allow disabling all NSMenuItems

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-30 12:07:50 +01:00
trop[bot]
8f23e5a426 fix: use correct signal variable in nan-spec-runner install check (#48708)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: KinshukSS2 <kinshuk380@gmail.com>
2025-10-29 14:11:29 +01:00
trop[bot]
e308928159 ci: use <sup> in release notes generator (#48698)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-28 10:56:59 -04:00
trop[bot]
c1eb83c659 docs: add net.isOnline() to online/offline detection tutorial (#48684)
* docs: add net.isOnline() to online/offline detection tutorial

Co-authored-by: CuzImSlymi <fridolinojustin@gmail.com>

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: CuzImSlymi <fridolinojustin@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-28 08:54:08 +01:00
trop[bot]
16099b6cf5 ci: add more fields to Slack payload for backport requested message (#48687)
* ci: add more fields to Slack payload for backport requested message

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: wrap values with toJSON

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-27 19:33:04 -07:00
trop[bot]
74952bd7b4 fix: crash when inspector evaluates on provisional frames (#48513)
* fix: crash when inspector evaluates on provisional frames

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: update .patches

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:14:26 -05:00
trop[bot]
3d59235245 fix: logical bug in install.js env var handling (#48672)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 14:47:54 -04:00
trop[bot]
370a737ced docs: modify the thickFrame doc (#48678)
* doc: modify the thickFrame doc

Co-authored-by: zoy <zoy-l@outlook.com>

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

Co-authored-by: zoy <zoy-l@outlook.com>

* update format

Co-authored-by: zoy <zoy-l@outlook.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: zoy <zoy-l@outlook.com>
2025-10-27 12:51:45 -05:00
trop[bot]
6b98259971 docs: fix Ubuntu version used to build Electron (#48644)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-10-27 11:24:55 +01:00
trop[bot]
c1097edd15 feat: enable more granular a11y feature management (#48626)
* feat: enable more granular a11y feature management

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-27 11:24:23 +01:00
trop[bot]
a0be2f521d fix: crash on empty dialog extensions array on Windows (#48660)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-27 09:17:27 +01:00
trop[bot]
d14320748d docs: security.md mark 'Enable process sandboxing' as active by defau… (#48649)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

* Adjusted according to feedback

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

* Updated according to feedback - adjusted sandbox.md

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

* formatting

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

* Fixed broken markup

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

* Implemented docs linting suggestions

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Teaveloper <49181620+LeUser111@users.noreply.github.com>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Teaveloper <49181620+LeUser111@users.noreply.github.com>
2025-10-24 11:16:38 +02:00
electron-roller[bot]
e840a3f13f chore: bump chromium to 140.0.7339.249 (38-x-y) (#48569)
chore: bump chromium in DEPS to 140.0.7339.249

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-10-23 11:57:21 -04:00
trop[bot]
9008cf70f5 fix: background hover contrast for WCO buttons (#48595)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-23 16:09:53 +02:00
trop[bot]
c9c048196a fix: icon in Windows toast notification (#48630)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-22 13:55:41 +02:00
trop[bot]
955afdd92b fix: trafficLightPosition incorrect with customButtonsOnHover (#48620)
fix: trafficLightPosition incorrect with customButtonsOnHover

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-21 19:30:59 +02:00
trop[bot]
5e29e21a60 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48602)
fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490)

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2025-10-21 15:26:57 +02:00
trop[bot]
d0db2ec333 feat: dynamic ESM import in preload without context isolation (#48489)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Fedor Indutny <indutny@signal.org>
2025-10-21 07:28:25 +02:00
John Kleinschmidt
4a2f733d0a build: use one build target (#48527) (#48605)
Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-21 07:26:22 +02:00
trop[bot]
be4805afdd fix: fixed white flash on call to BrowserWindow.show (#48560)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Cezary Kulakowski <cezary@openfin.co>
2025-10-16 14:49:17 +02:00
trop[bot]
41721fc82e fix: enable shader-f16 on windows (#48555)
* fix: Enable shader-f16 on Windows

Co-authored-by: creeper-0910 <56744841+creeper-0910@users.noreply.github.com>

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

Co-authored-by: creeper-0910 <56744841+creeper-0910@users.noreply.github.com>

* fix: modified to follow the chromium dawn build configuration

Co-authored-by: creeper-0910 <56744841+creeper-0910@users.noreply.github.com>

* fix: include dxil.dll and dxcompiler.dll for windows x86

Co-authored-by: creeper-0910 <56744841+creeper-0910@users.noreply.github.com>

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc

Co-authored-by: creeper-0910 <56744841+creeper-0910@users.noreply.github.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: creeper-0910 <56744841+creeper-0910@users.noreply.github.com>
2025-10-14 23:46:01 -07:00
trop[bot]
5bc759e08d fix: auth required websocket crash (#48539)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-13 21:39:39 -07:00
electron-roller[bot]
91899aa9af chore: bump node to v22.20.0 (38-x-y) (#48381)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-13 18:10:54 +02:00
trop[bot]
4f0b4c7fa8 build: fail publish when upload fatal errors (#48547)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sam@electronjs.org>
2025-10-13 16:53:15 +02:00
trop[bot]
5b32b7b4f3 fix: unexpected openExternal dialog on macOS Tahoe (#48517)
fix: unexpected openExternal dialog on macOS Tahoe

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-13 10:13:53 +02:00
trop[bot]
e03891eec7 ci: upload build effective cache hit rate stats to Datadog (#48529)
* ci: upload build effective cache hit rate stats to Datadog

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* ci: fix release branch name in build stats script

Update branch tag logic to handle release branches.

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-11 15:54:50 -07:00
trop[bot]
af55e45ce8 fix: dialog.showMessageBox defaultid on Windows (#48519)
* fix: dialog.showMessageBox defaultid on Windows

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-11 10:02:29 +02:00
trop[bot]
d1c2d06bae docs: update Azure Trusted Signing availability (#48523)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: remove unused link

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-10-10 12:44:37 -04:00
trop[bot]
2af34b7353 fix: broken transparent window styles on resizable change (#48499)
* fix: wrong api call

Co-authored-by: zoy <zoy-l@outlook.com>

* fix: consistency of the resize state

Co-authored-by: zoy <zoy-l@outlook.com>

* fix: edge cases

Co-authored-by: zoy <zoy-l@outlook.com>

* chore: add detailed comments

Co-authored-by: zoy <zoy-l@outlook.com>

* fix: lint

Co-authored-by: zoy <zoy-l@outlook.com>

* chore: only windows

Co-authored-by: zoy <zoy-l@outlook.com>

* chore: use transparent

Co-authored-by: zoy <zoy-l@outlook.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: zoy <zoy-l@outlook.com>
2025-10-10 11:35:48 +02:00
John Kleinschmidt
54e2de4397 build: fixup chromedriver and mksnapshot (#48481)
build: fixup chromedriver and mksnapshot (#48470)

* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-09 17:34:17 -04:00
trop[bot]
d9e9ed3141 build: handle Metal toolchain being unbundled from Xcode 26 (#48473)
* chore: add metal patch dir

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: update patch

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-10-09 09:29:29 -04:00
trop[bot]
f8479ece3d docs: add note for node_modules for Yarn and pnpm (#48496)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-10-09 10:30:02 +02:00
trop[bot]
cc4712affa docs: clarify postinstall requirements (#48497)
postinstall

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-10-09 10:29:40 +02:00
electron-roller[bot]
4622f09cae chore: bump chromium to 140.0.7339.240 (38-x-y) (#48486)
* chore: bump chromium in DEPS to 140.0.7339.240

* 6978158: [m140] siso: Roll out v1.4.8

https://chromium-review.googlesource.com/c/chromium/src/+/6978158

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-08 17:02:07 -04:00
electron-roller[bot]
ad5e60274a chore: bump chromium to 140.0.7339.230 (38-x-y) (#48349)
* chore: bump chromium in DEPS to 140.0.7339.186

* chore: bump chromium in DEPS to 140.0.7339.207

* chore: update patches

* chore: bump chromium in DEPS to 140.0.7339.209

* chore: bump chromium in DEPS to 140.0.7339.214

* chore: bump chromium in DEPS to 140.0.7339.230

* chore: update patches

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-08 10:43:52 +02:00
trop[bot]
6ee299c9ee docs: recommend calling renderer process modules from preload script (#48462)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-10-04 17:23:42 -05:00
trop[bot]
4e4c156ab3 docs: clarify optional args in webFrame.executeJavaScript() (#48460)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-04 18:45:05 +02:00
trop[bot]
9c81f56f40 fix: accentColor set distinguishes the frame (#48451)
* fix: accentColor set distinguishes the frame

Co-authored-by: zoy <zoy-l@outlook.com>

* chore: invalid change

Co-authored-by: zoy <zoy-l@outlook.com>

* fix: lint

Co-authored-by: zoy <zoy-l@outlook.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: zoy <zoy-l@outlook.com>
2025-10-04 04:12:07 +02:00
trop[bot]
347fd37dfb docs: mention that webUtils should be used via preload script (#48454)
docs: mention that webUtils should be used via preload script (#45861)

* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion



* docs: apply suggestion



* docs: apply suggestion



* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kaiichiro Ota <kigh.ota@gmail.com>
2025-10-03 15:48:06 -05:00
trop[bot]
f6238586d4 fix: runtime JS error that crashes GetPackageJSON (#48424)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Fedor Indutny <indutny@signal.org>
2025-10-03 19:03:18 +02:00
BILL SHEN
6dc3923b93 fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48409)
fix: add missed SaveRequestType enum to PdfViewerPrivate function

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
2025-10-03 10:59:30 -05:00
trop[bot]
074d0e19fb docs: update allowed window.open options (#48444)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-10-02 20:58:09 -05:00
trop[bot]
7e089f65c1 fix: snapped window restoring to correct position (#48437)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-03 00:12:03 +02:00
trop[bot]
ad8686f7d7 docs: fix formatting in asar integrity (#48433)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-10-01 23:41:11 -07:00
trop[bot]
48c0f561ff build: add missing copied tarball to cloudstore paths (#48415)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sam@electronjs.org>
2025-09-30 18:36:20 +02:00
trop[bot]
81db417caa fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48398)
fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)

fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: avarayr <7735415+avarayr@users.noreply.github.com>
2025-09-27 16:16:33 -07:00
trop[bot]
5dfeee6b55 fix: disable NSAutoFillHeuristicController on macOS 26 (#48394)
* fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: update .patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Robo <hop2deep@gmail.com>
2025-09-27 14:53:42 -07:00
John Kleinschmidt
2982cd77f0 test: rerun failed tests individually (#48387)
* test: rerun failed tests individually

* rerun test up to 3 times

* test: fixup navigationHistory flake

(cherry picked from commit fa6431c368)
2025-09-27 10:32:10 -07:00
trop[bot]
3179f61bc1 fix: set ozone platform for wayland (#48309)
* fix: set ozone platform for wayland

Co-authored-by: clavin <clavin@electronjs.org>

* whoops, includes. thx charles

Co-authored-by: clavin <clavin@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-09-25 15:22:16 -04:00
John Kleinschmidt
526dfe2577 build: update build tools to get siso for forks fix (#48345) (#48350) 2025-09-25 13:19:43 -04:00
trop[bot]
cf9d0448be feat: add fileSystem to ses.setPermissionCheckHandler (#48327)
feat: add fileSystem to ses.setPermissionCheckHandler

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-24 13:10:33 -04:00
trop[bot]
99feff3965 docs: mention setContentProtection macOS limitations (#48367)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-09-23 17:04:13 -05:00
Keeley Hammond
d60ae17998 chore: cherry-pick ec6c18478382 from v8 (#48337)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches

* chore: update patches post-rebase
2025-09-16 23:24:49 -07:00
trop[bot]
f43348e75c ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48323)
cleanup

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-16 09:52:34 -04:00
electron-roller[bot]
5e51c882ee chore: bump chromium to 140.0.7339.133 (38-x-y) (#48287)
* chore: bump chromium in DEPS to 140.0.7339.133

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-12 10:18:12 -04:00
trop[bot]
8cd29d24b1 docs: update release timeline for unsupported v35 (#48286)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Michaela Laurencin <35157522+mlaurencin@users.noreply.github.com>
2025-09-09 15:50:16 -07:00
electron-roller[bot]
35639ad801 chore: bump node to v22.19.0 (38-x-y) (#48221)
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-09-08 11:25:24 +02:00
electron-roller[bot]
2d397883a5 chore: bump chromium to 140.0.7339.80 (38-x-y) (#48249)
chore: bump chromium in DEPS to 140.0.7339.80

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-09-04 17:25:44 -04:00
trop[bot]
79433861fe fix: BrowserWindow add the same BrowserView (#48201)
fix: BrowserWindow add the same BrowserView (#48057)

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Zonglong Liu <83216456+mai-121@users.noreply.github.com>
2025-09-02 16:56:04 -04:00
trop[bot]
a7335142a4 fix: file-only picker incorrectly allowing some directories (#48231)
* fix: file-only picker incorrectly allowing some directories

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* build: remove chore patch for Electron objects

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-09-02 13:50:33 -07:00
trop[bot]
d5907878bc fix: showMessageDialog should center dialog to parent (#48215)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-01 14:56:47 -07:00
trop[bot]
0098160f2a fix: ensure dragging works again after emitting contextmenu event (#48224)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-29 13:15:17 -04:00
electron-roller[bot]
207f64fec8 chore: bump chromium to 140.0.7339.41 (38-x-y) (#48190)
* chore: bump chromium in DEPS to 140.0.7339.41

* chore: update patches

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-28 16:39:10 -04:00
BILL SHEN
441cff700b feat: add fileBacked and purgeable fields to process.getSystemMemoryInfo() for macOS (#48146)
feat: add fileBacked and purgeable fields to process.getSystemMemoryInfo() for macOS
2025-08-28 10:57:06 -07:00
trop[bot]
9eede35fc1 build: refactor Linux binary stripping to align with upstream (#48197)
build: refactor Linux binary stripping to align with upstream (#47932)

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-08-28 10:51:07 -07:00
trop[bot]
6812b13161 docs: fix some module headings (#48195)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-08-28 10:25:13 +02:00
trop[bot]
a64175ff1c ci: use free GH arm runners (#48187)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-27 15:44:58 -04:00
trop[bot]
b34e618285 docs: add release timeline for Electron 39 (#48176)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-26 15:08:31 -07:00
trop[bot]
818743493d build: use siso instead of reclient (#48154)
* build: use siso instead of reclient

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* build: remove no longer needed arg for siso

* build: fix ffmpeg build with siso

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-25 16:46:51 -04:00
trop[bot]
9e631b62d8 fix: snapped restoration after minimization (#48157)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-25 13:22:28 +02:00
trop[bot]
f28d08ad86 refactor: use XmlWriter for Windows toasts (#48130)
refactor: use XmlWriter for Windows toasts

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-22 14:38:13 -04:00
trop[bot]
0c2271a515 fix: net.isOnline always true in utility processes (#48151)
* fix: net.isOnline always true in utilityProcesses

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Update shell/services/node/node_service.cc

Co-authored-by: Robo <hop2deep@gmail.com>

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-22 11:18:58 -04:00
electron-roller[bot]
cc67728226 chore: bump chromium to 140.0.7339.24 (38-x-y) (#48147)
* chore: bump chromium in DEPS to 140.0.7339.24

* chore: update patches

* Track DevTools feature usage in new badge tracker

https://chromium-review.googlesource.com/c/chromium/src/+/6842401

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-22 14:30:23 +02:00
trop[bot]
1a38293926 build: use new 7z command line switch (#48139)
-snld20 replaces -snld

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-21 09:44:04 -04:00
trop[bot]
2cb262b280 build: fixup docs only condition (#48134)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-20 17:48:04 -04:00
Shelley Vohr
20a563c27d feat: allow macOS tray to maintain position (#48077) 2025-08-20 13:03:54 -04:00
trop[bot]
aa022ce30e build: get source cache for docs only pipeline (#48127)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-20 09:35:52 -04:00
electron-roller[bot]
fead821311 chore: bump chromium to 140.0.7339.16 (38-x-y) (#48075)
* chore: bump chromium in DEPS to 140.0.7339.16

* chore: update patches

* Remove ELECTRON_OZONE_PLATFORM_HINT env var

6819616: Remove OzonePlatformHint | https://chromium-review.googlesource.com/c/chromium/src/+/6819616

See: https://github.com/electron/electron/issues/48001
(cherry picked from commit d9dad43050)

* Remove `DESKTOP_STARTUP_ID` code

This was removed upstream in https://chromium-review.googlesource.com/c/chromium/src/+/6819616 and I confirmed with the author that it was an intentional change. Going to mirror upstream and remove it here too.

(cherry picked from commit 8fffb83c11)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-19 21:04:49 -04:00
trop[bot]
37b5a62daa fix: system accent color parsing hex order (#48108)
fix: system accent color parsing

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-19 12:45:57 +02:00
trop[bot]
3e0378340e fix: avoid deprecated login item methods (#48094)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2025-08-19 12:45:49 +02:00
Keeley Hammond
2e5a0b7220 fix: ensure snapshot is valid (#48102)
* feat: add support for embedder snapshot validation

* fix: cpp lint
2025-08-18 14:37:21 -07:00
trop[bot]
a6b0d27bb7 fix: shell.openPath should be non-blocking (#48089)
fix: shell.openPath should be non-blocking

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-17 20:19:09 +02:00
trop[bot]
114a3b3971 build: use quick tunnels for ssh debugging (#48071)
* build: use dynamic local tunnels for ssh debugging

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* weeee

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* that'll do

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* chore: pretty output

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* build: allow ssh input

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-08-16 09:38:28 +02:00
trop[bot]
641f60619f fix: app.accessibilitySupportEnabled (#48060)
fix: app.accessibilitySupportEnabled on macOS

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-14 11:06:46 +02:00
trop[bot]
a130d4ebfe fix: re-entrancy issues in webContents.loadURL() (#48043) 2025-08-12 13:41:47 +02:00
trop[bot]
cea5034019 build: drop @types/webpack-env in favor of webpack/module types (#48015)
* build: drop @types/webpack-env in favor of webpack/module types

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: improve type when assigning to global.require

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-08-12 11:11:56 +02:00
Calvin
095ae30f6d chore: bump chromium to 140.0.7339.2 (38-x-y) (#47985)
chore: bump chromium to 140.0.7339.2 (main) (#47929)

* chore: bump chromium in DEPS to 140.0.7330.0

* chore: bump chromium in DEPS to 140.0.7331.0

* chore: update patches

* fix: gn check failing on crashpad.h
Not yet sure what caused this

* fix: predictors::PreconnectManager -> content::PreconnectManager
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* chore: bump chromium in DEPS to 140.0.7333.0

* chore: bump chromium in DEPS to 140.0.7335.0

* chore: bump chromium in DEPS to 140.0.7337.0

* chore: update patches

* chore: restore some gin utility

* 6804057: [Extensions] Validate nodoc is specified as a boolean in schemas
https://chromium-review.googlesource.com/c/chromium/src/+/6804057

* fixup! chore: restore some gin utility

* fixup! fix: predictors::PreconnectManager -> content::PreconnectManager CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected
https://chromium-review.googlesource.com/c/chromium/src/+/6772346

Not certain about what the "correct" argument to pass here is. A quick dive into the CL suggests that passing `false` is safe to keep things working. The blast radius if this assumption is wrong is that "fling" scroll gestures may not work as expected with the OSR.

* 6789383: Uninstall SODA language pack after 30 days of inactivity
https://chromium-review.googlesource.com/c/chromium/src/+/6789383

* chore: update libcxx filenames

* chore: bump chromium in DEPS to 140.0.7339.0

* chore: update patches

* fixup! 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected https://chromium-review.googlesource.com/c/chromium/src/+/6772346

* chore: bump chromium in DEPS to 140.0.7339.2

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-08-11 16:01:08 -04:00
trop[bot]
35b3d25ee1 docs: deprecate ELECTRON_OZONE_PLATFORM_HINT env var (#48028)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-11 09:43:30 +02:00
trop[bot]
03a14844b1 fix: importing from electron/utility in ESM (#48019)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-08-11 09:42:56 +02:00
Calvin
fffe214702 ci: update llvmobjdump package as part of fix sync (#48029)
ci: update llvmobjdump package as part of fix sync (#47858)
2025-08-10 21:08:14 -07:00
Calvin
bc56c6987f fix: offscreen mode under window.open creation (#48026)
fix: offscreen mode under `window.open` creation (#47868)

fix: offscreen mode under new window creation

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-10 21:55:40 +02:00
Calvin
e3f358a45a chore: move gin::Handle to gin_helper (#48016)
chore: move gin::Handle to gin_helper (#47959)

* chore: move gin::Handle to gin_helper

* chore: fix lint

Co-authored-by: Robo <hop2deep@gmail.com>
2025-08-10 21:46:37 +02:00
trop[bot]
89d5b6cd5b ci: cleanup use new arc cluster (#48009)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-09 09:46:37 +02:00
Calvin
4fff74b73e chore: move gin::DeprecatedWrappable to gin_helper (#47996)
chore: move gin::DeprecatedWrappable to gin_helper (#47958)

* chore: move gin::DeprecatedWrappable to gin_helper

This is in preparation for migrating to gin::Wrappable
based on cppgc #47922
The upstream class will be deleted soon via roller PR but
the cppgc migration should happen outside the roll, this
change retains the current functionality by copying the
implementation into //electron/shell/common/gin_helper.
The class can be deleted once the cppgc migration is complete.

* chore: fix lint:cpp

Co-authored-by: Robo <hop2deep@gmail.com>
2025-08-09 13:00:45 +09:00
trop[bot]
74ad696f98 refactor: replace webFrame.routingId with sync IPC (#47941)
* refactor: replace webFrame.routingId with sync IPC

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: GetConstructor missing isolate

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: missing isolate

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-08-08 10:55:05 +02:00
trop[bot]
d05f99ff4c fix: compilation error when disabling extensions and pdf_viewer (#47993)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Jinli Wu <wujinli@bytedance.com>
2025-08-07 16:49:37 -04:00
trop[bot]
f6a2c13740 fix: allow importing from electron/utility at runtime (#47989)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-08-07 12:12:42 +02:00
trop[bot]
433f9f5e8c feat: Use DIR_ASSETS path to locate resource bundles (#47950)
* feat: Use DIR_ASSETS path to locate resource bundles

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* Use DIR_ASSETS for calculating ASAR relative paths

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* Add test to verify 'assets' matches parent dir of 'exe'

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* Add Mac-specific test for assets path (but it is failing)

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* test: Update app.getPath('assets') to expect an exception on Mac

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* docs: Update docs for 'assets' path to indicate that it's only available on Windows + Linux

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* fix: Don't define 'assets' mapping on macOS

Co-authored-by: Will Anderson <andersonw@dropbox.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Will Anderson <andersonw@dropbox.com>
2025-08-06 19:40:11 +02:00
trop[bot]
a7b6145f3b feat: webFrameMain.fromFrameToken (#47942)
* feat: webFrameMain.fromFrameToken

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* refactor: return null instead of undefined

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* docs: mention renderer webFrame property

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: undo null->undefined in wfm.fromId api this will be updated in another pr

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-08-06 19:39:56 +02:00
trop[bot]
f3774d578d feat: add {get|set}AccentColor on Windows (#47939)
* feat: add setAccentColor on Windows

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* refactor: unify GetSystemAccentColor

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* refactor: remove redundant parsing

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup documentation

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Update docs/api/browser-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Update docs/api/base-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-06 19:39:18 +02:00
trop[bot]
33f4808182 feat: add app.getRecentDocuments() (#47924)
feat: add app.getRecentDocuments()

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-06 19:35:04 +02:00
trop[bot]
eb02db5185 test: add TS smoke test for electron/utility (#47976)
chore: add TS smoke test for electron/utility

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-08-06 14:47:42 +02:00
trop[bot]
c3f64712de refactor: avoid deprecated v8::Context::GetIsolate() pt 4 (#47973)
* refactor: remove GetIsolate() calls from SetPrivate()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: remove excess GetIsolate() calls in PassValueToOtherContextInner()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: remove GetIsolate() calls from GetPrivate()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* local to ProxyFunctionWrapper()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: remove error_context->GetIsolate() call from PassValueToOtherContextInner()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: remove GetIsolate() call from ProxyFunctionWrapper()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass source and destination isolate as arg to CreateProxyForAPI()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-08-05 23:32:50 -05:00
trop[bot]
df6ad9c970 chore: bump chromium to 140.0.7327.0 (38-x-y) (#47930)
* chore: bump chromium in DEPS to 140.0.7324.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 140.0.7325.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: remove @dsanders11's unused include patch CL: https://chromium-review.googlesource.com/c/chromium/src/+/6782507

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: update chromium patches

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: update other patches

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: bump chromium in DEPS to 140.0.7327.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* fix: mistake in reapplied patch

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: update patches

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: remove OnPrivateNetworkAccessPermissionRequired override CL: https://chromium-review.googlesource.com/c/chromium/src/+/6769208

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: update colorSpace property to use new unified value CL: https://chromium-review.googlesource.com/c/chromium/src/+/6795085

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: include OverlayWindowLiveCaptionButton CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787420

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: format chromium_src/BUILD.gn CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: format BUILD.gn CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: include script/ in logged path

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* fix: update filenames.libcxx.gni CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787279

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-05 21:45:37 -04:00
trop[bot]
729a67d0d7 fix: video scrubbing on playback (#47965)
* fix: fix video scrubbing on playback

Co-authored-by: VerteDinde <keeleymhammond@gmail.com>

* chore: address review feedback

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: VerteDinde <keeleymhammond@gmail.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-05 15:09:23 -07:00
electron-roller[bot]
ecf905decb chore: bump node to v22.18.0 (38-x-y) (#47936)
chore: bump node to v22.18.0 (main) (#47937)

* chore: bump node in DEPS to v22.18.0

* crypto: fix inclusion of OPENSSL_IS_BORINGSSL define

https://github.com/nodejs/node/pull/58845

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58960

* permission: propagate permission model flags on spawn

https://github.com/nodejs/node/pull/58853

* esm: syncify default path of ModuleLoader\.load

https://github.com/nodejs/node/pull/57419

* src: remove fast API for InternalModuleStat

https://github.com/nodejs/node/pull/58489

* src: simplify adding fast APIs to ExternalReferenceRegistry

https://github.com/nodejs/node/pull/58896/

* chore: fixup patch indices

* src: fix internalModuleStat v8 fast path

https://github.com/nodejs/node/pull/58054

* test: add tests to ensure that node.1 is kept in sync with cli.md

https://github.com/nodejs/node/pull/58878

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58942

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-05 18:30:41 +02:00
trop[bot]
4fea51017f fix: crash on window.close() with webContents on blur (#47952)
fix: crash on window.close with WebContentsView on blur

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-04 14:28:35 +02:00
trop[bot]
d3059897ed build: roll build-images to 933c7d6 (#47928)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-31 22:43:47 +02:00
trop[bot]
f2d14ca29d refactor: avoid deprecated v8::Context::GetIsolate() calls pt 3 context get isolate pt 3 (#47910)
* refactor: add a v8::Isolate* arg to RendererClientBase::IsWebViewFrame()

Needed for creating gin dictionaries

refactor: add a v8::Isolate* arg to ShouldLoadPreload()

Needed for calling IsWebViewFrame()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to electron::util::CompileAndCall()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to OnCreatePreloadableV8Context()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to InvokeEmitProcessEvent()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to ServiceWorkerData's constructor

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to RendererClientBase::SetupMainWorldOverrides()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to RendererClientBase::WilLReleaseScriptContext()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* docs: update docs to avoid v8::Context::GetIsolate()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to ElectronSandboxedRendererClient::InitializeBindings()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: avoid v8::Context::GetIsolate() call in PromiseBase::SettleScope::~SettleScope()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-07-31 14:19:10 -05:00
trop[bot]
9b1dfe90f4 fix: dark mode on Linux default themeing (#47919)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-31 14:29:43 +02:00
trop[bot]
a41ca28b63 fix: window content protection on older Windows versions (#47886)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-31 10:53:15 +02:00
trop[bot]
8841e4be83 ci: use new arc cluster (#47912)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-07-30 16:32:33 -04:00
trop[bot]
5c83e2b00c ci: add ability to debug SSH sessions in CI (#47874)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-30 11:43:26 -07:00
trop[bot]
7930f4a20c chore: bump chromium to 140.0.7314.0 (38-x-y) (#47903)
* chore: bump chromium in DEPS to 140.0.7314.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6632993: PDF Searchify IPH: Use embedder WebContents for GuestView PDF

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6632993

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6769214: [ios blink] Set IOSurface shared memory region on all GMB handles

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769214

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6769572: [soft navs]: Move AsyncSameDocumentNavigationStarted to TaskAttributionTracker

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769572

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: node gen-libc++-filenames.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6765740: [SxS] Implement support for split view in extensions API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765740

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-29 11:00:54 -04:00
trop[bot]
3fefa06d34 refactor: prefer GetCreationContextChecked(v8::Isolate*) over GetCreationContextChecked() (#47890)
* refactor: pass an isolate when calling GetCreationContextChecked() in V8FunctionInvoker

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in RendererClientBase

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::Completed()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::CopyResultToCallingContextAndFinalize()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in gin_helper::internal::CallMethodWithArgs()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalPropertyFromIsolatedWorld()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalValueFromIsolatedWorld()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in ProxyFunctionWrapper()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: pass an isolate when calling GetCreationContextChecked() in PassValueToOtherContextInner()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* fixup! refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-07-29 10:37:29 -04:00
trop[bot]
e1e12318e2 refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 2) (#47896)
* refactor: add a v8::Isolate* arg to Constructible::GetConstructor()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add a v8::Isolate* arg to NodeBindings::Initialize()

This is needed for the GetConstructor() call

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: avoid v8::Context::GetIsolate() call in GetIpcObject() by taking it as an arg

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: avoid v8::Context::GetIsolate() call in ipc_native::EmitIPCEvent() by taking it as an arg

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-07-29 10:34:18 -04:00
trop[bot]
edccb0a7ea chore: bump chromium to 140.0.7312.0 (38-x-y) (#47881)
* chore: bump chromium in DEPS to 140.0.7312.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 6769540: Move NetworkTrafficAnnotationTag out of PreconnectManager.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769540

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6771377: Roll libc++ from 3eda1e62e799 to 569aa83b4bbc (7 revisions)

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771377

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6771398: Remove unnecessary std::optional wrappers in ResolveHostClient

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771398

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6776165: Use shared session bus for MPRIS

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6776165

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-24 09:33:14 -04:00
trop[bot]
83373c3679 fix: webContents.downloadURL() did not support referer header (#47867)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: xufuhang <576484918@qq.com>
2025-07-23 16:45:45 +02:00
trop[bot]
9c4d783d1f chore: bump chromium to 140.0.7309.0 (38-x-y) (#47863)
* chore: bump chromium in DEPS to 140.0.7309.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 6762172: Replace MSG_ROUTING_NONE with IPC::mojom::kRoutingIdNone.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6762172

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6759543: [exit-time-destructors] Exclude target with warnings

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759543

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6765167: Split PreconnectManager into interface and implementation.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765167

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6766775: [media] Clarify coded and visible size in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6766775

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6760878: Move PreconnectRequest to //content/public

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6760878

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6718973: Implement media playback trust check for the video PiP overlay window

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6718973

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: add missing include of <iterator> in ada

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: node gen-libc++-filenames.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 6759633: [media] Use format from shared image in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759633

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-23 10:12:00 +02:00
trop[bot]
139ab00d8c build: improve check-zip-manifest (#47852)
* build: improve check-zip-manifest

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: unicode on Windows

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-22 09:50:38 +02:00
trop[bot]
124bfd25f8 chore: bump chromium to 140.0.7301.0 (38-x-y) (#47849)
* chore: bump chromium in DEPS to 140.0.7296.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6702959: Remove OwnedByWidgetPassKey usage from content analysis dialog tests | https://chromium-review.googlesource.com/c/chromium/src/+/6702959

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6722750: Remove un-used `stream_id` argument for `AidaCodeComplete` | https://chromium-review.googlesource.com/c/chromium/src/+/6722750

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6696478: Reland Reland [video pip] Add fade in/out animation to controls visibility changes | https://chromium-review.googlesource.com/c/chromium/src/+/6696478

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: update libc++-filenames

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* build: explicitly include cstdlib in Boyer-Moore patch

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: bump chromium in DEPS to 140.0.7297.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6729537: [FPF] Pipe flag state from the browser to the renderer | https://chromium-review.googlesource.com/c/chromium/src/+/6729537

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6727996: [Win] Detect pre-IPC crashes in sandboxed utility processes | https://chromium-review.googlesource.com/c/chromium/src/+/6727996

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6707182: Move wtf/cross_thread_copier*.* to "blink" namespace | https://chromium-review.googlesource.com/c/chromium/src/+/6707182

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: bump chromium in DEPS to 140.0.7299.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>

* chore: update main patches

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: reset the minimum macOS SDK to 15 to match upstream

This reverts commit 499e987c77.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6730215: Remove IPC_MESSAGE_LOG_ENABLED ifdef blocks. | https://chromium-review.googlesource.com/c/chromium/src/+/6730215

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6690442: Delete ppapi/buildflags/buildflags.h | https://chromium-review.googlesource.com/c/chromium/src/+/6690442

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: bump chromium in DEPS to 140.0.7301.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6656309: extensions: Port proxy API to desktop Android | https://chromium-review.googlesource.com/c/chromium/src/+/6656309

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6758510: Reland 'Move GN enable_plugins variable out of //ppapi' | https://chromium-review.googlesource.com/c/chromium/src/+/6758510

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6735979: [FSA] Replace `request_writable` with a new enum `FileSystemAccessPermissionMode`. | https://chromium-review.googlesource.com/c/chromium/src/+/6735979

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6712080: Reland "Turn on gender translation PAK generation everywhere" | https://chromium-review.googlesource.com/c/chromium/src/+/6712080

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: restore minimum macOS SDK to 10, restore patch

This reverts commit a04c579b99.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fixup! 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: correct node patches

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* fixup! 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-21 11:55:08 -07:00
trop[bot]
d5ce459cea build: fix ffmpeg generation on Windows non-x64 (#47844)
* build: fix ffmpeg generation on Windows non-x64

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: ffmpeg artifact

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-21 20:30:34 +02:00
trop[bot]
ea0773c7c7 fix: dialog file filters and macOS app bundles (#47841)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-21 19:44:16 +02:00
trop[bot]
d426b92326 refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 1) (#47843)
* refactor: avoid redundant GetIsolate() calls in NodeBindings::CreateEnvironment()

Xref: https://chromium-review.googlesource.com/c/v8/v8/+/6563615

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: use v8::Isolate::GetCurrent() in Initialize() methods

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: add v8::Isolate* arg to RendererClientBase::DidCreateScriptContext()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* fixup! refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* fixup! fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

refactor: prefer JavascriptEnvironment::GetIsolate() in the browser layer

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-07-21 13:12:24 -04:00
trop[bot]
673ec5d39e fix: window accentColor should adhere to native window behavior (#47802)
* fix: window accentColor should adhere to native window behavior

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: address review feedback

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove duplicate UpdateWindowAccentColor call in ctor

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-21 12:37:01 +02:00
trop[bot]
bfdc318d56 ci: remove kTCCServiceMicrophone change (#47823)
ci: remove kTCCServiceMicrophone change

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-18 16:37:33 -04:00
trop[bot]
41093c5ba6 build: update codespace on-create-command (#47820)
build: update codespace on-create-command

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-18 15:22:08 -04:00
electron-roller[bot]
22d6210c3c chore: bump node to v22.17.1 (38-x-y) (#47775)
* chore: bump node in DEPS to v22.17.1

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-18 14:45:35 +02:00
trop[bot]
b20e91d86f fix: abnormal behavior of windows background material (#47814)
* fix: abnormal behavior of windows background material

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

Co-authored-by: zoy <zoy-l@outlook.com>

* chore: update patches

Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>

* fix: setting background material after init

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: zoy <zoy-l@outlook.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-18 10:30:37 +02:00
trop[bot]
658d52ecf1 test: re-enable native module tests (#47805)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-17 21:52:20 +02:00
trop[bot]
53c17ea4f5 build: deep update brace-expansion to resolve an audit alert (#47720)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-17 11:40:53 -04:00
trop[bot]
71af3e452f build(dev-deps): drop unused @types/webpack dep (#47809)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-17 11:37:28 -04:00
trop[bot]
5081fbe830 fix: handle missing NativeWindowMac in ElectronNSWindow (#47812)
fix: handle missing NativeWindowMac in ElectronNSWindow

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-17 11:33:25 -04:00
trop[bot]
a4a12fb35a test: fix extensions console flake (#47791)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-17 11:04:06 +02:00
trop[bot]
564698e27f test: cleanup RenderFrame lifespan tests (#47797)
* test: cleanup RenderFrame lifespan tests

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* test: disable navigator.serial tests on arm64 mac

debug the hang

test: disable navigator.bluetooth on arm64 mac

Revert "test: disable navigator.bluetooth on arm64 mac"

This reverts commit 4b53a8485a5ff391832c7da93d859f1aa8722e70.

Revert "debug the hang"

This reverts commit 00338f0d49a7918224822087b4510fa9db0686c3.

Revert "test: disable navigator.serial tests on arm64 mac"

This reverts commit fb515ce447a9d42185e84b17b460e4fb6d1bf71d.

Reapply "test: disable navigator.serial tests on arm64 mac"

This reverts commit 0e5608108ffebbe8b8b27af9ea06aadae2ea85dd.

Reapply "test: disable navigator.bluetooth on arm64 mac"

This reverts commit f4c7d3fc0624a22421cba5d3d75df8c5d4367eea.

fixup

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* test: add waitUntil for flaky test

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-07-17 11:03:34 +02:00
trop[bot]
280f643862 docs: add Menu module tutorials (#47761)
* docs: add `Menu` module tutorials

* link API docs to new tutorials

* removed unreferenced fiddles

* add wording for new types

* fix import sort errors

* delete accelerator.md

* fixes

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-07-16 12:20:08 -07:00
trop[bot]
e2689400aa fix: deprecation warning crash when no Node.js environment available (#47769)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-16 12:19:33 -07:00
trop[bot]
f37f8d41c0 fix: corner smoothing feature gate crash (#47785)
* fix: corner smoothing feature gate crash

Co-authored-by: clavin <clavin@electronjs.org>

* Fix ElectronCornerSmoothing::CSSValueFromComputedStyleInternal

Co-authored-by: clavin <clavin@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-07-16 12:15:53 -07:00
trop[bot]
7d83554d0e test: deflake clipboard read/write specs (#47787)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-16 11:35:47 -07:00
trop[bot]
8924d682be fix: add macos memory query fallback patch to avoid crash (#47783)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-07-16 11:34:28 -07:00
trop[bot]
d6c5642155 docs: fix broken sentence in crashReporter.start() documentation (#47778)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Pratyush <116508117+pratstick@users.noreply.github.com>
2025-07-16 15:58:16 +02:00
trop[bot]
789b4b026a fix: missing SQLite builtin support in Node.js (#47757)
https://github.com/nodejs/node/pull/58122

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-16 15:05:23 +02:00
trop[bot]
44bd560068 docs: improve win.setContentProtection() docs (#47763)
* docs: improve win.setContentProtection() docs

Co-authored-by: Milan Burda <milan.burda@gmail.com>

* docs: update Windows display affinity value

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: update Windows behavior description

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Revert "docs: update Windows behavior description"

This reverts commit 6d1942c53a.

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Revert "docs: update Windows display affinity value"

This reverts commit c15363e75d.

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Milan Burda <milan.burda@gmail.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-07-15 16:54:21 -07:00
electron-roller[bot]
2783f76f1f chore: bump chromium to 140.0.7281.0 (38-x-y) (#47559)
* chore: bump chromium in DEPS to 139.0.7258.6

* chore: bump chromium in DEPS to 139.0.7258.5

* chore: bump chromium in DEPS to 140.0.7270.1

* chore: bump chromium in DEPS to 140.0.7271.1

* chore: bump chromium in DEPS to 140.0.7273.0

* chore: bump chromium in DEPS to 140.0.7273.1

* chore: bump chromium in DEPS to 140.0.7275.1

* chore: bump chromium in DEPS to 140.0.7275.4

* chore: bump chromium in DEPS to 140.0.7277.1

* chore: bump chromium in DEPS to 140.0.7279.1

* chore: bump chromium in DEPS to 140.0.7281.1

* chore: bump chromium in DEPS to 140.0.7283.1

* chore: bump chromium in DEPS to 140.0.7285.1

* chore: bump chromium in DEPS to 140.0.7287.1

* chore: bump chromium in DEPS to 140.0.7289.0

* chore: bump chromium in DEPS to 140.0.7289.1

* chore: bump chromium in DEPS to 140.0.7291.1

* chore: bump chromium in DEPS to 140.0.7293.1

* chore: bump chromium in DEPS to 140.0.7295.1

* chore: bump chromium in DEPS to 140.0.7296.0

* chore: bump chromium to 140.0.7281.0 (main) (#47616)

cherry picked from 603cafad7e

* chore: bump chromium in DEPS to 140.0.7269.2

* chore: bump chromium in DEPS to 140.0.7270.0

* chore: bump chromium in DEPS to 140.0.7271.0

* chore: bump chromium in DEPS to 140.0.7273.0

* 6516731: [ExclusiveAccessForAndroid] remove unneeded includes & deps | https://chromium-review.googlesource.com/c/chromium/src/+/6516731

* 6694809: dbus: Ensure systemd scope is started before using any portal services | https://chromium-review.googlesource.com/c/chromium/src/+/6694809

* chore: patch chromium

* chore: export patches

* chore: bump chromium in DEPS to 140.0.7275.0

* 6677511: [pepper] More pepper removal | https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: export chromium patches

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: bump chromium in DEPS to 140.0.7277.0

* chore: bump chromium in DEPS to 140.0.7279.0

* chore: bump chromium in DEPS to 140.0.7281.0

* 6677314: Plumb enabled client hints in the network requestion to network layer

https://chromium-review.googlesource.com/c/chromium/src/+/6677314

* 6351556: [source-phase-imports] Support Wasm Source Phase Imports

https://chromium-review.googlesource.com/c/chromium/src/+/6351556

* 6700077: [renderer] Avoid calls to deprecated GetIsolate methods

https://chromium-review.googlesource.com/c/chromium/src/+/6700077

* 6692873: Reland "Reland "FSA: Only normalize the hardcoded rules once during initialization""

https://chromium-review.googlesource.com/c/chromium/src/+/6692873

* 6686234: [gin] Cleanup NamedPropertyInterceptor for Wrappable

https://chromium-review.googlesource.com/c/chromium/src/+/6686234

* chore: export patches

* 6667723: Remove content_enable_legacy_ipc GN arg.

https://chromium-review.googlesource.com/c/chromium/src/+/6667723

* 6646566: ui: Move NativeWindowTracker to its own directory

https://chromium-review.googlesource.com/c/chromium/src/+/6646566

* fix: add missing includes

* 6580522: [WAR, DNR] Fix unsafe redirect error to web accessible resource

https://chromium-review.googlesource.com/c/chromium/src/+/6580522

* 6680477: Implement `completeCode` endpoint and expose to DevTools

https://chromium-review.googlesource.com/c/chromium/src/+/6680477

* 6677511: [pepper] More pepper removal

https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6696689: Rename views::WidgetFocusManager -> NativeViewFocusManager

https://chromium-review.googlesource.com/c/chromium/src/+/6696689

* 6702812: Move wtf/text/string_impl*.* to "blink" namespace

https://chromium-review.googlesource.com/c/chromium/src/+/6702812

* chore: fix dialog patch

* 6702431: [animation-trigger] Parse timeline-trigger-name

https://chromium-review.googlesource.com/c/chromium/src/+/6702431

* chore: fixup patch indices

* feat: replace webFrame.routingId with webFrame.frameToken

* feat: WebFrameMain.prototype.frameToken

* test: refactor to use replacement APIs

* chore: fixup pip patch

* test: adjust webFrame tests for frameToken changes

* 6703757: Reland "Enable -fsanitize=array-bounds in non-UBSan builds"

https://chromium-review.googlesource.com/c/chromium/src/+/6703757

* test: switch to frameTokens

* test: routingId is fine to test in the main process

* docs: add routingId to breaking changes

* docs: update plugin-crashed event

* chore: fixup linux dialog patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
(cherry picked from commit 603cafad7e)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-15 12:05:29 -04:00
trop[bot]
96957aebf3 test: add response to bluetooth request possibilities (#47743)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-15 13:49:45 +02:00
trop[bot]
e8c3b6fe66 ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK (#47742)
ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-15 11:33:07 +02:00
trop[bot]
58e0a96d21 ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors (#47737)
ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-14 11:45:37 +02:00
trop[bot]
b136dbc4cc build: cleanup symlinks in cache (#47733)
* build: cleanup symlinks in cache

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* build: ignore broken links

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* try --ignore-failed-read

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* build: dont deref symlinks

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* build: add flag to 7zip to resolve symlink error

Needed to ignore Dangerous symbolic link path was ignored errors

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Revert "build: cleanup symlinks in cache"

This reverts commit 69e53cdc88.

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-07-13 12:24:59 +02:00
trop[bot]
2efd448a87 refactor: use dbus_thread_linux::GetSharedSessionBus() (#47707)
refactor: use dbus_thread_linux::GetSharedSessionBus()

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-12 09:54:03 +02:00
trop[bot]
31e6800314 ci: set git core.longpaths to true (#47714)
ci: set git core.longpaths to true

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-11 15:56:10 +02:00
trop[bot]
f1fef462c0 build: reenable v8_enable_temporal_support (#47715)
* build: reenable v8_enable_temporal_support

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* ci: test with increased vm map count

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: backport PA use fewer vmas by default on linux

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: update patches

Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>

* Revert "ci: test with increased vm map count"

This reverts commit b626c9a5ab7ad3f01e17d77c330abfd8096a8b02.

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* ci: remove logs

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-11 09:52:43 +02:00
trop[bot]
e08f057e91 docs: update build prerequisites (#47696)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-09 12:31:52 +02:00
trop[bot]
f97bee6f04 build: drop eslint-plugin-unicorn (#47686)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-08 18:18:37 +02:00
trop[bot]
0b77096f2a fix: default to system accent color on invalid user color (#47684)
fix: default to system accent color on invalid user color"

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-08 15:21:44 +02:00
trop[bot]
130f00dfcd fix: fullscreen for windows without rounded corners (#47681)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-08 15:21:13 +02:00
trop[bot]
3a6d7e0c22 refactor: avoid a few unnecessary strings (#47655)
* perf: replace string temporary with string_view in GetXdgAppId()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* perf: replace string temporary with string_view in ToV8(WindowOpenDisposition)

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* perf: replace string temporary with string_view in ToV8(electron::api::WebContents::Type)

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-07-04 10:58:50 +02:00
trop[bot]
7907443448 build: set the minimum macOS SDK to 10.15 (#47659)
* build: set the minumum macOS SDK to 10.15

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: revert "Update mac_sdk_min to match minimum required SDK version"

This reverts commit 3d4654fc18.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-07-04 10:24:36 +02:00
trop[bot]
a425ddd08e fix: crash on source capture with empty thumbnail size (#47652)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-03 22:19:43 +02:00
trop[bot]
9184541193 fix: accent color should reflect system settings without restart (#47658)
fix: accentColor should reflect system settings without restart

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-07-03 22:19:29 +02:00
trop[bot]
5edb807cff build: update yarn to 1.22.22 (#47637)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2025-07-03 14:41:55 +02:00
trop[bot]
c65bfc1e5c chore: bump chromium to 140.0.7261.0 (38-x-y) (#47617)
* chore: bump chromium in DEPS to 140.0.7259.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* Add fade in animation to Picture-in-Picture windows

https://chromium-review.googlesource.com/c/chromium/src/+/6538268

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* Use V8 Apis that don't return JSGlobalObject

Refs https://issues.chromium.org/issues/333672197

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: IWYU

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: bump chromium in DEPS to 140.0.7261.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* revert: update to siso-chromium image

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* Use v8::Object::WrapGlobal()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6650977

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: IWYU

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: fix --trace-startup spec

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-30 17:07:00 -04:00
trop[bot]
85a8bfaa31 chore: bump chromium to 139.0.7256.0 (38-x-y) (#47615)
* chore: bump chromium in DEPS to 139.0.7242.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update render_widget_host_view_mac.patch

no code changes; just updating patch context

Do a cleanup pass on the history swiper code | https://chromium-review.googlesource.com/c/chromium/src/+/6604367

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: update mas_avoid_private_macos_api_usage.patch.patch

no code changes; just updating patch context

[tracing] Delete base/trace_event/base_tracing.h | https://chromium-review.googlesource.com/c/chromium/src/+/6624012

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

no manual changes; just updating patch context

[ActorFramework] Refactor Actor Task Management | https://chromium-review.googlesource.com/c/chromium/src/+/6618684

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: update fix_move_autopipsettingshelper_behind_branding_buildflag.patch

[pip] Tuck picture-in-picture windows when a file dialog is open | https://chromium-review.googlesource.com/c/chromium/src/+/6449682

Reland "[document pip] Restrict the size that a website can request" | https://chromium-review.googlesource.com/c/chromium/src/+/6372104

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: update feat_corner_smoothing_css_rule_and_blink_painting.patch

Xref: corner-shape: constraint radii based on opposite corner overlap | https://chromium-review.googlesource.com/c/chromium/src/+/6592572

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: update revert_code_health_clean_up_stale_macwebcontentsocclusion.patch

no manual changes; just updating patch context

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: update fix_rename_sqlite_win32_exports_to_avoid_conflicts_with_node_js.patch

no code changes; just updating patch context

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: e patches all

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* Plumb Verify2QwacBinding and hook it up in QwacWebContentsObserver

https://chromium-review.googlesource.com/c/chromium/src/+/6624719

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Remove host delegate OnMainFrameCreatedForBackgroundPage

https://chromium-review.googlesource.com/c/chromium/src/+/6631123

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Extensions: Rename GetResourceURL to ResolveExtensionURL

https://chromium-review.googlesource.com/c/chromium/src/+/6625053

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Consolidate NativeFrameViewMac

https://chromium-review.googlesource.com/c/chromium/src/+/6614239

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* ICWYU

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Remove dead code WidgetAXTreeIDMap

https://chromium-review.googlesource.com/c/chromium/src/+/6619701

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS"

https://chromium-review.googlesource.com/c/chromium/src/+/6630056

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* NavigationThrottleRunner2: Remove MaybeAddThrottle

https://chromium-review.googlesource.com/c/chromium/src/+/6628079

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Tuck picture-in-picture windows when a file dialog is open

https://chromium-review.googlesource.com/c/chromium/src/+/6449682

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* build: fix snapshot_blob.bin build error

xref: https://issues.chromium.org/issues/416540976

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: e patches all

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* build: freeup disk space on macos

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: bump chromium in DEPS to 139.0.7244.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update printing.patch

no manual changes; just updating patch context

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: remove upstreamed ignore_parse_errors_for_resolveshortcutproperties.patch

Prevent Windows crash on unexpected shortcut type | https://chromium-review.googlesource.com/c/chromium/src/+/6633298

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: e patches all

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* Revert "Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS""

This reverts commit 77c4f967a6.

Revert CL for the high confidence crash culprit for http://crash/28f897bb9743dfe0 | https://chromium-review.googlesource.com/c/chromium/src/+/6641819

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* Fix spec's expected base64-encoded PNG strings to match upstream changes.

[rust png] Enable by default. | https://chromium-review.googlesource.com/c/chromium/src/+/6085801

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: bump chromium in DEPS to 139.0.7246.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: e patches all

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: bump chromium in DEPS to 139.0.7248.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* siso: Enable Siso by default for non-Google builds

https://chromium-review.googlesource.com/c/chromium/src/+/6638830

Disabling for now until we are ready to build siso on all platforms.

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Revert "revert Don't use static variable for UseExternalPopupMenus"

This reverts commit e91e3894e6.

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Update mac_sdk_min to match minimum required SDK version

https://chromium-review.googlesource.com/c/chromium/src/+/6493969
(cherry picked from commit 3e7cbe912d)

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Use default window styling on Mac

https://chromium-review.googlesource.com/c/chromium/src/+/6648665

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* Reland "Force the unintentional renderer process creation check by default"

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: bump chromium in DEPS to 139.0.7249.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: update patches

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* chore: bump chromium in DEPS to 139.0.7250.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 139.0.7252.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 139.0.7254.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 6638187: browser level TOCTOU check for coordinate target

https://chromium-review.googlesource.com/c/chromium/src/+/6638187

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: add missing base/notimplemented includes

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 6652910: [Frame Cleanup] Push down/hide implementation-specific API

https://chromium-review.googlesource.com/c/chromium/src/+/6652910

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump chromium in DEPS to 139.0.7256.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fix lint

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! 6652910: [Frame Cleanup] Push down/hide implementation-specific API

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: move HandleScope location

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump chromium in DEPS to 139.0.7258.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* fixup! [NonClientFrameView] Consolidate NativeFrameViewMac

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* Revert "chore: bump chromium in DEPS to 139.0.7258.0"

This reverts commit 264b2e934f.

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-06-30 12:29:54 -04:00
electron-roller[bot]
f6d054f0fb chore: bump node to v22.17.0 (38-x-y) (#47556)
* chore: bump node in DEPS to v22.17.0

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* chore: adjust crypto specs:

- https://github.com/nodejs/node/pull/58117
- https://github.com/nodejs/node/pull/58387

* deps: update libuv to 1.51.0

https://github.com/nodejs/node/pull/58124

* test: fix test-buffer-tostring-range on allocation failure

https://github.com/nodejs/node/pull/58416

* build: use FILE_OFFSET_BITS=64 esp. on 32-bit arch

https://github.com/nodejs/node/pull/58090

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* inspector: add protocol method Network.dataReceived

https://github.com/nodejs/node/pull/58001

* test: force slow JSON.stringify path for overflow

https://github.com/nodejs/node/pull/58181

* chore: fixup patch indices

* 6049967: Remove protocol::Maybe and roll inspector_protocol

https://chromium-review.googlesource.com/c/chromium/src/+/6049967

* chore: fixup crypto test patch

* src: fix module buffer allocation

https://github.com/nodejs/node/pull/57738

* crypto: expose process.features.openssl_is_boringssl

https://github.com/nodejs/node/pull/58387

* util: add internal assignFunctionName() function

https://github.com/nodejs/node/pull/57916

* build: fix pointer compression builds

https://github.com/nodejs/node/pull/58171

* chore: put back config options

* fixup! deps: update libuv to 1.51.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-06-30 14:49:12 +02:00
trop[bot]
66a89ec38f refactor: reduce scope of temporaries when getting dictionary values (#47612)
refactor: reduce scale of temporaries when getting dictionary values

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-30 12:03:45 +02:00
trop[bot]
6d3eeb46e4 perf: avoid copying a vector when calling ConvertToWeakPtrVector() (#47603)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-30 10:59:53 +02:00
trop[bot]
34dcfb5422 fix: Reland "[accessibility] Platform node lifetime cleanups" (#47610)
Reland "[accessibility] Platform node lifetime cleanups"

https://chromium-review.googlesource.com/c/chromium/src/+/6462552

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-30 10:59:26 +02:00
trop[bot]
e84f0e164e test: fix nan tests on macOS (#47609)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-06-30 10:58:56 +02:00
trop[bot]
68c769de94 refactor: avoid copies of large objects in range based for loops (#47606)
* Avoid copies of large objects in range-based for-loops.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6527689

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* Avoid copies of large objects in range-based for-loops in Browser::ShowAboutPanel()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-30 10:28:53 +02:00
trop[bot]
3eabf175b8 docs: update example apps (#47599)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-06-29 21:58:10 +02:00
trop[bot]
9c0ef6f9c6 refactor: sync IsKillURL() with upstream impl in extension_tab_util.cc (#47596)
Use base::MakeFixedFlatSet()

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-27 21:07:44 -05:00
trop[bot]
c150a1e004 refactor: extract-constant static Windows registry keys in Browser code (#47589)
* refactor: extract-constant for registry key in GetProcessExecPath()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: extract-constant for registry key in Browser::GetLoginItemSettings()

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* chore: document the symbolic constants

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: prefer base::wcstring_view::c_str() to data() to make zero-termination clearer

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-27 15:12:00 -05:00
trop[bot]
a8b8ad9ca9 refactor: make context bridge's private keys hidden, constexpr string_views (#47585)
* refactor: local functions GetPrivate(), SetPrivate() now take std::string_views

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: make local keys std::string_views instead of C-style char arrays

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: make local keys constexpr

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: move local keys into local anonymous namespace

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-27 12:42:33 -05:00
trop[bot]
4268bf91e4 refactor: remove stray .c_str() calls for absl::StrFormat() (#47578)
refactor: remove stray .c_str() calls for absl::StrFormat()

StrFormat() understands std::string, std::string_view

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-06-26 11:41:48 -05:00
trop[bot]
79d6160bdc docs: fix --experimental-network-inspection spelling (#47574)
doc: fix `--experimental-network-inspection` spelling

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-06-26 16:38:22 +02:00
trop[bot]
41ebb49703 fix: revert upstream MacOS mouse event routing (#47575)
* fix: revert upstream MacOS mouse event routing

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: reduce patch surface area

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: update patches

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-06-26 16:38:10 +02:00
trop[bot]
c30eae3216 docs: update asar integrity fuse availability (#47568)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-06-25 17:06:46 -05:00
trop[bot]
b89810f374 docs: Add C++/Linux tutorial (#47552)
* docs: Add C++/Linux tutorial

Co-authored-by: Felix Rieseberg <fr@makenotion.com>

* Update docs/tutorial/native-code-and-electron-cpp-linux.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

Co-authored-by: Felix Rieseberg <fr@makenotion.com>

* Apply suggestions from code review

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Felix Rieseberg <felix@felixrieseberg.com>

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Felix Rieseberg <felix@felixrieseberg.com>

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Felix Rieseberg <felix@felixrieseberg.com>

* Implement more feedback, lint

Co-authored-by: Felix Rieseberg <felix@felixrieseberg.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Felix Rieseberg <fr@makenotion.com>
Co-authored-by: Felix Rieseberg <felix@felixrieseberg.com>
2025-06-25 09:35:00 -04:00
572 changed files with 26309 additions and 21241 deletions

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -58,16 +58,6 @@ body:
label: Last Known Working Electron version
description: What is the last version of Electron this worked in, if applicable?
placeholder: 16.0.0
- type: dropdown
attributes:
label: Does the issue also appear in Chromium / Google Chrome?
description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
options:
- I don't know how to test
- "Yes"
- "No"
validations:
required: true
- type: textarea
attributes:
label: Expected Behavior

View File

@@ -70,11 +70,7 @@ runs:
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
if [ "$TARGET_PLATFORM" = "win" ]; then
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
else
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
fi
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
@@ -136,14 +132,6 @@ runs:
run: |
cd src
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
target_os="${target_os}_mas"
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -188,10 +176,11 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -202,6 +191,11 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash

View File

@@ -143,16 +143,17 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matcher
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
npx node src/electron/script/patches-stats.mjs --upload-stats || true
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD
@@ -172,6 +173,7 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

View File

@@ -6,8 +6,6 @@ runs:
- name: Free Space on MacOS
shell: bash
run: |
echo "Disk usage before cleanup:"
df -h
sudo mkdir -p $TMPDIR/del-target
tmpify() {
@@ -17,30 +15,28 @@ runs:
}
strip_universal_deep() {
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
done
fi
done
cd $opwd
fi
cd $opwd
}
tmpify /Library/Developer/CoreSimulator
@@ -62,9 +58,10 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
@@ -76,5 +73,4 @@ runs:
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
sudo mdutil -a -i off
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -6,7 +6,7 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
id: yarn-cache
with:
@@ -18,4 +18,14 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

122
.github/copilot-instructions.md vendored Normal file
View File

@@ -0,0 +1,122 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

View File

@@ -19,6 +19,16 @@
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

View File

@@ -3,17 +3,21 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
with:
node-version: 20.19.x
- name: Setting Up Dig Site
@@ -41,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 #v5.0.0
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
with:
name: artifacts
path: electron/artifacts

View File

@@ -15,12 +15,8 @@ jobs:
permissions:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903 # v6.0.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
- run: npm install @actions/cache @electron/fiddle-core
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
@@ -33,7 +29,7 @@ jobs:
// Only want the most recent workflow run that wasn't skipped or cancelled
const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
const versions = await ElectronVersions.create({ ignoreCache: true });
const versions = await ElectronVersions.create(undefined, { ignoreCache: true });
const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
for (const branch of ["main", ...branches]) {
@@ -73,7 +69,6 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)
@@ -106,6 +101,7 @@ jobs:
}
if (runsWithErrors.length > 0) {
core.setOutput('errorsFound', true);
core.summary.addHeading('⚠️ Runs with Errors');
core.summary.addTable([
[
@@ -132,7 +128,6 @@ jobs:
// Set this as failed so it's easy to scan runs to find failures
if (runsWithErrors.find((run) => !run.isStale)) {
core.setOutput('errorsFound', true);
process.exitCode = 1;
}
} else {
@@ -142,7 +137,7 @@ jobs:
await core.summary.write();
- name: Send Slack message if errors
if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
with:
payload: |
link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
id: generate-project-metadata
with:
script: |

View File

@@ -6,11 +6,15 @@ on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -19,7 +23,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -30,8 +34,10 @@ jobs:
build-git-cache-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -41,7 +47,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -52,10 +58,12 @@ jobs:
build-git-cache-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -64,7 +72,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
skip-macos:
type: boolean
@@ -43,10 +43,13 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -54,7 +57,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -63,13 +66,17 @@ jobs:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -80,6 +87,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
@@ -89,6 +98,8 @@ jobs:
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
@@ -98,6 +109,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -111,7 +124,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -126,6 +139,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -141,7 +156,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -155,6 +170,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -171,7 +188,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -185,16 +202,20 @@ jobs:
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-15
check-runs-on: macos-14
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
@@ -207,6 +228,8 @@ jobs:
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
@@ -225,8 +248,8 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
build-runs-on: macos-14-xlarge
test-runs-on: macos-14-large
target-platform: macos
target-arch: x64
is-release: false
@@ -244,8 +267,8 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
build-runs-on: macos-14-xlarge
test-runs-on: macos-14
target-platform: macos
target-arch: arm64
is-release: false
@@ -310,7 +333,7 @@ jobs:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -400,6 +423,8 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
steps:

View File

@@ -1,16 +1,20 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root

View File

@@ -10,24 +10,15 @@ permissions: {}
jobs:
issue-commented:
name: Remove blocked/{need-info,need-repro} on comment
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-latest
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Remove label
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
ISSUE_URL: ${{ github.event.issue.html_url }}

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -31,6 +32,8 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -72,7 +75,7 @@ jobs:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,6 +11,7 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -28,6 +29,7 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -37,7 +39,7 @@ jobs:
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Add labels
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
@@ -134,7 +136,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -10,6 +10,7 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,9 +17,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -31,7 +35,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,12 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -54,7 +63,12 @@ jobs:
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -69,7 +83,12 @@ jobs:
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -32,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -43,11 +47,16 @@ jobs:
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-15-xlarge
build-runs-on: macos-14-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -58,11 +67,16 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-15-xlarge
build-runs-on: macos-14-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -73,11 +87,16 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-15-xlarge
build-runs-on: macos-14-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -88,11 +107,16 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-15-xlarge
build-runs-on: macos-14-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -7,28 +7,22 @@ on:
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}
jobs:
check-for-non-maintainer-dependency-change:
name: Check for disallowed non-maintainer change
if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.pull_request.author_association) && github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
permissions:
contents: read
pull-requests: write
runs-on: ubuntu-latest
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Check for existing review
id: check-for-review
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -64,14 +64,13 @@ concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -86,6 +85,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
@@ -19,11 +21,13 @@ jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -50,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -19,11 +21,13 @@ jobs:
lint:
name: Lint
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -74,11 +78,15 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -59,6 +59,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -81,6 +83,8 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
@@ -91,7 +95,7 @@ jobs:
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -115,7 +119,7 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
with:
node-version: 20.19.x
cache: yarn
@@ -159,7 +163,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0

View File

@@ -0,0 +1,237 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
with:
node-version: 20.19.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -35,10 +35,7 @@ concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -53,6 +50,10 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
@@ -68,16 +69,14 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@2028fbc5c25fe9cf00d9f06a71cc4710d4507903
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
with:
node-version: 20.19.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
configure_user_tccdb () {
local values=$1
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
@@ -96,14 +95,11 @@ jobs:
"'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
)
for values in "${userValuesArray[@]}"; do
# Sonoma and higher have a few extra values
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
if [ "$OSTYPE" = "darwin23" ]; then
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
else
@@ -114,21 +110,12 @@ jobs:
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
- name: Set xcode to 16.4
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
@@ -167,12 +154,12 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
@@ -190,16 +177,12 @@ jobs:
run: |
cd src/out/Default
unzip -:o dist.zip
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
run: |
sudo security authorizationdb write com.apple.trust-settings.admin allow
cd src/electron
node script/yarn global add @datadog/datadog-ci
./script/codesign/generate-identity.sh
- name: Run Electron Tests
shell: bash
env:
@@ -225,7 +208,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -242,9 +225,14 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
- name: Upload Test results to Datadog
@@ -256,13 +244,14 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -39,6 +41,8 @@ jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +97,8 @@ jobs:
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@018cc2cf5baa6db3ef3c5f8a56943fffe632ef53
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +138,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

View File

@@ -11,9 +11,10 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
uses: slackapi/slack-github-action@b0fa283ad8fea605de13dc3f449259339835fc52 # v2.1.0
with:
webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
webhook-type: webhook-trigger
@@ -28,6 +29,7 @@ jobs:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8 # v5.0.0
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@330a01c490aca151604b8cf639adc76d48f6c5d4 # v5.0.0
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@4e94bd11f71e507f7f87df81788dff88d1dacbfb # v3.29.5
uses: github/codeql-action/upload-sarif@ce28f5bb42b7a9f2c824e633a3f6ee835bab6858 # v3.29.0
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:
@@ -19,7 +18,7 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: semantic-pull-request
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
with:

View File

@@ -11,6 +11,7 @@ jobs:
check-stable-prep-items:
name: Check Stable Prep Items
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -10,13 +10,14 @@ permissions: {}
jobs:
stale:
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,10 +28,11 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
permissions: {}
if: ${{ always() }}
needs: stale
steps:
@@ -39,7 +41,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -36,7 +40,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@08c6903cd8c0fde910a37f88322edcfb5dd907a8
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
with:
path: src/electron
fetch-depth: 0
@@ -47,7 +51,12 @@ jobs:
target-platform: win
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -61,7 +70,12 @@ jobs:
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -75,7 +89,12 @@ jobs:
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release

2
.gitignore vendored
View File

@@ -53,3 +53,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

2
.nvmrc
View File

@@ -1 +1 @@
22
20

942
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

12
.yarnrc.yml Normal file
View File

@@ -0,0 +1,12 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

View File

@@ -586,13 +586,7 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -695,6 +689,7 @@ source_set("electron_lib") {
"//components/app_launch_prefetch",
"//components/crash/core/app:crash_export_thunks",
"//third_party/libxml:xml_writer",
"//ui/native_theme:native_theme_browser",
"//ui/wm",
"//ui/wm/public",
]
@@ -786,13 +781,9 @@ source_set("electron_lib") {
action("mksnapshot_checksum_gen") {
script = "build/checksum_header.py"
outputs = [ "$target_gen_dir/snapshot_checksum.h" ]
inputs = [ "$root_out_dir/$v8_context_snapshot_filename" ]
args = rebase_path(inputs)
args += rebase_path(outputs)
args = rebase_path(inputs) + rebase_path(outputs)
deps = [ "//tools/v8_context_snapshot" ]
}

11
DEPS
View File

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'143.0.7499.0',
'140.0.7339.249',
'node_version':
'v22.20.0',
'v22.22.0',
'nan_version':
'675cefebca42410733da8a454c8d9391fcebfbc2',
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.22.22',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -155,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -8,12 +8,6 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 143
node_module_version = 139
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"
@@ -19,10 +19,6 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false

View File

@@ -12,7 +12,7 @@ TEMPLATE_H = """
namespace electron::snapshot_checksum {
inline constexpr std::string_view kChecksum = "{checksum}";
const std::string kChecksum = "{checksum}";
} // namespace electron::snapshot_checksum

View File

@@ -67,6 +67,10 @@ template("mac_xib_bundle_data") {
ibtool_flags = [
"--minimum-deployment-target",
mac_deployment_target,
# TODO(rsesek): Enable this once all the bots are on Xcode 7+.
# "--target-device",
# "mac",
]
}

View File

@@ -23,8 +23,6 @@ static_library("chrome") {
"//chrome/browser/browser_process.h",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
"//chrome/browser/devtools/devtools_eye_dropper.cc",
@@ -144,6 +142,8 @@ static_library("chrome") {
"//chrome/browser/ui/views/overlay/toggle_camera_button.h",
"//chrome/browser/ui/views/overlay/toggle_microphone_button.cc",
"//chrome/browser/ui/views/overlay/toggle_microphone_button.h",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
"//chrome/browser/ui/views/overlay/video_overlay_window_views.cc",
"//chrome/browser/ui/views/overlay/video_overlay_window_views.h",
"//chrome/browser/ui/views/picture_in_picture/picture_in_picture_bounds_change_animation.cc",
@@ -280,8 +280,6 @@ static_library("chrome") {
"//chrome/browser/process_singleton_mac.mm",
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.h",
"//chrome/browser/ui/views/eye_dropper/eye_dropper_view_mac.mm",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.h",
"//chrome/browser/ui/views/overlay/video_overlay_window_native_widget_mac.mm",
]
deps += [ ":system_media_capture_permissions_mac_conflict" ]
}
@@ -504,17 +502,15 @@ source_set("chrome_spellchecker") {
]
}
if (is_mac) {
# These sources create an object file conflict with one in |:chrome|, so they
# must live in a separate target.
# Conflicting sources:
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
source_set("system_media_capture_permissions_mac_conflict") {
sources = [
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
]
deps = [ "//chrome/common" ]
}
# These sources create an object file conflict with one in |:chrome|, so they
# must live in a separate target.
# Conflicting sources:
# //chrome/browser/media/webrtc/system_media_capture_permissions_stats_mac.mm
# //chrome/browser/permissions/system/system_media_capture_permissions_mac.mm
source_set("system_media_capture_permissions_mac_conflict") {
sources = [
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.h",
"//chrome/browser/permissions/system/system_media_capture_permissions_mac.mm",
]
deps = [ "//chrome/common" ]
}

View File

@@ -421,7 +421,6 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.

View File

@@ -25,6 +25,11 @@ following properties:
with which the request is associated. Defaults to the empty string. The
`session` option supersedes `partition`. Thus if a `session` is explicitly
specified, `partition` is ignored.
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
custom protocol handlers registered for the request's URL scheme will not be
called. This allows forwarding an intercepted request to the built-in
handler. [webRequest](web-request.md) handlers will still be triggered
when bypassing custom protocols. Defaults to `false`.
* `credentials` string (optional) - Can be `include`, `omit` or
`same-origin`. Whether to send
[credentials](https://fetch.spec.whatwg.org/#credentials) with this

View File

@@ -86,7 +86,7 @@ Field trials to be forcefully enabled or disabled.
For example: `WebRTC-Audio-Red-For-Opus/Enabled/`
### --host-rules=`rules` _Deprecated_
### --host-rules=`rules`
A comma-separated list of `rules` that control how hostnames are mapped.
@@ -104,23 +104,9 @@ These mappings apply to the endpoint host in a net request (the TCP connect
and host resolver in a direct connection, and the `CONNECT` in an HTTP proxy
connection, and the endpoint host in a `SOCKS` proxy connection).
**Deprecated:** Use the `--host-resolver-rules` switch instead.
### --host-resolver-rules=`rules`
A comma-separated list of `rules` that control how hostnames are mapped.
For example:
* `MAP * 127.0.0.1` Forces all hostnames to be mapped to 127.0.0.1
* `MAP *.google.com proxy` Forces all google.com subdomains to be resolved to
"proxy".
* `MAP test.com [::1]:77` Forces "test.com" to resolve to IPv6 loopback. Will
also force the port of the resulting socket address to be 77.
* `MAP * baz, EXCLUDE www.google.com` Remaps everything to "baz", except for
"www.google.com".
These `rules` only apply to the host resolver.
Like `--host-rules` but these `rules` only apply to the host resolver.
### --ignore-certificate-errors
@@ -193,11 +179,6 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated
@@ -350,22 +331,6 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
Disable exposition of [Navigator API][] on the global scope from Node.js.
## Chromium Flags
There isn't a documented list of all Chromium switches, but there are a few ways to find them.
The easiest way is through Chromium's flags page, which you can access at `about://flags`. These flags don't directly match switch names, but they show up in the process's command-line arguments.
To see these arguments, enable a flag in `about://flags`, then go to `about://version` in Chromium. You'll find a list of command-line arguments, including `--flag-switches-begin --your --list --flag-switches-end`, which contains the list of your flag enabled switches.
Most flags are included as part of `--enable-features=`, but some are standalone switches, like `--enable-experimental-web-platform-features`.
A complete list of flags exists in [Chromium's flag metadata page](https://source.chromium.org/chromium/chromium/src/+/main:chrome/browser/flag-metadata.json), but this list includes platform, environment and GPU specific, expired and potentially non-functional flags, so many of them might not always work in every situation.
Keep in mind that standalone switches can sometimes be split into individual features, so there's no fully complete list of switches.
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
[app]: app.md
[append-switch]: command-line.md#commandlineappendswitchswitch-value
[debugging-main-process]: ../tutorial/debugging-main-process.md

View File

@@ -157,7 +157,6 @@ has been included below for completeness:
| [Cloneable Types](https://developer.mozilla.org/en-US/docs/Web/API/Web_Workers_API/Structured_clone_algorithm) | Simple | ✅ | ✅ | See the linked document on cloneable types |
| `Element` | Complex | ✅ | ✅ | Prototype modifications are dropped. Sending custom elements will not work. |
| `Blob` | Complex | ✅ | ✅ | N/A |
| `VideoFrame` | Complex | ✅ | ✅ | N/A |
| `Symbol` | N/A | ❌ | ❌ | Symbols cannot be copied across contexts so they are dropped |
If the type you care about is not in the above table, it is probably not supported.

View File

@@ -102,10 +102,6 @@ Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`Desktop
## Caveats
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
A `Session` object, the default session object of the app.
## Class: Session

View File

@@ -1,195 +0,0 @@
# ColorSpace Object
* `primaries` string - The color primaries of the color space. Can be one of the following values:
* `bt709` - BT709 primaries (also used for sRGB)
* `bt470m` - BT470M primaries
* `bt470bg` - BT470BG primaries
* `smpte170m` - SMPTE170M primaries
* `smpte240m` - SMPTE240M primaries
* `film` - Film primaries
* `bt2020` - BT2020 primaries
* `smptest428-1` - SMPTEST428-1 primaries
* `smptest431-2` - SMPTEST431-2 primaries
* `p3` - P3 primaries
* `xyz-d50` - XYZ D50 primaries
* `adobe-rgb` - Adobe RGB primaries
* `apple-generic-rgb` - Apple Generic RGB primaries
* `wide-gamut-color-spin` - Wide Gamut Color Spin primaries
* `ebu-3213-e` - EBU 3213-E primaries
* `custom` - Custom primaries
* `invalid` - Invalid primaries
* `transfer` string - The transfer function of the color space. Can be one of the following values:
* `bt709` - BT709 transfer function
* `bt709-apple` - BT709 Apple transfer function
* `gamma18` - Gamma 1.8 transfer function
* `gamma22` - Gamma 2.2 transfer function
* `gamma24` - Gamma 2.4 transfer function
* `gamma28` - Gamma 2.8 transfer function
* `smpte170m` - SMPTE170M transfer function
* `smpte240m` - SMPTE240M transfer function
* `linear` - Linear transfer function
* `log` - Log transfer function
* `log-sqrt` - Log Square Root transfer function
* `iec61966-2-4` - IEC61966-2-4 transfer function
* `bt1361-ecg` - BT1361 ECG transfer function
* `srgb` - sRGB transfer function
* `bt2020-10` - BT2020-10 transfer function
* `bt2020-12` - BT2020-12 transfer function
* `pq` - PQ (Perceptual Quantizer) transfer function
* `smptest428-1` - SMPTEST428-1 transfer function
* `hlg` - HLG (Hybrid Log-Gamma) transfer function
* `srgb-hdr` - sRGB HDR transfer function
* `linear-hdr` - Linear HDR transfer function
* `custom` - Custom transfer function
* `custom-hdr` - Custom HDR transfer function
* `scrgb-linear-80-nits` - scRGB Linear 80 nits transfer function
* `invalid` - Invalid transfer function
* `matrix` string - The color matrix of the color space. Can be one of the following values:
* `rgb` - RGB matrix
* `bt709` - BT709 matrix
* `fcc` - FCC matrix
* `bt470bg` - BT470BG matrix
* `smpte170m` - SMPTE170M matrix
* `smpte240m` - SMPTE240M matrix
* `ycocg` - YCoCg matrix
* `bt2020-ncl` - BT2020 NCL matrix
* `ydzdx` - YDzDx matrix
* `gbr` - GBR matrix
* `invalid` - Invalid matrix
* `range` string - The color range of the color space. Can be one of the following values:
* `limited` - Limited color range (RGB values ranging from 16 to 235)
* `full` - Full color range (RGB values from 0 to 255)
* `derived` - Range defined by the transfer function and matrix
* `invalid` - Invalid range
## Common `ColorSpace` definitions
### Standard Color Spaces
**sRGB**:
```js
const cs = {
primaries: 'bt709',
transfer: 'srgb',
matrix: 'rgb',
range: 'full'
}
```
**Display P3**:
```js
const cs = {
primaries: 'p3',
transfer: 'srgb',
matrix: 'rgb',
range: 'full'
}
```
**XYZ D50**:
```js
const cs = {
primaries: 'xyz-d50',
transfer: 'linear',
matrix: 'rgb',
range: 'full'
}
```
### HDR Color Spaces
**Extended sRGB** (extends sRGB to all real values):
```js
const cs = {
primaries: 'bt709',
transfer: 'srgb-hdr',
matrix: 'rgb',
range: 'full'
}
```
**scRGB Linear** (linear transfer function for all real values):
```js
const cs = {
primaries: 'bt709',
transfer: 'linear-hdr',
matrix: 'rgb',
range: 'full'
}
```
**scRGB Linear 80 Nits** (with an SDR white level of 80 nits):
```js
const cs = {
primaries: 'bt709',
transfer: 'scrgb-linear-80-nits',
matrix: 'rgb',
range: 'full'
}
```
**HDR10** (BT.2020 primaries with PQ transfer function):
```js
const cs = {
primaries: 'bt2020',
transfer: 'pq',
matrix: 'rgb',
range: 'full'
}
```
**HLG** (BT.2020 primaries with HLG transfer function):
```js
const cs = {
primaries: 'bt2020',
transfer: 'hlg',
matrix: 'rgb',
range: 'full'
}
```
### Video Color Spaces
**Rec. 601** (SDTV):
```js
const cs = {
primaries: 'smpte170m',
transfer: 'smpte170m',
matrix: 'smpte170m',
range: 'limited'
}
```
**Rec. 709** (HDTV):
```js
const cs = {
primaries: 'bt709',
transfer: 'bt709',
matrix: 'bt709',
range: 'limited'
}
```
**JPEG** (typical color space for JPEG images):
```js
const cs = {
primaries: 'bt709',
transfer: 'srgb',
matrix: 'smpte170m',
range: 'full'
}
```

View File

@@ -2,13 +2,9 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In OSR case, it is expected to have the full section area.
* `contentRect` [Rectangle](rectangle.md) - The region of the video frame that capturer would like to populate. In OSR case, it is the same with `dirtyRect` that needs to be painted.
* `timestamp` number - The time in microseconds since the capture start.
* `metadata` Object - Extra metadata. See comments in src\media\base\video_frame_metadata.h for accurate details.
@@ -16,6 +12,13 @@
* `regionCaptureRect` [Rectangle](rectangle.md) (optional) - May reflect the frame's contents origin if region capture is used internally.
* `sourceSize` [Rectangle](rectangle.md) (optional) - Full size of the source frame.
* `frameCount` number (optional) - The increasing count of captured frame. May contain gaps if frames are dropped between two consecutively received frames.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle data.
* `sharedTextureHandle` Buffer _Windows_ _macOS_ - The handle to the shared texture.
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
* `release` Function - Release the resources. The `texture` cannot be directly passed to another process, users need to maintain texture lifecycles in
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important that you call `texture.release()` as soon as you're done with the texture.
main process, but it is safe to pass the `textureInfo` to another process. Only a limited number of textures can exist at the same time, so it's important
that you call `texture.release()` as soon as you're done with the texture.

View File

@@ -8,7 +8,6 @@
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` Integer - The exit code of the process, unless `reason` is
`launch-failed`, in which case `exitCode` will be a platform-specific
launch failure error code.

View File

@@ -1,12 +0,0 @@
# SharedTextureHandle Object
* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process.
* `ioSurface` Buffer (optional) _macOS_ - IOSurfaceRef holds the shared texture. Note that this IOSurface is local to current process (not global).
* `nativePixmap` Object (optional) _Linux_ - Structure contains planes of shared texture.
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.
* `stride` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `offset` number - The strides and offsets in bytes to be used when accessing the buffers via a memory mapping. One per plane per entry.
* `size` number - Size in bytes of the plane. This is necessary to map the buffers.
* `fd` number - File descriptor for the underlying memory object (usually dmabuf).
* `modifier` string _Linux_ - The modifier is retrieved from GBM library and passed to EGL driver.
* `supportsZeroCopyWebGpuImport` boolean _Linux_ - Indicates whether supports zero copy import to WebGPU.

View File

@@ -1,35 +1,17 @@
# USBDevice Object
* `configuration` Object (optional) - A [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) object containing information about the currently selected configuration of a USB device.
* `configurationValue` Integer - the configuration value of this configuration.
* `configurationName` string - the name provided by the device to describe this configuration.
* `interfaces` Object[] - An array of [USBInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBInterface) objects containing information about an interface provided by the USB device.
* `interfaceNumber` Integer - the interface number of this interface.
* `alternate` Object - the currently selected alternative configuration of this interface.
* `alternateSetting` Integer - the alternate setting number of this interface.
* `interfaceClass` Integer - the class of this interface. See [USB.org](https://www.usb.org/defined-class-codes) for class code descriptions.
* `interfaceSubclass` Integer - the subclass of this interface.
* `interfaceProtocol` Integer - the protocol supported by this interface.
* `interfaceName` string (optional) - the name of the interface, if one is provided by the device.
* `endpoints` Object[] - an array containing instances of the [USBEndpoint interface](https://developer.mozilla.org/en-US/docs/Web/API/USBEndpoint) describing each of the endpoints that are part of this interface.
* `endpointNumber` Integer - this endpoint's "endpoint number" which is a value from 1 to 15.
* `direction` string - the direction in which this endpoint transfers data - can be either 'in' or 'out'.
* `type` string - the type of this endpoint - can be either 'bulk', 'interrupt', or 'isochronous'.
* `packetSize` Integer - the size of the packets that data sent through this endpoint will be divided into.
* `alternates` Object[] - an array containing instances of the [USBAlternateInterface](https://developer.mozilla.org/en-US/docs/Web/API/USBAlternateInterface) interface describing each of the alternative configurations possible for this interface.
* `configurations` Object[] - An array of [USBConfiguration](https://developer.mozilla.org/en-US/docs/Web/API/USBConfiguration) interfaces for controlling a paired USB device.
* `deviceClass` Integer - The device class for the communication interface supported by the device.
* `deviceId` string - Unique identifier for the device.
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device.
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device.
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.
* `manufacturerName` string (optional) - The manufacturer name of the device.
* `vendorId` Integer - The USB vendor ID.
* `productId` Integer - The USB product ID.
* `productName` string (optional) - Name of the device.
* `serialNumber` string (optional) - The USB device serial number.
* `usbVersionMajor` Integer - The USB protocol major version supported by the device.
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device.
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device.
* `vendorId` Integer - The USB vendor ID.
* `manufacturerName` string (optional) - The manufacturer name of the device.
* `usbVersionMajor` Integer - The USB protocol major version supported by the device
* `usbVersionMinor` Integer - The USB protocol minor version supported by the device
* `usbVersionSubminor` Integer - The USB protocol subminor version supported by the device
* `deviceClass` Integer - The device class for the communication interface supported by the device
* `deviceSubclass` Integer - The device subclass for the communication interface supported by the device
* `deviceProtocol` Integer - The device protocol for the communication interface supported by the device
* `deviceVersionMajor` Integer - The major version number of the device as defined by the device manufacturer.
* `deviceVersionMinor` Integer - The minor version number of the device as defined by the device manufacturer.
* `deviceVersionSubminor` Integer - The subminor version number of the device as defined by the device manufacturer.

View File

@@ -89,11 +89,6 @@
paint event. Defaults to `false`. See the
[offscreen rendering tutorial](../../tutorial/offscreen-rendering.md) for
more details.
* `sharedTexturePixelFormat` string (optional) _Experimental_ - The requested output format of the shared texture. Defaults to `argb`.
The name is originated from Chromium [`media::VideoPixelFormat`](https://source.chromium.org/chromium/chromium/src/+/main:media/base/video_types.h) enum suffix and only subset of them are supported.
The actual output pixel format and color space of the texture should refer to [`OffscreenSharedTexture`](../structures/offscreen-shared-texture.md) object in the `paint` event.
* `argb` - The requested output texture format is 8-bit unorm RGBA, with SRGB SDR color space.
* `rgbaf16` - The requested output texture format is 16-bit float RGBA, with scRGB HDR color space.
* `contextIsolation` boolean (optional) - Whether to run Electron APIs and
the specified `preload` script in a separate JavaScript context. Defaults
to `true`. The context that the `preload` script runs in will only have

View File

@@ -14,7 +14,7 @@ console.log(systemPreferences.getEffectiveAppearance())
The `systemPreferences` object emits the following events:
### Event: 'accent-color-changed' _Windows_ _Linux_
### Event: 'accent-color-changed' _Windows_
Returns:
@@ -182,7 +182,7 @@ Some popular `key` and `type`s are:
Removes the `key` in `NSUserDefaults`. This can be used to restore the default
or global value of a `key` previously set with `setUserDefault`.
### `systemPreferences.getAccentColor()`
### `systemPreferences.getAccentColor()` _Windows_ _macOS_
Returns `string` - The users current system wide accent color preference in RGBA
hexadecimal form.

View File

@@ -12,37 +12,6 @@ This document uses the following convention to categorize breaking changes:
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
## Planned Breaking API Changes (39.0)
### Deprecated: `--host-rules` command line switch
Chromium is deprecating the `--host-rules` switch.
You should use `--host-resolver-rules` instead.
### Behavior Changed: window.open popups are always resizable
Per current [WHATWG spec](https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev), the `window.open` API will now always create a resizable popup window.
To restore previous behavior:
```js
webContents.setWindowOpenHandler((details) => {
return {
action: 'allow',
overrideBrowserWindowOptions: {
resizable: details.features.includes('resizable=yes')
}
}
})
```
### Behavior Changed: shared texture OSR `paint` event data structure
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
It moves the `sharedTextureHandle`, `planes`, `modifier` into a unified `handle` property.
See the [OffscreenSharedTexture](./api/structures/offscreen-shared-texture.md) API structure for more details.
## Planned Breaking API Changes (38.0)
### Removed: `ELECTRON_OZONE_PLATFORM_HINT` environment variable

View File

@@ -6,77 +6,17 @@ Follow the guidelines below for building **Electron itself** on Linux, for the p
## Prerequisites
* At least 25GB disk space and 8GB RAM.
* Python >= 3.9.
* [Node.js](https://nodejs.org/download/) >= 22.12.0
* [clang](https://clang.llvm.org/get_started.html) 3.4 or later.
* Development headers of GTK 3 and libnotify.
Due to Electron's dependency on Chromium, prerequisites and dependencies for Electron change over time. [Chromium's documentation on building on Linux](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/linux/build_instructions.md) has up to date information for building Chromium on Linux. This documentation can generally
be followed for building Electron on Linux as well.
On Ubuntu >= 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libasound2-dev libcap-dev \
libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python3-dbusmock openjdk-8-jre
```
On Ubuntu < 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libgnome-keyring-dev \
libasound2-dev libcap-dev libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python-dbusmock openjdk-8-jre
```
On RHEL / CentOS, install the following libraries:
```sh
$ sudo yum install clang dbus-devel gtk3-devel libnotify-devel \
libgnome-keyring-devel xorg-x11-server-utils libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock openjdk-8-jre
```
On Fedora, install the following libraries:
```sh
$ sudo dnf install clang dbus-devel gperf gtk3-devel \
libnotify-devel libgnome-keyring-devel libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock
```
On Arch Linux / Manjaro, install the following libraries:
```sh
$ sudo pacman -Syu base-devel clang libdbus gtk2 libnotify \
libgnome-keyring alsa-lib libcap libcups libxtst \
libxss nss gcc-multilib curl gperf bison \
python2 python-dbusmock jdk8-openjdk
```
Other distributions may offer similar packages for installation via package
managers such as pacman. Or one can compile from source code.
Additionally, Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) can be referenced to get the current dependencies that Electron requires in addition to what Chromium installs via [build/install-deps.sh](https://chromium.googlesource.com/chromium/src/+/HEAD/build/install-build-deps.sh).
### Cross compilation
If you want to build for an `arm` target you should also install the following
dependencies:
If you want to build for an `arm` target, you can use Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) to install the additional dependencies by passing the `--arm argument`:
```sh
$ sudo apt-get install libc6-dev-armhf-cross linux-libc-dev-armhf-cross \
g++-arm-linux-gnueabihf
```
Similarly for `arm64`, install the following:
```sh
$ sudo apt-get install libc6-dev-arm64-cross linux-libc-dev-arm64-cross \
g++-aarch64-linux-gnu
$ sudo install-deps.sh --arm
```
And to cross-compile for `arm` or targets, you should pass the

View File

@@ -12,15 +12,6 @@ The ASAR format was created primarily to improve performance on Windows when
reading large quantities of small files (e.g. when loading your app's JavaScript
dependency tree from `node_modules`).
### ASAR integrity
ASAR integrity is an security feature that validates the contents of your app's
ASAR archives at runtime. When enabled, your Electron app will verify the
header hash of its ASAR archive on runtime. If no hash is present or if there is a mismatch in the
hashes, the app will forcefully terminate.
See the [ASAR Integrity](./tutorial/asar-integrity.md) guide for more details.
### code signing
Code signing is a process where an app developer digitally signs their code to

View File

@@ -5,7 +5,7 @@ slug: asar-integrity
hide_title: false
---
ASAR integrity is a security feature that validates the contents of your app's
ASAR integrity is an experimental feature that validates the contents of your app's
[ASAR archives](./asar-archives.md) at runtime.
## Version support
@@ -77,7 +77,7 @@ on package time. The process of providing this packaged hash is different for ma
### Using Electron tooling
Electron Forge and Electron Packager do this setup automatically for you with no additional
configuration whenever `asar` is enabled. The minimum required versions for ASAR integrity are:
configuration. The minimum required versions for ASAR integrity are:
* `@electron/packager@18.3.1`
* `@electron/forge@7.4.0`

View File

@@ -74,22 +74,46 @@ describe('keyboard input', () => {
Furthermore, WebdriverIO allows you to access Electron APIs to get static information about your application:
```js @ts-nocheck
import { browser } from '@wdio/globals'
import { browser, $, expect } from '@wdio/globals'
describe('trigger message modal', async () => {
it('message modal can be triggered from a test', async () => {
await browser.electron.execute(
(electron, param1, param2, param3) => {
const appWindow = electron.BrowserWindow.getFocusedWindow()
electron.dialog.showMessageBox(appWindow, {
message: 'Hello World!',
detail: `${param1} + ${param2} + ${param3} = ${param1 + param2 + param3}`
})
},
1,
2,
3
)
describe('when the make smaller button is clicked', () => {
it('should decrease the window height and width by 10 pixels', async () => {
const boundsBefore = await browser.electron.browserWindow('getBounds')
expect(boundsBefore.width).toEqual(210)
expect(boundsBefore.height).toEqual(310)
await $('.make-smaller').click()
const boundsAfter = await browser.electron.browserWindow('getBounds')
expect(boundsAfter.width).toEqual(200)
expect(boundsAfter.height).toEqual(300)
})
})
```
or to retrieve other Electron process information:
```js @ts-nocheck
import fs from 'node:fs'
import path from 'node:path'
import { browser, expect } from '@wdio/globals'
const packageJson = JSON.parse(fs.readFileSync(path.join(__dirname, '..', 'package.json'), { encoding: 'utf-8' }))
const { name, version } = packageJson
describe('electron APIs', () => {
it('should retrieve app metadata through the electron API', async () => {
const appName = await browser.electron.app('getName')
expect(appName).toEqual(name)
const appVersion = await browser.electron.app('getVersion')
expect(appVersion).toEqual(version)
})
it('should pass args through to the launched application', async () => {
// custom args are set in the wdio.conf.js file as they need to be set before WDIO starts
const argv = await browser.electron.mainProcess('argv')
expect(argv).toContain('--foo')
expect(argv).toContain('--bar=baz')
})
})
```
@@ -182,7 +206,7 @@ npm install --save-dev @playwright/test
```
:::caution Dependencies
This tutorial was written with `@playwright/test@1.52.0`. Check out
This tutorial was written with `@playwright/test@1.41.1`. Check out
[Playwright's releases][playwright-releases] page to learn about
changes that might affect the code below.
:::
@@ -194,10 +218,10 @@ To point this API to your Electron app, you can pass the path to your main proce
entry point (here, it is `main.js`).
```js {5} @ts-nocheck
import { test, _electron as electron } from '@playwright/test'
const { test, _electron: electron } = require('@playwright/test')
test('launch app', async () => {
const electronApp = await electron.launch({ args: ['.'] })
const electronApp = await electron.launch({ args: ['main.js'] })
// close app
await electronApp.close()
})
@@ -207,10 +231,10 @@ After that, you will access to an instance of Playwright's `ElectronApp` class.
is a powerful class that has access to main process modules for example:
```js {5-10} @ts-nocheck
import { test, _electron as electron } from '@playwright/test'
const { test, _electron: electron } = require('@playwright/test')
test('get isPackaged', async () => {
const electronApp = await electron.launch({ args: ['.'] })
const electronApp = await electron.launch({ args: ['main.js'] })
const isPackaged = await electronApp.evaluate(async ({ app }) => {
// This runs in Electron's main process, parameter here is always
// the result of the require('electron') in the main app script.
@@ -226,10 +250,10 @@ It can also create individual [Page][playwright-page] objects from Electron Brow
For example, to grab the first BrowserWindow and save a screenshot:
```js {6-7} @ts-nocheck
import { test, _electron as electron } from '@playwright/test'
const { test, _electron: electron } = require('@playwright/test')
test('save screenshot', async () => {
const electronApp = await electron.launch({ args: ['.'] })
const electronApp = await electron.launch({ args: ['main.js'] })
const window = await electronApp.firstWindow()
await window.screenshot({ path: 'intro.png' })
// close app
@@ -241,7 +265,7 @@ Putting all this together using the Playwright test-runner, let's create a `exam
test file with a single test and assertion:
```js title='example.spec.js' @ts-nocheck
import { test, expect, _electron as electron } from '@playwright/test'
const { test, expect, _electron: electron } = require('@playwright/test')
test('example test', async () => {
const electronApp = await electron.launch({ args: ['.'] })

View File

@@ -9,11 +9,10 @@ check out our [Electron Versioning](./electron-versioning.md) doc.
| Electron | Alpha | Beta | Stable | EOL | Chrome | Node | Supported |
| ------- | ----- | ------- | ------ | ------ | ---- | ---- | ---- |
| 40.0.0 | 2025-Oct-30 | 2025-Dec-03 | 2025-Oct-28 | 2026-Jun-30 | M144 | TBD | ✅ |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | v22.20 | ✅ |
| 39.0.0 | 2025-Sep-04 | 2025-Oct-01 | 2025-Oct-28 | 2026-May-05 | M142 | TBD | ✅ |
| 38.0.0 | 2025-Jun-26 | 2025-Aug-06 | 2025-Sep-02 | 2026-Mar-10 | M140 | v22.18 | ✅ |
| 37.0.0 | 2025-May-01 | 2025-May-28 | 2025-Jun-24 | 2026-Jan-13 | M138 | v22.16 | ✅ |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | 🚫 |
| 36.0.0 | 2025-Mar-06 | 2025-Apr-02 | 2025-Apr-29 | 2025-Oct-28 | M136 | v22.14 | |
| 35.0.0 | 2025-Jan-16 | 2025-Feb-05 | 2025-Mar-04 | 2025-Sep-02 | M134 | v22.14 | 🚫 |
| 34.0.0 | 2024-Oct-17 | 2024-Nov-13 | 2025-Jan-14 | 2025-Jun-24 | M132 | v20.18 | 🚫 |
| 33.0.0 | 2024-Aug-22 | 2024-Sep-18 | 2024-Oct-15 | 2025-Apr-29 | M130 | v20.18 | 🚫 |
@@ -122,3 +121,22 @@ and that number is reduced to two in major version 10, the three-argument versio
continue to work until, at minimum, major version 12. Past the minimum two-version
threshold, we will attempt to support backwards compatibility beyond two versions
until the maintainers feel the maintenance burden is too high to continue doing so.
### End-of-life
When a release branch reaches the end of its support cycle, the series
will be deprecated in NPM and a final end-of-support release will be
made. This release will add a warning to inform that an unsupported
version of Electron is in use.
These steps are to help app developers learn when a branch they're
using becomes unsupported, but without being excessively intrusive
to end users.
If an application has exceptional circumstances and needs to stay
on an unsupported series of Electron, developers can silence the
end-of-support warning by omitting the final release from the app's
`package.json` `devDependencies`. For example, since the 1-6-x series
ended with an end-of-support 1.6.18 release, developers could choose
to stay in the 1-6-x series without warnings with `devDependency` of
`"electron": 1.6.0 - 1.6.17`.

View File

@@ -4,24 +4,11 @@
## What are fuses?
From a security perspective, it makes sense to disable certain unused Electron features
that are powerful but may make your app's security posture weaker. For example, any app that doesn't
use the `ELECTRON_RUN_AS_NODE` environment variable would want to disable the feature to prevent a
subset of "living off the land" attacks.
For a subset of Electron functionality it makes sense to disable certain features for an entire application. For example, 99% of apps don't make use of `ELECTRON_RUN_AS_NODE`, these applications want to be able to ship a binary that is incapable of using that feature. We also don't want Electron consumers building Electron from source as that is both a massive technical challenge and has a high cost of both time and money.
We also don't want Electron consumers forking to achieve this goal, as building from source and
maintaining a fork is a massive technical challenge and costs a lot of time and money.
Fuses are the solution to this problem, at a high level they are "magic bits" in the Electron binary that can be flipped when packaging your Electron app to enable / disable certain features / restrictions. Because they are flipped at package time before you code sign your app the OS becomes responsible for ensuring those bits aren't flipped back via OS level code signing validation (Gatekeeper / App Locker).
Fuses are the solution to this problem. At a high level, they are "magic bits" in the Electron binary
that can be flipped when packaging your Electron app to enable or disable certain features/restrictions.
Because they are flipped at package time before you code sign your app, the OS becomes responsible
for ensuring those bits aren't flipped back via OS-level code signing validation
(e.g. [Gatekeeper](https://support.apple.com/en-ca/guide/security/sec5599b66df/web) on macOS or
[AppLocker](https://learn.microsoft.com/en-us/windows/security/application-security/application-control/app-control-for-business/applocker/applocker-overview)
on Windows).
## Current fuses
## Current Fuses
### `runAsNode`
@@ -29,11 +16,7 @@ on Windows).
**@electron/fuses:** `FuseV1Options.RunAsNode`
The `runAsNode` fuse toggles whether the [`ELECTRON_RUN_AS_NODE`](../api/environment-variables.md)
environment variable is respected or not. With this fuse disabled, [`child_process.fork`](https://nodejs.org/api/child_process.html#child_processforkmodulepath-args-options) in the main process will not function
as expected, as it depends on this environment variable to function. Instead, we recommend that you
use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a
standalone Node.js process (e.g. a SQLite server process).
The runAsNode fuse toggles whether the `ELECTRON_RUN_AS_NODE` environment variable is respected or not. Please note that if this fuse is disabled then `process.fork` in the main process will not function as expected as it depends on this environment variable to function. Instead, we recommend that you use [Utility Processes](../api/utility-process.md), which work for many use cases where you need a standalone Node.js process (like a Sqlite server process or similar scenarios).
### `cookieEncryption`
@@ -41,12 +24,7 @@ standalone Node.js process (e.g. a SQLite server process).
**@electron/fuses:** `FuseV1Options.EnableCookieEncryption`
The `cookieEncryption` fuse toggles whether the cookie store on disk is encrypted using OS level
cryptography keys. By default, the SQLite database that Chromium uses to store cookies stores the
values in plaintext. If you wish to ensure your app's cookies are encrypted in the same way Chrome
does, then you should enable this fuse. Please note it is a one-way transition—if you enable this
fuse, existing unencrypted cookies will be encrypted-on-write, but subsequently disabling the fuse
later will make your cookie store corrupt and useless. Most apps can safely enable this fuse.
The cookieEncryption fuse toggles whether the cookie store on disk is encrypted using OS level cryptography keys. By default the sqlite database that Chromium uses to store cookies stores the values in plaintext. If you wish to ensure your apps cookies are encrypted in the same way Chrome does then you should enable this fuse. Please note it is a one-way transition, if you enable this fuse existing unencrypted cookies will be encrypted-on-write but if you then disable the fuse again your cookie store will effectively be corrupt and useless. Most apps can safely enable this fuse.
### `nodeOptions`
@@ -54,11 +32,7 @@ later will make your cookie store corrupt and useless. Most apps can safely enab
**@electron/fuses:** `FuseV1Options.EnableNodeOptionsEnvironmentVariable`
The `nodeOptions` fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions)
and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile)
environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all
kinds of custom options to the Node.js runtime and isn't typically used by apps in production.
Most apps can safely disable this fuse.
The nodeOptions fuse toggles whether the [`NODE_OPTIONS`](https://nodejs.org/api/cli.html#node_optionsoptions) and [`NODE_EXTRA_CA_CERTS`](https://github.com/nodejs/node/blob/main/doc/api/cli.md#node_extra_ca_certsfile) environment variables are respected. The `NODE_OPTIONS` environment variable can be used to pass all kinds of custom options to the Node.js runtime and isn't typically used by apps in production. Most apps can safely disable this fuse.
### `nodeCliInspect`
@@ -66,9 +40,7 @@ Most apps can safely disable this fuse.
**@electron/fuses:** `FuseV1Options.EnableNodeCliInspectArguments`
The `nodeCliInspect` fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected
or not. When disabled, it also ensures that `SIGUSR1` signal does not initialize the main process
inspector. Most apps can safely disable this fuse.
The nodeCliInspect fuse toggles whether the `--inspect`, `--inspect-brk`, etc. flags are respected or not. When disabled it also ensures that `SIGUSR1` signal does not initialize the main process inspector. Most apps can safely disable this fuse.
### `embeddedAsarIntegrityValidation`
@@ -76,12 +48,9 @@ inspector. Most apps can safely disable this fuse.
**@electron/fuses:** `FuseV1Options.EnableEmbeddedAsarIntegrityValidation`
The `embeddedAsarIntegrityValidation` fuse toggles a feature on macOS and Windows that validates the
content of the `app.asar` file when it is loaded. This feature is designed to have a minimal
performance impact but may marginally slow down file reads from inside the `app.asar` archive.
Most apps can safely enable this fuse.
The embeddedAsarIntegrityValidation fuse toggles an experimental feature on macOS and Windows that validates the content of the `app.asar` file when it is loaded. This feature is designed to have a minimal performance impact but may marginally slow down file reads from inside the `app.asar` archive.
For more information on how to use ASAR integrity validation, please read the [Asar Integrity](asar-integrity.md) documentation.
For more information on how to use asar integrity validation please read the [Asar Integrity](asar-integrity.md) documentation.
### `onlyLoadAppFromAsar`
@@ -89,15 +58,7 @@ For more information on how to use ASAR integrity validation, please read the [A
**@electron/fuses:** `FuseV1Options.OnlyLoadAppFromAsar`
The `onlyLoadAppFromAsar` fuse changes the search system that Electron uses to locate your app code.
By default, Electron will search for this code in the following order:
1. `app.asar`
1. `app`
1. `default_app.asar`
When this fuse is enabled, Electron will _only_ search for `app.asar`. When combined with the [`embeddedAsarIntegrityValidation`](#embeddedasarintegrityvalidation) fuse, this fuse ensures that
it is impossible to load non-validated code.
The onlyLoadAppFromAsar fuse changes the search system that Electron uses to locate your app code. By default Electron will search in the following order `app.asar` -> `app` -> `default_app.asar`. When this fuse is enabled the search order becomes a single entry `app.asar` thus ensuring that when combined with the `embeddedAsarIntegrityValidation` fuse it is impossible to load non-validated code.
### `loadBrowserProcessSpecificV8Snapshot`
@@ -105,17 +66,11 @@ it is impossible to load non-validated code.
**@electron/fuses:** `FuseV1Options.LoadBrowserProcessSpecificV8Snapshot`
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of
initialized heaps and then load them back in to avoid the cost of initializing the heap.
The loadBrowserProcessSpecificV8Snapshot fuse changes which V8 snapshot file is used for the browser process. By default Electron's processes will all use the same V8 snapshot file. When this fuse is enabled the browser process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot. The other processes will use the V8 snapshot file that they normally do.
The `loadBrowserProcessSpecificV8Snapshot` fuse changes which V8 snapshot file is used for the browser
process. By default, Electron's processes will all use the same V8 snapshot file. When this fuse is
enabled, the main process uses the file called `browser_v8_context_snapshot.bin` for its V8 snapshot.
Other processes will use the V8 snapshot file that they normally do.
V8 snapshots can be useful to improve app startup performance. V8 lets you take snapshots of initialized heaps and then load them back in to avoid the cost of initializing the heap.
Using separate snapshots for renderer processes and the main process can improve security, especially
to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled.
See [electron/electron#35170](https://github.com/electron/electron/issues/35170) for details.
Using separate snapshots for renderer processes and the main process can improve security, especially to make sure that the renderer doesn't use a snapshot with `nodeIntegration` enabled. See [#35170](https://github.com/electron/electron/issues/35170) for details.
### `grantFileProtocolExtraPrivileges`
@@ -123,25 +78,19 @@ See [electron/electron#35170](https://github.com/electron/electron/issues/35170)
**@electron/fuses:** `FuseV1Options.GrantFileProtocolExtraPrivileges`
The `grantFileProtocolExtraPrivileges` fuse changes whether pages loaded from the `file://` protocol
are given privileges beyond what they would receive in a traditional web browser. This behavior was
core to Electron apps in original versions of Electron, but is no longer required as apps should be
[serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead.
If you aren't serving pages from `file://`, you should disable this fuse.
The grantFileProtocolExtraPrivileges fuse changes whether pages loaded from the `file://` protocol are given privileges beyond what they would receive in a traditional web browser. This behavior was core to Electron apps in original versions of Electron but is no longer required as apps should be [serving local files from custom protocols](./security.md#18-avoid-usage-of-the-file-protocol-and-prefer-usage-of-custom-protocols) now instead. If you aren't serving pages from `file://` you should disable this fuse.
The extra privileges granted to the `file://` protocol by this fuse are incompletely documented below:
* `file://` protocol pages can use `fetch` to load other assets over `file://`
* `file://` protocol pages can use service workers
* `file://` protocol pages have universal access granted to child frames also running on `file://`
protocols regardless of sandbox settings
* `file://` protocol pages have universal access granted to child frames also running on `file://` protocols regardless of sandbox settings
## How do I flip fuses?
## How do I flip the fuses?
### The easy way
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a JavaScript utility designed to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
We've made a handy module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make flipping these fuses easy. Check out the README of that module for more details on usage and potential error cases.
```js @ts-nocheck
const { flipFuses, FuseVersion, FuseV1Options } = require('@electron/fuses')
@@ -157,37 +106,29 @@ flipFuses(
)
```
You can validate the fuses that have been flipped or check the fuse status of an arbitrary Electron
app using the `@electron/fuses` CLI.
You can validate the fuses have been flipped or check the fuse status of an arbitrary Electron app using the fuses CLI.
```bash
npx @electron/fuses read --app /Applications/Foo.app
```
>[!NOTE]
> If you are using Electron Forge to distribute your application, you can flip fuses using
> [`@electron-forge/plugin-fuses`](https://www.electronforge.io/config/plugins/fuses),
> which comes pre-installed with all templates.
### The hard way
> [!IMPORTANT]
> Glossary:
>
> * **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
> * **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
> * **Fuse Schema**: The format/allowed values for the fuse wire
#### Quick Glossary
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the
sequence of bytes that represent the state of the fuses you want.
* **Fuse Wire**: A sequence of bytes in the Electron binary used to control the fuses
* **Sentinel**: A static known sequence of bytes you can use to locate the fuse wire
* **Fuse Schema**: The format / allowed values for the fuse wire
Somewhere in the Electron binary, there will be a sequence of bytes that look like this:
Manually flipping fuses requires editing the Electron binary and modifying the fuse wire to be the sequence of bytes that represent the state of the fuses you want.
Somewhere in the Electron binary there will be a sequence of bytes that look like this:
```text
| ...binary | sentinel_bytes | fuse_version | fuse_wire_length | fuse_wire | ...binary |
```
* `sentinel_bytes` is always this exact string: `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `sentinel_bytes` is always this exact string `dL7pKGdnNz796PbbjQWNKmHXBZaB9tsX`
* `fuse_version` is a single byte whose unsigned integer value represents the version of the fuse schema
* `fuse_wire_length` is a single byte whose unsigned integer value represents the number of fuses in the following fuse wire
* `fuse_wire` is a sequence of N bytes, each byte represents a single fuse and its state.
@@ -195,6 +136,6 @@ Somewhere in the Electron binary, there will be a sequence of bytes that look li
* "1" (0x31) indicates the fuse is enabled
* "r" (0x72) indicates the fuse has been removed and changing the byte to either 1 or 0 will have no effect.
To flip a fuse, you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
To flip a fuse you find its position in the fuse wire and change it to "0" or "1" depending on the state you'd like.
You can view the current schema [here](https://github.com/electron/electron/blob/main/build/fuses/fuses.json5).

View File

@@ -98,7 +98,7 @@ either `process.env` or the `window` object.
You should at least follow these steps to improve the security of your application:
1. [Only load secure content](#1-only-load-secure-content)
2. [Do not enable Node.js integration for remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
2. [Disable the Node.js integration in all renderers that display remote content](#2-do-not-enable-nodejs-integration-for-remote-content)
3. [Enable context isolation in all renderers](#3-enable-context-isolation)
4. [Enable process sandboxing](#4-enable-process-sandboxing)
5. [Use `ses.setPermissionRequestHandler()` in all sessions that load remote content](#5-handle-session-permission-requests-from-remote-content)
@@ -299,7 +299,7 @@ const { session } = require('electron')
const { URL } = require('node:url')
session
.defaultSession
.fromPartition('some-partition')
.setPermissionRequestHandler((webContents, permission, callback) => {
const parsedUrl = new URL(webContents.getURL())
@@ -316,8 +316,6 @@ session
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
### 6. Do not disable `webSecurity`
:::info
@@ -408,8 +406,6 @@ session.defaultSession.webRequest.onHeadersReceived((details, callback) => {
})
```
Note: `session.defaultSession` is only available after `app.whenReady` is called.
#### CSP meta tag
CSP's preferred delivery mechanism is an HTTP header. However, it is not possible
@@ -822,10 +818,10 @@ that your application might have the rights for.
#### How?
[`@electron/fuses`](https://npmjs.com/package/@electron/fuses) is a module we made to make
We've made a module, [`@electron/fuses`](https://npmjs.com/package/@electron/fuses), to make
flipping these fuses easy. Check out the README of that module for more details on usage and
potential error cases, and refer to
[How do I flip fuses?](./fuses.md#how-do-i-flip-fuses) in our documentation.
[How do I flip the fuses?](./fuses.md#how-do-i-flip-the-fuses) in our documentation.
### 20. Do not expose Electron APIs to untrusted web content

View File

@@ -82,7 +82,6 @@ auto_filenames = {
"docs/api/structures/browser-window-options.md",
"docs/api/structures/certificate-principal.md",
"docs/api/structures/certificate.md",
"docs/api/structures/color-space.md",
"docs/api/structures/cookie.md",
"docs/api/structures/cpu-usage.md",
"docs/api/structures/crash-report.md",
@@ -144,7 +143,6 @@ auto_filenames = {
"docs/api/structures/service-worker-info.md",
"docs/api/structures/shared-dictionary-info.md",
"docs/api/structures/shared-dictionary-usage-info.md",
"docs/api/structures/shared-texture-handle.md",
"docs/api/structures/shared-worker-info.md",
"docs/api/structures/sharing-item.md",
"docs/api/structures/shortcut-details.md",

View File

@@ -629,6 +629,8 @@ filenames = {
"shell/common/gin_converters/usb_device_info_converter.h",
"shell/common/gin_converters/value_converter.cc",
"shell/common/gin_converters/value_converter.h",
"shell/common/gin_helper/arguments.cc",
"shell/common/gin_helper/arguments.h",
"shell/common/gin_helper/callback.cc",
"shell/common/gin_helper/callback.h",
"shell/common/gin_helper/cleaned_up_at_exit.cc",

View File

@@ -217,7 +217,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__atomic/check_memory_order.h",
"//third_party/libc++/src/include/__atomic/contention_t.h",
"//third_party/libc++/src/include/__atomic/fence.h",
"//third_party/libc++/src/include/__atomic/floating_point_helper.h",
"//third_party/libc++/src/include/__atomic/is_always_lock_free.h",
"//third_party/libc++/src/include/__atomic/kill_dependency.h",
"//third_party/libc++/src/include/__atomic/memory_order.h",
@@ -841,6 +840,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cmath",
"//third_party/libc++/src/include/__cxx03/codecvt",
"//third_party/libc++/src/include/__cxx03/complex",
"//third_party/libc++/src/include/__cxx03/complex.h",
"//third_party/libc++/src/include/__cxx03/condition_variable",
"//third_party/libc++/src/include/__cxx03/csetjmp",
"//third_party/libc++/src/include/__cxx03/csignal",
@@ -853,20 +853,25 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/cstring",
"//third_party/libc++/src/include/__cxx03/ctgmath",
"//third_party/libc++/src/include/__cxx03/ctime",
"//third_party/libc++/src/include/__cxx03/ctype.h",
"//third_party/libc++/src/include/__cxx03/cuchar",
"//third_party/libc++/src/include/__cxx03/cwchar",
"//third_party/libc++/src/include/__cxx03/cwctype",
"//third_party/libc++/src/include/__cxx03/deque",
"//third_party/libc++/src/include/__cxx03/errno.h",
"//third_party/libc++/src/include/__cxx03/exception",
"//third_party/libc++/src/include/__cxx03/experimental/__config",
"//third_party/libc++/src/include/__cxx03/experimental/utility",
"//third_party/libc++/src/include/__cxx03/ext/__hash",
"//third_party/libc++/src/include/__cxx03/ext/hash_map",
"//third_party/libc++/src/include/__cxx03/ext/hash_set",
"//third_party/libc++/src/include/__cxx03/fenv.h",
"//third_party/libc++/src/include/__cxx03/float.h",
"//third_party/libc++/src/include/__cxx03/forward_list",
"//third_party/libc++/src/include/__cxx03/fstream",
"//third_party/libc++/src/include/__cxx03/functional",
"//third_party/libc++/src/include/__cxx03/future",
"//third_party/libc++/src/include/__cxx03/inttypes.h",
"//third_party/libc++/src/include/__cxx03/iomanip",
"//third_party/libc++/src/include/__cxx03/ios",
"//third_party/libc++/src/include/__cxx03/iosfwd",
@@ -893,8 +898,11 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/sstream",
"//third_party/libc++/src/include/__cxx03/stack",
"//third_party/libc++/src/include/__cxx03/stdatomic.h",
"//third_party/libc++/src/include/__cxx03/stdbool.h",
"//third_party/libc++/src/include/__cxx03/stddef.h",
"//third_party/libc++/src/include/__cxx03/stdexcept",
"//third_party/libc++/src/include/__cxx03/stdint.h",
"//third_party/libc++/src/include/__cxx03/stdio.h",
"//third_party/libc++/src/include/__cxx03/stdlib.h",
"//third_party/libc++/src/include/__cxx03/streambuf",
"//third_party/libc++/src/include/__cxx03/string",
@@ -902,6 +910,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/string_view",
"//third_party/libc++/src/include/__cxx03/strstream",
"//third_party/libc++/src/include/__cxx03/system_error",
"//third_party/libc++/src/include/__cxx03/tgmath.h",
"//third_party/libc++/src/include/__cxx03/thread",
"//third_party/libc++/src/include/__cxx03/type_traits",
"//third_party/libc++/src/include/__cxx03/typeindex",
@@ -914,6 +923,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__cxx03/vector",
"//third_party/libc++/src/include/__cxx03/version",
"//third_party/libc++/src/include/__cxx03/wchar.h",
"//third_party/libc++/src/include/__cxx03/wctype.h",
"//third_party/libc++/src/include/__debug_utils/randomize_range.h",
"//third_party/libc++/src/include/__debug_utils/sanitizers.h",
"//third_party/libc++/src/include/__debug_utils/strict_weak_ordering_check.h",
@@ -1024,12 +1034,14 @@ libcxx_headers = [
"//third_party/libc++/src/include/__fwd/get.h",
"//third_party/libc++/src/include/__fwd/ios.h",
"//third_party/libc++/src/include/__fwd/istream.h",
"//third_party/libc++/src/include/__fwd/map.h",
"//third_party/libc++/src/include/__fwd/mdspan.h",
"//third_party/libc++/src/include/__fwd/memory.h",
"//third_party/libc++/src/include/__fwd/memory_resource.h",
"//third_party/libc++/src/include/__fwd/ostream.h",
"//third_party/libc++/src/include/__fwd/pair.h",
"//third_party/libc++/src/include/__fwd/queue.h",
"//third_party/libc++/src/include/__fwd/set.h",
"//third_party/libc++/src/include/__fwd/span.h",
"//third_party/libc++/src/include/__fwd/sstream.h",
"//third_party/libc++/src/include/__fwd/stack.h",
@@ -1355,9 +1367,11 @@ libcxx_headers = [
"//third_party/libc++/src/include/__tree",
"//third_party/libc++/src/include/__tuple/find_index.h",
"//third_party/libc++/src/include/__tuple/ignore.h",
"//third_party/libc++/src/include/__tuple/make_tuple_types.h",
"//third_party/libc++/src/include/__tuple/sfinae_helpers.h",
"//third_party/libc++/src/include/__tuple/tuple_element.h",
"//third_party/libc++/src/include/__tuple/tuple_like.h",
"//third_party/libc++/src/include/__tuple/tuple_like_ext.h",
"//third_party/libc++/src/include/__tuple/tuple_like_no_subrange.h",
"//third_party/libc++/src/include/__tuple/tuple_size.h",
"//third_party/libc++/src/include/__tuple/tuple_types.h",
@@ -1367,6 +1381,7 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/aligned_storage.h",
"//third_party/libc++/src/include/__type_traits/aligned_union.h",
"//third_party/libc++/src/include/__type_traits/alignment_of.h",
"//third_party/libc++/src/include/__type_traits/can_extract_key.h",
"//third_party/libc++/src/include/__type_traits/common_reference.h",
"//third_party/libc++/src/include/__type_traits/common_type.h",
"//third_party/libc++/src/include/__type_traits/conditional.h",
@@ -1414,7 +1429,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_floating_point.h",
"//third_party/libc++/src/include/__type_traits/is_function.h",
"//third_party/libc++/src/include/__type_traits/is_fundamental.h",
"//third_party/libc++/src/include/__type_traits/is_generic_transparent_comparator.h",
"//third_party/libc++/src/include/__type_traits/is_implicit_lifetime.h",
"//third_party/libc++/src/include/__type_traits/is_implicitly_default_constructible.h",
"//third_party/libc++/src/include/__type_traits/is_integral.h",
@@ -1448,7 +1462,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/is_trivially_relocatable.h",
"//third_party/libc++/src/include/__type_traits/is_unbounded_array.h",
"//third_party/libc++/src/include/__type_traits/is_union.h",
"//third_party/libc++/src/include/__type_traits/is_unqualified.h",
"//third_party/libc++/src/include/__type_traits/is_unsigned.h",
"//third_party/libc++/src/include/__type_traits/is_valid_expansion.h",
"//third_party/libc++/src/include/__type_traits/is_void.h",
@@ -1457,7 +1470,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__type_traits/make_32_64_or_128_bit.h",
"//third_party/libc++/src/include/__type_traits/make_const_lvalue_ref.h",
"//third_party/libc++/src/include/__type_traits/make_signed.h",
"//third_party/libc++/src/include/__type_traits/make_transparent.h",
"//third_party/libc++/src/include/__type_traits/make_unsigned.h",
"//third_party/libc++/src/include/__type_traits/maybe_const.h",
"//third_party/libc++/src/include/__type_traits/nat.h",
@@ -1489,7 +1501,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/cmp.h",
"//third_party/libc++/src/include/__utility/convert_to_integral.h",
"//third_party/libc++/src/include/__utility/declval.h",
"//third_party/libc++/src/include/__utility/default_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/element_count.h",
"//third_party/libc++/src/include/__utility/empty.h",
"//third_party/libc++/src/include/__utility/exception_guard.h",
@@ -1500,7 +1511,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/integer_sequence.h",
"//third_party/libc++/src/include/__utility/is_pointer_in_range.h",
"//third_party/libc++/src/include/__utility/is_valid_range.h",
"//third_party/libc++/src/include/__utility/lazy_synth_three_way_comparator.h",
"//third_party/libc++/src/include/__utility/move.h",
"//third_party/libc++/src/include/__utility/no_destroy.h",
"//third_party/libc++/src/include/__utility/pair.h",
@@ -1512,7 +1522,6 @@ libcxx_headers = [
"//third_party/libc++/src/include/__utility/small_buffer.h",
"//third_party/libc++/src/include/__utility/swap.h",
"//third_party/libc++/src/include/__utility/to_underlying.h",
"//third_party/libc++/src/include/__utility/try_key_extraction.h",
"//third_party/libc++/src/include/__utility/unreachable.h",
"//third_party/libc++/src/include/__variant/monostate.h",
"//third_party/libc++/src/include/__vector/comparison.h",

View File

@@ -1,14 +1,11 @@
import { Menu } from 'electron/main';
import { EventEmitter } from 'events';
import * as fs from 'fs';
const bindings = process._linkedBinding('electron_browser_app');
const commandLine = process._linkedBinding('electron_common_command_line');
const { app } = bindings;
Object.setPrototypeOf(app, EventEmitter.prototype);
// Only one app object permitted.
export default app;

View File

@@ -119,7 +119,10 @@ export function fetchWithSession (input: RequestInfo, init: (RequestInit & {bypa
p.reject(err);
});
if (!req.body?.pipeTo(Writable.toWeb(r as unknown as Writable)).then(() => r.end())) { r.end(); }
// pipeTo expects a WritableStream<Uint8Array>. Node.js' Writable.toWeb returns WritableStream<any>,
// which causes a TS structural mismatch.
const writable = Writable.toWeb(r as unknown as Writable) as unknown as WritableStream<Uint8Array>;
if (!req.body?.pipeTo(writable).then(() => r.end())) { r.end(); }
return p.promise;
}

View File

@@ -4,6 +4,8 @@ import { createReadStream } from 'fs';
import { Readable } from 'stream';
import { ReadableStream } from 'stream/web';
import type { ReadableStreamDefaultReader } from 'stream/web';
// Global protocol APIs.
const { registerSchemesAsPrivileged, getStandardSchemes, Protocol } = process._linkedBinding('electron_browser_protocol');
@@ -12,7 +14,7 @@ const ERR_UNEXPECTED = -9;
const isBuiltInScheme = (scheme: string) => ['http', 'https', 'file'].includes(scheme);
function makeStreamFromPipe (pipe: any): ReadableStream {
function makeStreamFromPipe (pipe: any): ReadableStream<Uint8Array> {
const buf = new Uint8Array(1024 * 1024 /* 1 MB */);
return new ReadableStream({
async pull (controller) {
@@ -38,21 +40,26 @@ function makeStreamFromFileInfo ({
filePath: string;
offset?: number;
length?: number;
}): ReadableStream {
}): ReadableStream<Uint8Array> {
// Node's Readable.toWeb produces a WHATWG ReadableStream whose chunks are Uint8Array.
return Readable.toWeb(createReadStream(filePath, {
start: offset,
end: length >= 0 ? offset + length : undefined
}));
})) as ReadableStream<Uint8Array>;
}
function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): RequestInit['body'] {
if (!uploadData) return null;
// Optimization: skip creating a stream if the request is just a single buffer.
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') return uploadData[0].bytes;
if (uploadData.length === 1 && (uploadData[0] as any).type === 'rawData') {
return uploadData[0].bytes as any;
}
const chunks = [...uploadData] as any[]; // TODO: types are wrong
let current: ReadableStreamDefaultReader | null = null;
return new ReadableStream({
const chunks = [...uploadData] as any[]; // TODO: refine ProtocolRequest types
// Use Node's web stream types explicitly to avoid DOM lib vs Node lib structural mismatches.
// Generic <Uint8Array> ensures reader.read() returns value?: Uint8Array consistent with enqueue.
let current: ReadableStreamDefaultReader<Uint8Array> | null = null;
return new ReadableStream<Uint8Array>({
async pull (controller) {
if (current) {
const { done, value } = await current.read();
@@ -67,7 +74,7 @@ function convertToRequestBody (uploadData: ProtocolRequest['uploadData']): Reque
if (!chunks.length) { return controller.close(); }
const chunk = chunks.shift()!;
if (chunk.type === 'rawData') {
controller.enqueue(chunk.bytes);
controller.enqueue(chunk.bytes as Uint8Array);
} else if (chunk.type === 'file') {
current = makeStreamFromFileInfo(chunk).getReader();
return this.pull!(controller);

View File

@@ -882,7 +882,7 @@ export function create (options = {}): Electron.WebContents {
return new (WebContents as any)(options);
}
export function fromId (id: number) {
export function fromId (id: string) {
return binding.fromId(id);
}

View File

@@ -40,7 +40,7 @@ process.on('uncaughtException', function (error) {
// Emit 'exit' event on quit.
const { app } = require('electron');
app.on('quit', (_event, exitCode) => {
app.on('quit', (_event: any, exitCode: number) => {
process.emit('exit', exitCode);
});

View File

@@ -91,12 +91,6 @@ export function parseFeatures (features: string) {
delete parsed[key];
}
// Per spec - https://html.spec.whatwg.org/multipage/nav-history-apis.html#dom-open-dev
// windows are always resizable.
if (parsed.resizable !== undefined) {
delete parsed.resizable;
}
if (parsed.left !== undefined) parsed.x = parsed.left;
if (parsed.top !== undefined) parsed.y = parsed.top;

View File

@@ -289,7 +289,8 @@ function parseOptions (optionsIn: ClientRequestConstructorOptions | string): Nod
referrerPolicy: options.referrerPolicy,
cache: options.cache,
allowNonHttpProtocols: Object.hasOwn(options, kAllowNonHttpProtocols),
priority: options.priority
priority: options.priority,
bypassCustomProtocolHandlers: options.bypassCustomProtocolHandlers
};
if ('priorityIncremental' in options) {
urlLoaderOptions.priorityIncremental = options.priorityIncremental;

View File

@@ -5,9 +5,7 @@ const proc = require('child_process');
const electron = require('./');
const child = proc.spawn(electron, process.argv.slice(2), { stdio: 'inherit', windowsHide: false });
let childClosed = false;
child.on('close', function (code, signal) {
childClosed = true;
if (code === null) {
console.error(electron, 'exited with signal', signal);
process.exit(1);
@@ -17,7 +15,7 @@ child.on('close', function (code, signal) {
const handleTerminationSignal = function (signal) {
process.on(signal, function signalHandler () {
if (!childClosed) {
if (!child.killed) {
child.kill(signal);
}
});
@@ -25,4 +23,3 @@ const handleTerminationSignal = function (signal) {
handleTerminationSignal('SIGINT');
handleTerminationSignal('SIGTERM');
handleTerminationSignal('SIGUSR2');

View File

@@ -1,22 +1,23 @@
{
"name": "electron",
"name": "@electron-ci/dev-root",
"version": "0.0.0-development",
"repository": "https://github.com/electron/electron",
"description": "Build cross platform desktop apps with JavaScript, HTML, and CSS",
"devDependencies": {
"@azure/storage-blob": "^12.28.0",
"@azure/storage-blob": "^12.25.0",
"@datadog/datadog-ci": "^4.1.2",
"@electron/asar": "^3.2.13",
"@electron/docs-parser": "^2.0.0",
"@electron/fiddle-core": "^1.3.4",
"@electron/github-app-auth": "^2.2.1",
"@electron/lint-roller": "^3.1.2",
"@electron/typescript-definitions": "^9.1.5",
"@octokit/rest": "^20.1.2",
"@electron/github-app-auth": "^3.2.0",
"@electron/lint-roller": "^3.1.1",
"@electron/typescript-definitions": "^9.1.2",
"@octokit/rest": "^20.0.2",
"@primer/octicons": "^10.0.0",
"@types/minimist": "^1.2.5",
"@types/node": "^22.7.7",
"@types/semver": "^7.5.8",
"@types/stream-json": "^1.7.8",
"@types/stream-json": "^1.7.7",
"@types/temp": "^0.9.4",
"@typescript-eslint/eslint-plugin": "^8.32.1",
"@typescript-eslint/parser": "^8.7.0",
@@ -24,7 +25,6 @@
"buffer": "^6.0.3",
"chalk": "^4.1.0",
"check-for-leaks": "^1.2.1",
"dugite": "^2.7.1",
"eslint": "^8.57.1",
"eslint-config-standard": "^17.1.0",
"eslint-plugin-import": "^2.32.0",
@@ -34,29 +34,31 @@
"eslint-plugin-node": "^11.1.0",
"eslint-plugin-promise": "^6.6.0",
"events": "^3.2.0",
"folder-hash": "^4.1.1",
"folder-hash": "^2.1.1",
"got": "^11.8.5",
"husky": "^9.1.7",
"lint-staged": "^16.1.0",
"markdownlint-cli2": "^0.18.0",
"minimist": "^1.2.8",
"node-gyp": "^11.4.2",
"null-loader": "^4.0.1",
"pre-flight": "^2.0.0",
"process": "^0.11.10",
"remark-cli": "^12.0.1",
"remark-preset-lint-markdown-style-guide": "^6.0.1",
"remark-preset-lint-markdown-style-guide": "^4.0.0",
"semver": "^7.6.3",
"stream-json": "^1.9.1",
"stream-json": "^1.8.0",
"tap-xunit": "^2.4.1",
"temp": "^0.9.4",
"timers-browserify": "1.4.2",
"ts-loader": "^8.0.2",
"ts-node": "6.2.0",
"typescript": "^5.8.3",
"typescript": "^5.6.2",
"url": "^0.11.4",
"webpack": "^5.95.0",
"webpack-cli": "^6.0.1",
"wrapper-webpack-plugin": "^2.2.0"
"webpack-cli": "^5.1.4",
"wrapper-webpack-plugin": "^2.2.0",
"yaml": "^2.8.1"
},
"private": true,
"scripts": {
@@ -131,9 +133,25 @@
"DEPS": [
"node script/gen-hunspell-filenames.js",
"node script/gen-libc++-filenames.js"
],
".github/workflows/pipeline-segment-electron-build.yml": [
"node script/copy-pipeline-segment-publish.js",
"git add .github/workflows/pipeline-segment-electron-publish.yml"
]
},
"resolutions": {
"nan": "nodejs/nan#e14bdcd1f72d62bca1d541b66da43130384ec213"
"dbus-native/xml2js": "0.5.0",
"abstract-socket": "github:deepak1556/node-abstractsocket#928cc591decd12aff7dad96449da8afc29832c19",
"minimist@npm:~0.0.1": "0.2.4"
},
"packageManager": "yarn@4.12.0",
"workspaces": [
"spec",
"spec/fixtures/native-addon/*"
],
"dependenciesMeta": {
"abstract-socket": {
"built": true
}
}
}

1
patches/angle/.patches Normal file
View File

@@ -0,0 +1 @@
cherry-pick-2f564f1ca07b.patch

View File

@@ -0,0 +1,125 @@
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
From: Mark Mentovai <mark@chromium.org>
Date: Tue, 16 Sep 2025 16:46:36 -0400
Subject: mac: handle Metal toolchain being unbundled from Xcode 26
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
The Metal toolchain was formerly part of Xcode, but in Xcode 26, it has
been unbundled and is now a separate install. Attempting to use the
Metal toolchain without installing it results in a build error, such as:
error: error: cannot execute tool 'metal' due to missing Metal
Toolchain; use: xcodebuild -downloadComponent MetalToolchain
By running the suggested command, the Metal toolchain can be installed,
but the existing angle build does not know how to find it correctly.
For system Xcode installations, tools from the Metal toolchain (`metal`
and `metallib`) can be run via `xcrun`. This construct should work
equally well for older Xcode versions, for situations where its still
in use.
For the hermetic toolchain, well continue splicing the Metal toolchain
into the location it had previously been avialable (see
https://chromium-review.googlesource.com/c/6950738), although this is
subject to change in the future.
Bug: chromium:423933062, chromium:445400016
Change-Id: I139eca51938f7cecfec9b90fd488947160ef4ec9
Reviewed-on: https://chromium-review.googlesource.com/c/angle/angle/+/6955000
Auto-Submit: Mark Mentovai <mark@chromium.org>
Commit-Queue: Mark Mentovai <mark@chromium.org>
Reviewed-by: Geoff Lang <geofflang@chromium.org>
diff --git a/src/libANGLE/renderer/metal/BUILD.gn b/src/libANGLE/renderer/metal/BUILD.gn
index 96e9ee8420810f6a3ca9a0c290d4a654200eb7b9..50ac42a5b9a0f7c8b3b161af40c598cb34ff132a 100644
--- a/src/libANGLE/renderer/metal/BUILD.gn
+++ b/src/libANGLE/renderer/metal/BUILD.gn
@@ -24,20 +24,56 @@ config("angle_metal_backend_config") {
}
if (metal_internal_shader_compilation_supported) {
+ template("run_metal_tool") {
+ action(target_name) {
+ forward_variables_from(invoker,
+ [
+ "deps",
+ "sources",
+ "outputs",
+ "metal_tool",
+ ])
+ script = "shaders/metal_wrapper.py"
+ if (use_system_xcode) {
+ # System Xcode: run metal and metallib via xcrun. Since Xcode 26.0, the
+ # Metal toolchain has been unbundled from Xcode, and must be installed
+ # separately by running `xcodebuild -downloadComponent MetalToolchain`.
+ # There is a vestigial metal executable in mac_bin_path, but its
+ # incapable of running successfuly without the
+ # rest of the Metal toolchain surrounding it. `xcrun` is able to find
+ # and run the correct Metal toolchain when properly installed.
+ #
+ # If youre using system Xcode and your build fails with this message:
+ # error: error: cannot execute tool 'metal' due to missing Metal Toolchain; use: xcodebuild -downloadComponent MetalToolchain
+ # then do what the error message suggests, and then retry your build.
+ args = [
+ "xcrun",
+ metal_tool,
+ ]
+ } else {
+ # Hermetic Xcode: at least for now, the Metal toolchain is
+ # “spliced” into the location in the hermetic toolchain where it lived
+ # before Xcode 26.0, so it can be run directly from there.
+ args = [ mac_bin_path + metal_tool ]
+ }
+
+ args += invoker.args
+ }
+ }
+
_metal_internal_shaders_air_file =
"$root_gen_dir/angle/mtl_internal_shaders_autogen.air"
- action("angle_metal_internal_shaders_to_air") {
- script = "shaders/metal_wrapper.py"
-
- outputs = [ _metal_internal_shaders_air_file ]
-
+ run_metal_tool("angle_metal_internal_shaders_to_air") {
_metal_internal_shaders_metal_source =
"shaders/mtl_internal_shaders_autogen.metal"
sources = [ _metal_internal_shaders_metal_source ]
+ outputs = [ _metal_internal_shaders_air_file ]
+
+ metal_tool = "metal"
+
args = [
- mac_bin_path + "metal",
"-c",
rebase_path(_metal_internal_shaders_metal_source, root_build_dir),
"-o",
@@ -60,17 +96,16 @@ if (metal_internal_shader_compilation_supported) {
_metal_internal_shaders_metallib_file =
"$root_gen_dir/angle/mtl_internal_shaders_autogen.metallib"
- action("angle_metal_internal_shaders_to_mtllib") {
- script = "shaders/metal_wrapper.py"
-
- outputs = [ _metal_internal_shaders_metallib_file ]
+ run_metal_tool("angle_metal_internal_shaders_to_mtllib") {
+ deps = [ ":angle_metal_internal_shaders_to_air" ]
sources = [ _metal_internal_shaders_air_file ]
- deps = [ ":angle_metal_internal_shaders_to_air" ]
+ outputs = [ _metal_internal_shaders_metallib_file ]
+
+ metal_tool = "metallib"
args = [
- mac_bin_path + "metallib",
rebase_path(_metal_internal_shaders_air_file, root_build_dir),
"-o",
rebase_path(_metal_internal_shaders_metallib_file, root_build_dir),

View File

@@ -10,10 +10,10 @@ this patch is required to provide ripemd160 support in the nodejs crypto
module.
diff --git a/crypto/digest/digest_extra.cc b/crypto/digest/digest_extra.cc
index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47b9e3034f 100644
index 431214277314941c5ec031f03ad09e7f22800983..4cc48bbc3f8434876f35767c1a9f01d27388be99 100644
--- a/crypto/digest/digest_extra.cc
+++ b/crypto/digest/digest_extra.cc
@@ -47,6 +47,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
@@ -46,6 +46,7 @@ static const struct nid_to_digest nid_to_digest_mapping[] = {
{NID_sha512, EVP_sha512, SN_sha512, LN_sha512},
{NID_sha512_256, EVP_sha512_256, SN_sha512_256, LN_sha512_256},
{NID_md5_sha1, EVP_md5_sha1, SN_md5_sha1, LN_md5_sha1},
@@ -22,7 +22,7 @@ index ea1709ae6b50faedc786c0eaeb5f9002fd0db7d8..5b0ed4dc6aaf3fafad034e9ecc62cd47
// hash function when given a signature OID. To avoid unintended lax parsing
// of hash OIDs, this is no longer supported for lookup by OID or NID.
diff --git a/crypto/fipsmodule/digest/digests.cc.inc b/crypto/fipsmodule/digest/digests.cc.inc
index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649679d772b 100644
index 99e3a66c0a47818ccb039f8ccc41ea50e529a16d..dc50fd05bed6cb40bffe1c0f6f3019d25d351ba2 100644
--- a/crypto/fipsmodule/digest/digests.cc.inc
+++ b/crypto/fipsmodule/digest/digests.cc.inc
@@ -18,6 +18,7 @@
@@ -62,27 +62,27 @@ index 3a3bfd3f0560fcd7b5fdbdf4cc29a56e0346b90a..a7335ca03b5b3b918c4321d890b45649
+
#undef CHECK
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
index feaf17c72cecb8099bc11ac10747fbad719ddca9..891a73f229e3f0838cb2fa99b8fb24fdeac1962b 100644
index e04b80cd6a1a215fc87f8fd8d750c3d258c3974f..8fdf1c624794f568bfc77b7b6b0c510b23905a4d 100644
--- a/decrepit/evp/evp_do_all.cc
+++ b/decrepit/evp/evp_do_all.cc
@@ -79,6 +79,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
callback(EVP_sha384(), "SHA384", nullptr, arg);
callback(EVP_sha512(), "SHA512", nullptr, arg);
callback(EVP_sha512_256(), "SHA512-256", nullptr, arg);
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
callback(EVP_sha384(), "SHA384", NULL, arg);
callback(EVP_sha512(), "SHA512", NULL, arg);
callback(EVP_sha512_256(), "SHA512-256", NULL, arg);
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
callback(EVP_md4(), "md4", nullptr, arg);
callback(EVP_md5(), "md5", nullptr, arg);
callback(EVP_md4(), "md4", NULL, arg);
callback(EVP_md5(), "md5", NULL, arg);
@@ -88,6 +89,7 @@ void EVP_MD_do_all_sorted(void (*callback)(const EVP_MD *cipher,
callback(EVP_sha384(), "sha384", nullptr, arg);
callback(EVP_sha512(), "sha512", nullptr, arg);
callback(EVP_sha512_256(), "sha512-256", nullptr, arg);
+ callback(EVP_ripemd160(), "ripemd160", nullptr, arg);
callback(EVP_sha384(), "sha384", NULL, arg);
callback(EVP_sha512(), "sha512", NULL, arg);
callback(EVP_sha512_256(), "sha512-256", NULL, arg);
+ callback(EVP_ripemd160(), "ripemd160", NULL, arg);
}
void EVP_MD_do_all(void (*callback)(const EVP_MD *cipher, const char *name,
diff --git a/include/openssl/digest.h b/include/openssl/digest.h
index a86c18926e7798a3b0aae70c53870e03b5acd0ab..f4f27f9e803533d8db50d89e7a0125384a025a46 100644
index 710c6e6d110378d1db10d8c2ae57b2d844c603b9..dbb1e0cd5e9480d1ac7a86cbca6fae29d6a8dca4 100644
--- a/include/openssl/digest.h
+++ b/include/openssl/digest.h
@@ -48,6 +48,9 @@ OPENSSL_EXPORT const EVP_MD *EVP_blake2b256(void);

View File

@@ -28,7 +28,7 @@ RC2 Ciphers: rc2-40-cbc
It's unclear whether this would be accepted upstream. We should try regardless.
diff --git a/crypto/cipher/get_cipher.cc b/crypto/cipher/get_cipher.cc
index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da0229687f 100644
index 2622dc78d1da236862312f55bc0a40f26116486e..ac7aff6518ad5c2a0e48bd91d60a1f825851b634 100644
--- a/crypto/cipher/get_cipher.cc
+++ b/crypto/cipher/get_cipher.cc
@@ -31,6 +31,7 @@ static const struct {
@@ -64,64 +64,64 @@ index 6513df01c4b3e4d33fc6b521d9aae78ec5499e73..52eb7fea420e3d81d274fd5c1e21e4da
const EVP_CIPHER *EVP_get_cipherbynid(int nid) {
diff --git a/decrepit/evp/evp_do_all.cc b/decrepit/evp/evp_do_all.cc
index 891a73f229e3f0838cb2fa99b8fb24fdeac1962b..f7d0c5dc66f016eb9338c15e7f5ef59e6de2969d 100644
index 8fdf1c624794f568bfc77b7b6b0c510b23905a4d..2e40c031e8c681fe921331b26dbf63f4df2fcf71 100644
--- a/decrepit/evp/evp_do_all.cc
+++ b/decrepit/evp/evp_do_all.cc
@@ -20,8 +20,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
const char *unused, void *arg),
void *arg) {
callback(EVP_aes_128_cbc(), "AES-128-CBC", nullptr, arg);
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", nullptr, arg);
callback(EVP_aes_192_cbc(), "AES-192-CBC", nullptr, arg);
callback(EVP_aes_256_cbc(), "AES-256-CBC", nullptr, arg);
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", nullptr, arg);
callback(EVP_aes_128_ctr(), "AES-128-CTR", nullptr, arg);
callback(EVP_aes_192_ctr(), "AES-192-CTR", nullptr, arg);
callback(EVP_aes_256_ctr(), "AES-256-CTR", nullptr, arg);
callback(EVP_aes_128_cbc(), "AES-128-CBC", NULL, arg);
+ callback(EVP_aes_128_cfb128(), "AES-128-CFB", NULL, arg);
callback(EVP_aes_192_cbc(), "AES-192-CBC", NULL, arg);
callback(EVP_aes_256_cbc(), "AES-256-CBC", NULL, arg);
+ callback(EVP_aes_256_cfb128(), "AES-256-CFB", NULL, arg);
callback(EVP_aes_128_ctr(), "AES-128-CTR", NULL, arg);
callback(EVP_aes_192_ctr(), "AES-192-CTR", NULL, arg);
callback(EVP_aes_256_ctr(), "AES-256-CTR", NULL, arg);
@@ -34,9 +36,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
callback(EVP_aes_128_gcm(), "AES-128-GCM", nullptr, arg);
callback(EVP_aes_192_gcm(), "AES-192-GCM", nullptr, arg);
callback(EVP_aes_256_gcm(), "AES-256-GCM", nullptr, arg);
+ callback(EVP_bf_cbc(), "BF-CBC", nullptr, arg);
+ callback(EVP_bf_cfb(), "BF-CFB", nullptr, arg);
+ callback(EVP_bf_ecb(), "BF-ECB", nullptr, arg);
callback(EVP_des_cbc(), "DES-CBC", nullptr, arg);
callback(EVP_des_ecb(), "DES-ECB", nullptr, arg);
callback(EVP_des_ede(), "DES-EDE", nullptr, arg);
+ callback(EVP_des_ede3(), "DES-EDE3", nullptr, arg);
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", nullptr, arg);
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", nullptr, arg);
callback(EVP_rc2_cbc(), "RC2-CBC", nullptr, arg);
callback(EVP_aes_128_gcm(), "AES-128-GCM", NULL, arg);
callback(EVP_aes_192_gcm(), "AES-192-GCM", NULL, arg);
callback(EVP_aes_256_gcm(), "AES-256-GCM", NULL, arg);
+ callback(EVP_bf_cbc(), "BF-CBC", NULL, arg);
+ callback(EVP_bf_cfb(), "BF-CFB", NULL, arg);
+ callback(EVP_bf_ecb(), "BF-ECB", NULL, arg);
callback(EVP_des_cbc(), "DES-CBC", NULL, arg);
callback(EVP_des_ecb(), "DES-ECB", NULL, arg);
callback(EVP_des_ede(), "DES-EDE", NULL, arg);
+ callback(EVP_des_ede3(), "DES-EDE3", NULL, arg);
callback(EVP_des_ede_cbc(), "DES-EDE-CBC", NULL, arg);
callback(EVP_des_ede3_cbc(), "DES-EDE3-CBC", NULL, arg);
callback(EVP_rc2_cbc(), "RC2-CBC", NULL, arg);
@@ -44,8 +50,10 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
// OpenSSL returns everything twice, the second time in lower case.
callback(EVP_aes_128_cbc(), "aes-128-cbc", nullptr, arg);
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", nullptr, arg);
callback(EVP_aes_192_cbc(), "aes-192-cbc", nullptr, arg);
callback(EVP_aes_256_cbc(), "aes-256-cbc", nullptr, arg);
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", nullptr, arg);
callback(EVP_aes_128_ctr(), "aes-128-ctr", nullptr, arg);
callback(EVP_aes_192_ctr(), "aes-192-ctr", nullptr, arg);
callback(EVP_aes_256_ctr(), "aes-256-ctr", nullptr, arg);
callback(EVP_aes_128_cbc(), "aes-128-cbc", NULL, arg);
+ callback(EVP_aes_128_cfb128(), "aes-128-cfb", NULL, arg);
callback(EVP_aes_192_cbc(), "aes-192-cbc", NULL, arg);
callback(EVP_aes_256_cbc(), "aes-256-cbc", NULL, arg);
+ callback(EVP_aes_256_cfb128(), "aes-256-cfb", NULL, arg);
callback(EVP_aes_128_ctr(), "aes-128-ctr", NULL, arg);
callback(EVP_aes_192_ctr(), "aes-192-ctr", NULL, arg);
callback(EVP_aes_256_ctr(), "aes-256-ctr", NULL, arg);
@@ -58,9 +66,13 @@ void EVP_CIPHER_do_all_sorted(void (*callback)(const EVP_CIPHER *cipher,
callback(EVP_aes_128_gcm(), "aes-128-gcm", nullptr, arg);
callback(EVP_aes_192_gcm(), "aes-192-gcm", nullptr, arg);
callback(EVP_aes_256_gcm(), "aes-256-gcm", nullptr, arg);
+ callback(EVP_bf_cbc(), "bf-cbc", nullptr, arg);
+ callback(EVP_bf_cfb(), "bf-cfb", nullptr, arg);
+ callback(EVP_bf_ecb(), "bf-ecb", nullptr, arg);
callback(EVP_des_cbc(), "des-cbc", nullptr, arg);
callback(EVP_des_ecb(), "des-ecb", nullptr, arg);
callback(EVP_des_ede(), "des-ede", nullptr, arg);
+ callback(EVP_des_ede3(), "des-ede3", nullptr, arg);
callback(EVP_des_ede_cbc(), "des-ede-cbc", nullptr, arg);
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", nullptr, arg);
callback(EVP_rc2_cbc(), "rc2-cbc", nullptr, arg);
callback(EVP_aes_128_gcm(), "aes-128-gcm", NULL, arg);
callback(EVP_aes_192_gcm(), "aes-192-gcm", NULL, arg);
callback(EVP_aes_256_gcm(), "aes-256-gcm", NULL, arg);
+ callback(EVP_bf_cbc(), "bf-cbc", NULL, arg);
+ callback(EVP_bf_cfb(), "bf-cfb", NULL, arg);
+ callback(EVP_bf_ecb(), "bf-ecb", NULL, arg);
callback(EVP_des_cbc(), "des-cbc", NULL, arg);
callback(EVP_des_ecb(), "des-ecb", NULL, arg);
callback(EVP_des_ede(), "des-ede", NULL, arg);
+ callback(EVP_des_ede3(), "des-ede3", NULL, arg);
callback(EVP_des_ede_cbc(), "des-ede-cbc", NULL, arg);
callback(EVP_des_ede3_cbc(), "des-ede3-cbc", NULL, arg);
callback(EVP_rc2_cbc(), "rc2-cbc", NULL, arg);
diff --git a/include/openssl/cipher.h b/include/openssl/cipher.h
index a5533caf45eaacc4baef4a73d97e9bc2b6e3a942..35f24c1b22ea2c6b4766c0d87e75b6fc6b459f79 100644
index 13e68ad20ac08a462bb577d7f99e2c6f167579fa..4960d0eeb8f31bec4347ed2a1b63beba530de700 100644
--- a/include/openssl/cipher.h
+++ b/include/openssl/cipher.h
@@ -461,6 +461,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
@@ -448,6 +448,7 @@ OPENSSL_EXPORT const EVP_CIPHER *EVP_des_ede3_ecb(void);
// EVP_aes_128_cfb128 is only available in decrepit.
OPENSSL_EXPORT const EVP_CIPHER *EVP_aes_128_cfb128(void);

View File

@@ -8,7 +8,7 @@ This reverts commit ebd8b8965c74ab06bb91f7a00b23822e1f1f26ca.
It is causing significant TLS failures in Node.js.
diff --git a/ssl/ssl_buffer.cc b/ssl/ssl_buffer.cc
index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad1655500d33 100644
index 2cdcbc346175eeee69402ecee7f169e61c655199..f7226fe711e4214b216ea2c5173a02124b80f9ef 100644
--- a/ssl/ssl_buffer.cc
+++ b/ssl/ssl_buffer.cc
@@ -230,7 +230,6 @@ int ssl_handle_open_record(SSL *ssl, bool *out_retry, ssl_open_record_t ret,
@@ -20,10 +20,10 @@ index 8c5c7bcd96229cfcfb605bd4728c52c3c03d6062..ad8f1e7a26c665fd471b62bd694aad16
case ssl_open_record_error:
diff --git a/ssl/ssl_lib.cc b/ssl/ssl_lib.cc
index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e517ea6ae2 100644
index aa8ef8a0c53978021b675e1d909c3f78045dbb7b..61794458f7a7a849d48a225533ef4f8431434e42 100644
--- a/ssl/ssl_lib.cc
+++ b/ssl/ssl_lib.cc
@@ -1211,7 +1211,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
@@ -1206,7 +1206,7 @@ int SSL_get_error(const SSL *ssl, int ret_code) {
}
if (ret_code == 0) {
@@ -32,7 +32,7 @@ index f64b103fbb7a298a22fe0ff4bc95a4415c58e305..9bc3e1c3114ae67c0eb6a31de05b85e5
return SSL_ERROR_ZERO_RETURN;
}
// An EOF was observed which violates the protocol, and the underlying
@@ -2672,13 +2672,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
@@ -2567,13 +2567,7 @@ void *SSL_CTX_get_ex_data(const SSL_CTX *ctx, int idx) {
return CRYPTO_get_ex_data(&ctx->ex_data, idx);
}

View File

@@ -110,6 +110,7 @@ fix_getcursorscreenpoint_wrongly_returns_0_0.patch
fix_add_support_for_skipping_first_2_no-op_refreshes_in_thumb_cap.patch
refactor_expose_file_system_access_blocklist.patch
feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
fix_font_face_resolution_when_renderer_is_blocked.patch
feat_enable_passing_exit_code_on_service_process_crash.patch
chore_remove_reference_to_chrome_browser_themes.patch
feat_enable_customizing_symbol_color_in_framecaptionbutton.patch
@@ -131,15 +132,12 @@ chore_grandfather_in_electron_views_and_delegates.patch
refactor_patch_electron_permissiontypes_into_blink.patch
revert_views_remove_desktopwindowtreehostwin_window_enlargement.patch
build_partial_revert_mac_fullscreen_top_chrome_mouse_events.patch
build_set_mac_sdk_minimum_to_10.patch
fix_add_macos_memory_query_fallback_to_avoid_crash.patch
fix_resolve_dynamic_background_material_update_issue_on_windows_11.patch
feat_add_support_for_embedder_snapshot_validation.patch
chore_restore_some_deprecated_wrapper_utility_in_gin.patch
chore_add_electron_objects_to_wrappablepointertag.patch
chore_expose_isolate_parameter_in_script_lifecycle_observers.patch
revert_partial_remove_unused_prehandlemouseevent.patch
allow_electron_to_depend_on_components_os_crypt_sync.patch
band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch
inspectorpageagent_provisional_frame_speculative_fix.patch
expose_referrerscriptinfo_hostdefinedoptionsindex.patch
chore_disable_protocol_handler_dcheck.patch
fix_check_for_file_existence_before_setting_mtime.patch
revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch
fix_release_mouse_buttons_on_focus_loss_on_wayland.patch
cherry-pick-e045399a1ecb.patch

View File

@@ -53,19 +53,19 @@ index 5ad9332dd27ceda7d67cd3f571b12218a4415a40..ffe083836c39fb60b4bff1f9fbdd6ceb
}
diff --git a/ui/base/accelerators/accelerator.h b/ui/base/accelerators/accelerator.h
index 666ecbc118bec6d51465644ae4e573846c33610b..5f578ea153477379bac69e48fbd4f41a9a24885e 100644
index e7d5adfac920c97df8bab9bf4ed69a835ee314a9..9aeea7cb4c48d1ccc27304fa99238151b2811c87 100644
--- a/ui/base/accelerators/accelerator.h
+++ b/ui/base/accelerators/accelerator.h
@@ -21,6 +21,7 @@
@@ -18,6 +18,7 @@
#include <vector>
#include "base/component_export.h"
+#include "third_party/abseil-cpp/absl/types/optional.h"
#include "base/time/time.h"
#include "build/blink_buildflags.h"
#include "build/build_config.h"
+#include "third_party/abseil-cpp/absl/types/optional.h"
#include "ui/events/event_constants.h"
#include "ui/events/keycodes/keyboard_codes.h"
@@ -199,6 +200,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
<< 18); // masked to 6 bits
@@ -189,6 +190,8 @@ class COMPONENT_EXPORT(UI_BASE) Accelerator {
return interrupted_by_mouse_event_;
}
+ absl::optional<char16_t> shifted_char;

View File

@@ -10,10 +10,10 @@ Allows Electron to restore WER when ELECTRON_DEFAULT_ERROR_MODE is set.
This should be upstreamed.
diff --git a/content/gpu/gpu_main.cc b/content/gpu/gpu_main.cc
index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f6f6636e5 100644
index f9e15ddeeb022b77607ae7880a5a7121abc7a111..954a4966c73a74816131217756f17c04483bb1fe 100644
--- a/content/gpu/gpu_main.cc
+++ b/content/gpu/gpu_main.cc
@@ -272,6 +272,10 @@ int GpuMain(MainFunctionParams parameters) {
@@ -271,6 +271,10 @@ int GpuMain(MainFunctionParams parameters) {
// to the GpuProcessHost once the GpuServiceImpl has started.
viz::GpuLogMessageManager::GetInstance()->InstallPreInitializeLogHandler();
@@ -24,7 +24,7 @@ index 30cc1d4a179f9da59824cb98415baed8493fc843..2272eaa7e0e3306201e5e32226a0115f
// We are experiencing what appear to be memory-stomp issues in the GPU
// process. These issues seem to be impacting the task executor and listeners
// registered to it. Create the task executor on the heap to guard against
@@ -381,7 +385,6 @@ int GpuMain(MainFunctionParams parameters) {
@@ -380,7 +384,6 @@ int GpuMain(MainFunctionParams parameters) {
#endif
const bool dead_on_arrival = !init_success;

View File

@@ -10,10 +10,10 @@ DidCreateScriptContext is called, not all JS APIs are available in the
context, which can cause some preload scripts to trip.
diff --git a/content/public/renderer/render_frame_observer.h b/content/public/renderer/render_frame_observer.h
index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b70297e4e 100644
index c26cff0adef977617b10bbaa7c0c13cf5e6e91d3..f9c7af85af33572a88956bf1bc9765e90be3d39b 100644
--- a/content/public/renderer/render_frame_observer.h
+++ b/content/public/renderer/render_frame_observer.h
@@ -141,6 +141,8 @@ class CONTENT_EXPORT RenderFrameObserver {
@@ -138,6 +138,8 @@ class CONTENT_EXPORT RenderFrameObserver {
virtual void DidHandleOnloadEvents() {}
virtual void DidCreateScriptContext(v8::Local<v8::Context> context,
int32_t world_id) {}
@@ -23,10 +23,10 @@ index 5196f155cdc641b66c4faa77d8b00097145a1290..bbfac47a74f989482343c222b78f187b
int32_t world_id) {}
virtual void DidClearWindowObject() {}
diff --git a/content/renderer/render_frame_impl.cc b/content/renderer/render_frame_impl.cc
index 298387873e7ded5f96c788bc53ad7256a8f5b13e..7e64e34a2ebd9738d33bfc9cc7fd827b8757037d 100644
index ede4414f875254b77ffb29d0e1bfb254c619b10f..5f766b7d1bd20131b380e862090716de899d086c 100644
--- a/content/renderer/render_frame_impl.cc
+++ b/content/renderer/render_frame_impl.cc
@@ -4659,6 +4659,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
@@ -4676,6 +4676,12 @@ void RenderFrameImpl::DidCreateScriptContext(v8::Local<v8::Context> context,
observer.DidCreateScriptContext(context, world_id);
}
@@ -40,7 +40,7 @@ index 298387873e7ded5f96c788bc53ad7256a8f5b13e..7e64e34a2ebd9738d33bfc9cc7fd827b
int world_id) {
for (auto& observer : observers_)
diff --git a/content/renderer/render_frame_impl.h b/content/renderer/render_frame_impl.h
index b6acf7101932961b4a81738e1fcda07efc714edc..32dfed04e2fd7cd2e60c7cf145d182f4163feb68 100644
index 5456a50df5f75509c22afa47034afbb624303a75..bbd1edd567aee984001288901581dfa56dbfa2dc 100644
--- a/content/renderer/render_frame_impl.h
+++ b/content/renderer/render_frame_impl.h
@@ -603,6 +603,8 @@ class CONTENT_EXPORT RenderFrameImpl
@@ -53,10 +53,10 @@ index b6acf7101932961b4a81738e1fcda07efc714edc..32dfed04e2fd7cd2e60c7cf145d182f4
int world_id) override;
void DidChangeScrollOffset() override;
diff --git a/third_party/blink/public/web/web_local_frame_client.h b/third_party/blink/public/web/web_local_frame_client.h
index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb39170da24 100644
index 5c1c325d1e4037b0b413c3519e963c5f0210086a..994dd3118dfa43816db60e5dfb61c00bf366e92d 100644
--- a/third_party/blink/public/web/web_local_frame_client.h
+++ b/third_party/blink/public/web/web_local_frame_client.h
@@ -667,6 +667,9 @@ class BLINK_EXPORT WebLocalFrameClient {
@@ -662,6 +662,9 @@ class BLINK_EXPORT WebLocalFrameClient {
virtual void DidCreateScriptContext(v8::Local<v8::Context>,
int32_t world_id) {}
@@ -67,10 +67,10 @@ index 5c1d0c1581b7ef6214f3dde6a4053a23c8673b74..4520c9edccf63bdb9e35bf3a99a8ddb3
virtual void WillReleaseScriptContext(v8::Local<v8::Context>,
int32_t world_id) {}
diff --git a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
index 3ce1ef340780075951fb8c1b65f2ec90569f34ef..898d7caac98727210ac5780b576526a71ec5a5aa 100644
index b963abd8c4bf6ffaea1930a8d1f647a8a8c266bc..2e8653654686f4fc775288f059ff27daa38e02d5 100644
--- a/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
+++ b/third_party/blink/renderer/bindings/core/v8/local_window_proxy.cc
@@ -217,6 +217,7 @@ void LocalWindowProxy::Initialize() {
@@ -216,6 +216,7 @@ void LocalWindowProxy::Initialize() {
}
InstallConditionalFeatures();
@@ -92,11 +92,11 @@ index 36baf908d3be8aed44ff60b8de2cffe2eee15efe..8d73ddb12013ce195026b9f63050cf33
int32_t world_id) = 0;
virtual bool AllowScriptExtensions() = 0;
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9ae8d3379f 100644
index 22f1a4a3a903cb82a1066642e542bb78bf321d79..77d76bf97976e18a8bd077e005b8a3addf9b029d 100644
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.cc
@@ -300,6 +300,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
}
@@ -295,6 +295,13 @@ void LocalFrameClientImpl::DidCreateScriptContext(
web_frame_->Client()->DidCreateScriptContext(context, world_id);
}
+void LocalFrameClientImpl::DidInstallConditionalFeatures(
@@ -110,7 +110,7 @@ index 019445e625257f909875adffdc5e967fb65a3728..11475d1a22054a884f2f1e7e5c933e9a
v8::Local<v8::Context> context,
int32_t world_id) {
diff --git a/third_party/blink/renderer/core/frame/local_frame_client_impl.h b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e5844349c0b5 100644
index 081c8fabbcc514e47ff33d7e07a5eac3d112a518..e3fab574523a4b63069587b2fcaf30267fddf7c4 100644
--- a/third_party/blink/renderer/core/frame/local_frame_client_impl.h
+++ b/third_party/blink/renderer/core/frame/local_frame_client_impl.h
@@ -81,6 +81,8 @@ class CORE_EXPORT LocalFrameClientImpl final : public LocalFrameClient {
@@ -123,10 +123,10 @@ index fcc0928abbc454281b022e0451d993651ecba42f..16066fe34ee0335a0dabe00b6890e584
int32_t world_id) override;
diff --git a/third_party/blink/renderer/core/loader/empty_clients.h b/third_party/blink/renderer/core/loader/empty_clients.h
index 9ec4431ed035543beb78a3311049886c6d8e03f8..d46f3b764f653c990e57fb2c67121c8fd6b1b115 100644
index 769b08ca081fe83c50babb2743fde6e8961b65ff..d8f3b11c98fd58baa9995762a29847b9fd760c84 100644
--- a/third_party/blink/renderer/core/loader/empty_clients.h
+++ b/third_party/blink/renderer/core/loader/empty_clients.h
@@ -424,6 +424,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
@@ -420,6 +420,8 @@ class CORE_EXPORT EmptyLocalFrameClient : public LocalFrameClient {
void DidCreateScriptContext(v8::Local<v8::Context>,
int32_t world_id) override {}

View File

@@ -7,12 +7,12 @@ Ensure that licenses for the dependencies introduced by Electron
are included in `LICENSES.chromium.html`
diff --git a/tools/licenses/licenses.py b/tools/licenses/licenses.py
index 514be069768cc1bbd39f2b261cefb1a9f267f89f..0a1ab64914cfaa087e4000fb81bfafd18aa1b98b 100755
index b0807ee3d8ebcf34f0d740362aa46c8631562d38..118d200b74953c0068ad59300ccc0e3041d77a10 100755
--- a/tools/licenses/licenses.py
+++ b/tools/licenses/licenses.py
@@ -357,6 +357,31 @@ SPECIAL_CASES = {
@@ -337,6 +337,31 @@ SPECIAL_CASES = {
"License": "Apache 2.0",
"License File": ["//third_party/sample3/the_license"],
"License File": ["//third_party/dawn/third_party/khronos/LICENSE"],
},
+ os.path.join('third_party', 'electron_node'): {
+ "Name": "Node.js",

View File

@@ -8,10 +8,10 @@ was removed as part of the Raw Clipboard API scrubbing.
https://bugs.chromium.org/p/chromium/issues/detail?id=1217643
diff --git a/ui/base/clipboard/scoped_clipboard_writer.cc b/ui/base/clipboard/scoped_clipboard_writer.cc
index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0c56e2aa1 100644
index 0b457d0742b24381718092d6af11f396fda30436..e1619eeeb8f29e6745da282a33a3464ec97aefb0 100644
--- a/ui/base/clipboard/scoped_clipboard_writer.cc
+++ b/ui/base/clipboard/scoped_clipboard_writer.cc
@@ -244,6 +244,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
@@ -236,6 +236,16 @@ void ScopedClipboardWriter::WriteData(std::u16string_view format,
}
}
@@ -29,10 +29,10 @@ index e104f4d7814b6f6a0e1f5cf49ae24d5571e30fb1..cc7e9064b21f8f2c45690454805901c0
objects_.clear();
raw_objects_.clear();
diff --git a/ui/base/clipboard/scoped_clipboard_writer.h b/ui/base/clipboard/scoped_clipboard_writer.h
index 8c2be540757856a3e704764fe56003205b24812f..e31fbc01f68c0e92284a72298cac878d7247e7fb 100644
index 939a99b2a086d5373f82fe96da73dabe02f6f9d8..fccc200b1b11076c8fcffde071a53598ffba9a12 100644
--- a/ui/base/clipboard/scoped_clipboard_writer.h
+++ b/ui/base/clipboard/scoped_clipboard_writer.h
@@ -91,6 +91,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
@@ -87,6 +87,10 @@ class COMPONENT_EXPORT(UI_BASE_CLIPBOARD) ScopedClipboardWriter {
// This is only used to write custom format data.
void WriteData(std::u16string_view format, mojo_base::BigBuffer data);

View File

@@ -8,7 +8,7 @@ accessing Blink internals. Its inverse, which already exists, is used in
Android WebView.
diff --git a/third_party/blink/public/web/web_message_port_converter.h b/third_party/blink/public/web/web_message_port_converter.h
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211a29548aa 100644
index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..bd804d509ad5f3581154c6ede8653e7521cb71b8 100644
--- a/third_party/blink/public/web/web_message_port_converter.h
+++ b/third_party/blink/public/web/web_message_port_converter.h
@@ -13,6 +13,7 @@
@@ -19,20 +19,18 @@ index e7c4464f1b5aa19cbe441d94d88c949798ccb1e3..cdf9bca3df292531831b6df0077ba211
} // namespace v8
namespace blink {
@@ -25,6 +26,11 @@ class BLINK_EXPORT WebMessagePortConverter {
@@ -25,6 +26,9 @@ class BLINK_EXPORT WebMessagePortConverter {
// neutered, it will return nullopt.
static std::optional<MessagePortChannel>
DisentangleAndExtractMessagePortChannel(v8::Isolate*, v8::Local<v8::Value>);
+
+ BLINK_EXPORT static v8::Local<v8::Value>
+ EntangleAndInjectMessagePortChannel(v8::Isolate*,
+ v8::Local<v8::Context>,
+ MessagePortChannel);
+ EntangleAndInjectMessagePortChannel(v8::Local<v8::Context>, MessagePortChannel);
};
} // namespace blink
diff --git a/third_party/blink/renderer/core/exported/web_message_port_converter.cc b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d84213eba 100644
index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..e6c5764c54a18b31223ac8c5b8f2d6ef732225d6 100644
--- a/third_party/blink/renderer/core/exported/web_message_port_converter.cc
+++ b/third_party/blink/renderer/core/exported/web_message_port_converter.cc
@@ -6,6 +6,7 @@
@@ -43,20 +41,19 @@ index 3270da19f73077b1fab7522144b9f3d52d9f6a5a..bbd3c968027549b89087d9a4394f575d
#include "third_party/blink/renderer/bindings/core/v8/v8_message_port.h"
#include "third_party/blink/renderer/core/messaging/message_port.h"
@@ -21,4 +22,16 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
@@ -21,4 +22,15 @@ WebMessagePortConverter::DisentangleAndExtractMessagePortChannel(
return port->Disentangle();
}
+v8::Local<v8::Value>
+WebMessagePortConverter::EntangleAndInjectMessagePortChannel(
+ v8::Isolate* isolate,
+ v8::Local<v8::Context> context,
+ MessagePortChannel port_channel) {
+ auto* execution_context = ToExecutionContext(context);
+ CHECK(execution_context);
+ auto* port = MakeGarbageCollected<MessagePort>(*execution_context);
+ port->Entangle(std::move(port_channel));
+ return port->ToV8(isolate, context->Global());
+ return port->ToV8(context->GetIsolate(), context->Global());
+}
+
} // namespace blink

View File

@@ -10,7 +10,7 @@ usage of BrowserList and Browser as we subclass related methods and use our
WindowList.
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da2967073016 100644
index 20ba6b8fa6a7d5edf8ebab80ec15ece93d750000..6c42d825e520982c7fcac52cf3aa8aabbba621cb 100644
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.cc
@@ -48,6 +48,7 @@
@@ -19,9 +19,9 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
#include "content/public/browser/web_ui_data_source.h"
+#include "electron/shell/browser/electron_browser_context.h"
#include "ui/accessibility/accessibility_features.h"
#include "ui/accessibility/ax_mode.h"
#include "ui/accessibility/ax_updates_and_events.h"
@@ -178,7 +179,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
#include "ui/accessibility/platform/ax_platform.h"
@@ -173,7 +174,7 @@ base::Value::Dict BuildTargetDescriptor(content::RenderViewHost* rvh) {
rvh->GetRoutingID(), accessibility_mode);
}
@@ -30,7 +30,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
base::Value::Dict BuildTargetDescriptor(Browser* browser) {
base::Value::Dict target_data;
target_data.Set(kSessionIdField, browser->session_id().id());
@@ -224,7 +225,7 @@ void HandleAccessibilityRequestCallback(
@@ -197,7 +198,7 @@ void HandleAccessibilityRequestCallback(
auto& browser_accessibility_state =
*content::BrowserAccessibilityState::GetInstance();
base::Value::Dict data;
@@ -39,7 +39,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
ui::AXMode mode = browser_accessibility_state.GetAccessibilityMode();
bool native = mode.has_mode(ui::AXMode::kNativeAPIs);
bool web = mode.has_mode(ui::AXMode::kWebContents);
@@ -285,7 +286,7 @@ void HandleAccessibilityRequestCallback(
@@ -258,7 +259,7 @@ void HandleAccessibilityRequestCallback(
data.Set(kIsScreenReaderActive, is_screen_reader_active);
std::string pref_api_type =
@@ -48,7 +48,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
bool pref_api_type_supported = false;
std::vector<ui::AXApiType::Type> supported_api_types =
@@ -353,11 +354,11 @@ void HandleAccessibilityRequestCallback(
@@ -326,11 +327,11 @@ void HandleAccessibilityRequestCallback(
data.Set(kPagesField, std::move(page_list));
base::Value::List browser_list;
@@ -61,8 +61,8 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
+#endif
data.Set(kBrowsersField, std::move(browser_list));
#if BUILDFLAG(IS_WIN)
@@ -844,7 +845,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
std::string json_string;
@@ -804,7 +805,8 @@ void AccessibilityUIMessageHandler::SetGlobalString(
const std::string value = CheckJSValue(data.FindString(kValueField));
if (string_name == kApiTypeField) {
@@ -72,7 +72,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
pref->SetString(prefs::kShownAccessibilityApiType, value);
}
}
@@ -898,7 +900,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
@@ -858,7 +860,8 @@ void AccessibilityUIMessageHandler::RequestWebContentsTree(
AXPropertyFilter::ALLOW_EMPTY);
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
@@ -82,7 +82,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
ui::AXApiType::Type api_type =
ui::AXApiType::From(pref->GetString(prefs::kShownAccessibilityApiType));
std::string accessibility_contents =
@@ -925,6 +928,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
@@ -885,6 +888,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
AXPropertyFilter::ALLOW_EMPTY);
AddPropertyFilters(property_filters, deny, AXPropertyFilter::DENY);
@@ -90,7 +90,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
for (Browser* browser : *BrowserList::GetInstance()) {
if (browser->session_id().id() == session_id) {
base::Value::Dict result = BuildTargetDescriptor(browser);
@@ -937,6 +941,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
@@ -897,6 +901,7 @@ void AccessibilityUIMessageHandler::RequestNativeUITree(
return;
}
}
@@ -98,7 +98,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
#endif // !BUILDFLAG(IS_ANDROID)
// No browser with the specified |session_id| was found.
base::Value::Dict result;
@@ -980,11 +985,13 @@ void AccessibilityUIMessageHandler::StopRecording(
@@ -940,11 +945,13 @@ void AccessibilityUIMessageHandler::StopRecording(
}
ui::AXApiType::Type AccessibilityUIMessageHandler::GetRecordingApiType() {
@@ -115,7 +115,7 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
// Check to see if it is in the supported types list.
if (std::find(supported_types.begin(), supported_types.end(), api_type) ==
supported_types.end()) {
@@ -1054,10 +1061,13 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
@@ -1014,8 +1021,11 @@ void AccessibilityUIMessageHandler::RequestAccessibilityEvents(
// static
void AccessibilityUIMessageHandler::RegisterProfilePrefs(
user_prefs::PrefRegistrySyncable* registry) {
@@ -127,13 +127,11 @@ index 049ae3881eff6426b37a1ba09cfd8a10a7e9a597..0cdb542da696e9fc85e9bf321182da29
+ registry->RegisterBooleanPref(prefs::kShowInternalAccessibilityTree, false);
+#endif
}
void AccessibilityUIMessageHandler::OnVisibilityChanged(
diff --git a/chrome/browser/ui/webui/accessibility/accessibility_ui.h b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83c1d1fa0a 100644
index b171afc941b2b3ef4aeba04a2b1c6eef2774d442..8f431aae69365bc8756e515c603332a7f1648148 100644
--- a/chrome/browser/ui/webui/accessibility/accessibility_ui.h
+++ b/chrome/browser/ui/webui/accessibility/accessibility_ui.h
@@ -28,6 +28,8 @@ namespace content {
@@ -27,6 +27,8 @@ namespace content {
class WebContents;
} // namespace content
@@ -142,7 +140,7 @@ index 4b9d7df73c901c57c14693e9f24a51694ecd375f..93e1c9a79d88c8b4c57b244c9eec1e83
namespace user_prefs {
class PrefRegistrySyncable;
} // namespace user_prefs
@@ -79,6 +81,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler,
@@ -77,6 +79,8 @@ class AccessibilityUIMessageHandler : public content::WebUIMessageHandler {
static void RegisterProfilePrefs(user_prefs::PrefRegistrySyncable* registry);
private:

View File

@@ -6,11 +6,11 @@ Subject: allow disabling blink scheduler throttling per RenderView
This allows us to disable throttling for hidden windows.
diff --git a/content/browser/renderer_host/navigation_controller_impl_unittest.cc b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
index 74b39146bbb8151a66ecb4f138f769fffc2525b2..a54948fa36c85c5c5dd04b9836951b1ce1279038 100644
index d321fe74be7af24d1246224d7a28c9dede3635b2..af2cb60c42863b1fdad487c28d544b7a7dade805 100644
--- a/content/browser/renderer_host/navigation_controller_impl_unittest.cc
+++ b/content/browser/renderer_host/navigation_controller_impl_unittest.cc
@@ -173,6 +173,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
(bool supports_draggable_regions),
@@ -167,6 +167,12 @@ class MockPageBroadcast : public blink::mojom::PageBroadcast {
(network::mojom::AttributionSupport support),
(override));
+ MOCK_METHOD(
@@ -23,10 +23,10 @@ index 74b39146bbb8151a66ecb4f138f769fffc2525b2..a54948fa36c85c5c5dd04b9836951b1c
return receiver_.BindNewEndpointAndPassDedicatedRemote();
}
diff --git a/content/browser/renderer_host/render_view_host_impl.cc b/content/browser/renderer_host/render_view_host_impl.cc
index a9e4dbfd99b56167d05aa6c30c09408036bc897d..1b0f636cc3705eda221389967d9cd3acf563f00d 100644
index 87c448c04f8f164f7b2dca6f21a8ea9cc26db163..e88cfee7ad8495e7733c85efc8d21ad2aef26db0 100644
--- a/content/browser/renderer_host/render_view_host_impl.cc
+++ b/content/browser/renderer_host/render_view_host_impl.cc
@@ -779,6 +779,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
@@ -773,6 +773,11 @@ void RenderViewHostImpl::SetBackgroundOpaque(bool opaque) {
GetWidget()->GetAssociatedFrameWidget()->SetBackgroundOpaque(opaque);
}
@@ -51,25 +51,25 @@ index 7944fe64e0da112fc670358b75506bb199bb5e4a..0e3c16c6af2a078943e9f39808134ab2
void SendRendererPreferencesToRenderer(
const blink::RendererPreferences& preferences);
diff --git a/content/browser/renderer_host/render_widget_host_view_aura.cc b/content/browser/renderer_host/render_widget_host_view_aura.cc
index d97cbb4fd8e12bcbff19bf8cc8378997110c60c0..1041d25d5ef78abdcf7b85fe8457ec2a20e2a759 100644
index b14f5bc3f023c512a066ce9ec9f681c96b1fafc4..b930145db575eb8c4e84297ddd610bd90fb5d3a8 100644
--- a/content/browser/renderer_host/render_widget_host_view_aura.cc
+++ b/content/browser/renderer_host/render_widget_host_view_aura.cc
@@ -632,8 +632,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
@@ -580,8 +580,8 @@ void RenderWidgetHostViewAura::ShowImpl(PageVisibilityState page_visibility) {
// OnShowWithPageVisibility will not call NotifyHostAndDelegateOnWasShown,
// which updates `visibility_`, unless the host is hidden. Make sure no update
// is needed.
- CHECK(host_->IsHidden() || visibility_ == Visibility::VISIBLE);
- CHECK(host_->is_hidden() || visibility_ == Visibility::VISIBLE);
- OnShowWithPageVisibility(page_visibility);
+ if (host_->IsHidden() || visibility_ == Visibility::VISIBLE)
+ if (host_->is_hidden() || visibility_ == Visibility::VISIBLE)
+ OnShowWithPageVisibility(page_visibility);
}
void RenderWidgetHostViewAura::EnsurePlatformVisibility(
diff --git a/content/public/browser/render_view_host.h b/content/public/browser/render_view_host.h
index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060f0a640b1 100644
index 20ca763ff7f55e8176b77349b41917b11e051ae6..a50c122064b5f0092f57e3d508fb19389b72203b 100644
--- a/content/public/browser/render_view_host.h
+++ b/content/public/browser/render_view_host.h
@@ -73,6 +73,9 @@ class CONTENT_EXPORT RenderViewHost {
@@ -75,6 +75,9 @@ class CONTENT_EXPORT RenderViewHost {
virtual void WriteIntoTrace(
perfetto::TracedProto<TraceProto> context) const = 0;
@@ -80,34 +80,34 @@ index 782bed0fdc08d57eceb059f398f253fab9233b1b..f1ab5b981ea68af1b11313e67f2c5060
// This interface should only be implemented inside content.
friend class RenderViewHostImpl;
diff --git a/content/test/test_page_broadcast.h b/content/test/test_page_broadcast.h
index 8762811ec25069ddd0c57e3ffb50d158532a39b1..f5cdae891cc3b98371ae18dbc119b5e7f379f2bf 100644
index 3f4fdfcdf2f701a394e182bd61baf226338ef7f8..f2faa1225e8ca6abb190e6f7a0775545fa3f785d 100644
--- a/content/test/test_page_broadcast.h
+++ b/content/test/test_page_broadcast.h
@@ -54,6 +54,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
void UpdateCanvasNoiseToken(
std::optional<blink::NoiseToken> canvas_noise_token) override;
void SetSupportsDraggableRegions(bool supports_draggable_regions) override;
@@ -51,6 +51,7 @@ class TestPageBroadcast : public blink::mojom::PageBroadcast {
network::mojom::AttributionSupport support) override;
void UpdateColorProviders(
const blink::ColorProviderColorMaps& color_provider_colors) override;
+ void SetSchedulerThrottling(bool allowed) override {}
mojo::AssociatedReceiver<blink::mojom::PageBroadcast> receiver_;
};
diff --git a/third_party/blink/public/mojom/page/page.mojom b/third_party/blink/public/mojom/page/page.mojom
index fb846303b126c0bbaa252b8b6c5b9b2971100c62..e6dcf94dcde8515e9cf73656d6c1659492aac4b4 100644
index b6a4e3609af1f090f1f845d77fa0589e5b178d8a..989b2cf76ce88614b57e75ce2fcace101225f43e 100644
--- a/third_party/blink/public/mojom/page/page.mojom
+++ b/third_party/blink/public/mojom/page/page.mojom
@@ -186,4 +186,7 @@ interface PageBroadcast {
// Indicates that the page's main frame should collect draggable regions set
// using the app-region CSS property.
SetSupportsDraggableRegions(bool supports_draggable_regions);
@@ -175,4 +175,7 @@ interface PageBroadcast {
// 2. The ColorProvider associated with the WebContents changes as a result
// of theme changes.
UpdateColorProviders(ColorProviderColorMaps color_provider_colors);
+
+ // Whether to enable the Renderer scheduler background throttling.
+ SetSchedulerThrottling(bool allowed);
};
diff --git a/third_party/blink/public/web/web_view.h b/third_party/blink/public/web/web_view.h
index 11a31c9ed26b5abde0ea812eae6b219340ed711c..a72cf76b820cb86b9495ea147efbdcf53b8a9845 100644
index c8d27cfee8ef3fe244291f4667b59df1037c359b..92ed53a689991ec8eca9572bf2f7a212acfc4a38 100644
--- a/third_party/blink/public/web/web_view.h
+++ b/third_party/blink/public/web/web_view.h
@@ -366,6 +366,7 @@ class BLINK_EXPORT WebView {
@@ -360,6 +360,7 @@ class BLINK_EXPORT WebView {
// Scheduling -----------------------------------------------------------
virtual PageScheduler* Scheduler() const = 0;
@@ -116,10 +116,10 @@ index 11a31c9ed26b5abde0ea812eae6b219340ed711c..a72cf76b820cb86b9495ea147efbdcf5
// Visibility -----------------------------------------------------------
diff --git a/third_party/blink/renderer/core/exported/web_view_impl.cc b/third_party/blink/renderer/core/exported/web_view_impl.cc
index 9d1d25758c8f5f7adb613516a87e81c33e31072b..de1c308b599377dd2598a75427347dc5c980fc07 100644
index b0a8c14c845a69c72ab823af1eccad22b27f1ad6..6ba55d345d4b18c9c76e26a8a1eb3835dd692581 100644
--- a/third_party/blink/renderer/core/exported/web_view_impl.cc
+++ b/third_party/blink/renderer/core/exported/web_view_impl.cc
@@ -2501,6 +2501,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
@@ -2485,6 +2485,10 @@ void WebViewImpl::SetPageLifecycleStateInternal(
TRACE_EVENT2("navigation", "WebViewImpl::SetPageLifecycleStateInternal",
"old_state", old_state, "new_state", new_state);
@@ -130,7 +130,7 @@ index 9d1d25758c8f5f7adb613516a87e81c33e31072b..de1c308b599377dd2598a75427347dc5
bool storing_in_bfcache = new_state->is_in_back_forward_cache &&
!old_state->is_in_back_forward_cache;
bool restoring_from_bfcache = !new_state->is_in_back_forward_cache &&
@@ -4018,10 +4022,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
@@ -3986,10 +3990,23 @@ PageScheduler* WebViewImpl::Scheduler() const {
return GetPage()->GetPageScheduler();
}
@@ -155,10 +155,10 @@ index 9d1d25758c8f5f7adb613516a87e81c33e31072b..de1c308b599377dd2598a75427347dc5
// Do not throttle if the page should be painting.
bool is_visible =
diff --git a/third_party/blink/renderer/core/exported/web_view_impl.h b/third_party/blink/renderer/core/exported/web_view_impl.h
index 5dd87ed6a78156cf7d1fc130fc2db6b399227d76..6bd345d2fb854c5d2a79bfcfa9d8618c35bd8489 100644
index 5c8a5d7f9b675a460740643fc26d778a08ef7112..2ebae3e0a5b76eb9551d286af1ed64e1e58b9de4 100644
--- a/third_party/blink/renderer/core/exported/web_view_impl.h
+++ b/third_party/blink/renderer/core/exported/web_view_impl.h
@@ -452,6 +452,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
@@ -445,6 +445,7 @@ class CORE_EXPORT WebViewImpl final : public WebView,
LocalDOMWindow* PagePopupWindow() const;
PageScheduler* Scheduler() const override;
@@ -166,7 +166,7 @@ index 5dd87ed6a78156cf7d1fc130fc2db6b399227d76..6bd345d2fb854c5d2a79bfcfa9d8618c
void SetVisibilityState(mojom::blink::PageVisibilityState visibility_state,
bool is_initial_state) override;
mojom::blink::PageVisibilityState GetVisibilityState() override;
@@ -945,6 +946,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
@@ -935,6 +936,8 @@ class CORE_EXPORT WebViewImpl final : public WebView,
// If true, we send IPC messages when |preferred_size_| changes.
bool send_preferred_size_changes_ = false;

View File

@@ -1,23 +0,0 @@
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
From: John Kleinschmidt <jkleinsc@electronjs.org>
Date: Mon, 15 Sep 2025 15:52:55 -0400
Subject: Allow electron to depend on components/os_crypt/sync.
This is necessary after
https://chromium-review.googlesource.com/c/chromium/src/+/6944749
landed. That CL notes that "new code should use os_crypt async",
so we can remove this patch once we migrate our code to use
os_crypt async.
diff --git a/components/os_crypt/sync/BUILD.gn b/components/os_crypt/sync/BUILD.gn
index 23aa391aaf380f87310fb295277809f8b105d6e8..bb308187837371ecfa2482affaf35ac7ed98c1f3 100644
--- a/components/os_crypt/sync/BUILD.gn
+++ b/components/os_crypt/sync/BUILD.gn
@@ -10,6 +10,7 @@ import("//components/os_crypt/sync/features.gni")
component("sync") {
# New code should use os_crypt async.
visibility = [
+ "//electron:*",
"//chrome/browser",
"//chrome/test:test_support",
"//components/os_crypt/async/browser:dpapi_key_provider",

View File

@@ -8,7 +8,7 @@ WebPreferences of in-process child windows, rather than relying on
process-level command line switches, as before.
diff --git a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
index 845edd77da72cfe2d9a56e15cf1e50bdd391be49..9b50605b67c0da8692653816c8638ea89561282f 100644
index 545a854789199a6f3056bf507f882446a5e11235..e733581553328010275c85465ee3a97a950afe4d 100644
--- a/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
+++ b/third_party/blink/common/web_preferences/web_preferences_mojom_traits.cc
@@ -148,6 +148,19 @@ bool StructTraits<blink::mojom::WebPreferencesDataView,
@@ -32,7 +32,7 @@ index 845edd77da72cfe2d9a56e15cf1e50bdd391be49..9b50605b67c0da8692653816c8638ea8
out->accelerated_video_decode_enabled =
data.accelerated_video_decode_enabled();
diff --git a/third_party/blink/public/common/web_preferences/web_preferences.h b/third_party/blink/public/common/web_preferences/web_preferences.h
index da99e295dd7c063b5416d310fe91d422e74bf5fb..0c91e14c0fb760dd075f517731d110caa3f7739a 100644
index 3283422f7b6da21e6e9c6f35a52a643ba26a5e29..962d10f8166c3765b8d7434ecf941922981e3ce8 100644
--- a/third_party/blink/public/common/web_preferences/web_preferences.h
+++ b/third_party/blink/public/common/web_preferences/web_preferences.h
@@ -9,6 +9,7 @@
@@ -43,9 +43,9 @@ index da99e295dd7c063b5416d310fe91d422e74bf5fb..0c91e14c0fb760dd075f517731d110ca
#include "build/build_config.h"
#include "net/nqe/effective_connection_type.h"
#include "third_party/blink/public/common/common_export.h"
@@ -460,6 +461,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
bool should_screenshot_on_mainframe_same_doc_navigation = true;
#endif // BUILDFLAG(IS_ANDROID)
@@ -456,6 +457,19 @@ struct BLINK_COMMON_EXPORT WebPreferences {
// Whether fingerprinting protection based on page content is enabled.
bool content_based_fingerprinting_protection_enabled = false;
+ // Begin Electron-specific WebPreferences.
+ bool context_isolation = false;
@@ -64,7 +64,7 @@ index da99e295dd7c063b5416d310fe91d422e74bf5fb..0c91e14c0fb760dd075f517731d110ca
// chrome, except for the cases where it would require lots of extra work for
// the embedder to use the same default value.
diff --git a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
index b46fc738d5813a71212c4e1a29a8d08fc15982b3..f65ece291742e9776612cd1e5d2bf2f741c6a400 100644
index 49b374461da896943cd3da55ebcd8814098eeba9..13789a02f03dcfdbad798875d109882d9e548dff 100644
--- a/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
+++ b/third_party/blink/public/common/web_preferences/web_preferences_mojom_traits.h
@@ -8,6 +8,7 @@
@@ -129,18 +129,22 @@ index b46fc738d5813a71212c4e1a29a8d08fc15982b3..f65ece291742e9776612cd1e5d2bf2f7
return r.cookie_enabled;
}
diff --git a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
index 03ae611eda0f4b9888c498b89e4b805dbe629268..b96998d728c9b107532b2ec67320367eaa6b1f94 100644
index 60432eee506ddfcb02c5eef396494bea4dc3e263..76c0de3cc8095ab834950e117f8f12fd51e94978 100644
--- a/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
+++ b/third_party/blink/public/mojom/webpreferences/web_preferences.mojom
@@ -4,6 +4,7 @@
module blink.mojom;
@@ -8,9 +8,11 @@ import "third_party/blink/public/mojom/css/preferred_color_scheme.mojom";
import "third_party/blink/public/mojom/css/preferred_contrast.mojom";
import "third_party/blink/public/mojom/v8_cache_options.mojom";
import "url/mojom/url.mojom";
+import "mojo/public/mojom/base/file_path.mojom";
import "mojo/public/mojom/base/string16.mojom";
import "skia/public/mojom/skcolor.mojom";
import "third_party/blink/public/mojom/css/preferred_color_scheme.mojom";
@@ -223,6 +224,19 @@ struct WebPreferences {
+
enum PointerType {
kPointerNone = 1, // 1 << 0
kPointerFirstType = kPointerNone,
@@ -217,6 +219,19 @@ struct WebPreferences {
// If true, stylus handwriting recognition to text input will be available in
// editable input fields which are non-password type.
bool stylus_handwriting_enabled;

View File

@@ -0,0 +1,108 @@
From 0000000000000000000000000000000000000000 Mon Sep 17 00:00:00 2001
From: Avi Drissman <avi@chromium.org>
Date: Thu, 21 Aug 2025 07:33:53 -0700
Subject: Band-aid over an issue with using deprecated NSOpenPanel API
Because deprecated and broken NSOpenPanel API is used, the open panel
will sometimes incorrectly misunderstand a folder to be a package and
return it as a user selection when folders are disallowed from
selection. In that case, skip it.
Bug: 40861123
Bug: 41275486
Bug: 440106155
Change-Id: Ia0459a2bb76a30f4e126bd83069d7e13894d62f6
Fixed: 438779953
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/6867298
Commit-Queue: Avi Drissman <avi@chromium.org>
Reviewed-by: Christine Hollingsworth <christinesm@chromium.org>
Cr-Commit-Position: refs/heads/main@{#1504534}
diff --git a/components/remote_cocoa/app_shim/select_file_dialog_bridge.mm b/components/remote_cocoa/app_shim/select_file_dialog_bridge.mm
index f0b8108a7f8a63f66664c6c5ad3ada0bf60805b3..67380a76c699d1c2db0d3a96671bb92657c4a6d3 100644
--- a/components/remote_cocoa/app_shim/select_file_dialog_bridge.mm
+++ b/components/remote_cocoa/app_shim/select_file_dialog_bridge.mm
@@ -225,7 +225,7 @@ - (void)popupAction:(id)sender {
// Unfortunately, there's no great way to do strict type matching with
// NSOpenPanel. Setting explicit extensions via -allowedFileTypes is
// deprecated, and there's no way to specify that strict type equality should
- // be used for -allowedContentTypes (FB13721802).
+ // be used for -allowedContentTypes (https://crbug.com/41275486, FB13721802).
//
// -[NSOpenSavePanelDelegate panel:shouldEnableURL:] could be used to enforce
// strict type matching, however its presence on the delegate means that all
@@ -235,6 +235,10 @@ - (void)popupAction:(id)sender {
//
// Therefore, use the deprecated API, because it's the only way to remain
// performant while achieving strict type matching.
+ //
+ // TODO(https://crbug.com/440106155): Possibly reconsider using
+ // -panel:shouldEnableURL: if the speed impact is judged to be acceptable
+ // nowadays.
#pragma clang diagnostic push
#pragma clang diagnostic ignored "-Wdeprecated-declarations"
@@ -479,8 +483,8 @@ - (void)popupAction:(id)sender {
// See -[ExtensionDropdownHandler popupAction:] as to why file extensions
// are collected here rather than being converted to UTTypes.
- // TODO(FB13721802): Use UTTypes when strict type matching can be
- // specified.
+ // TODO(https://crbug.com/440106155, FB13721802): Use UTTypes when strict
+ // type matching can be specified.
NSString* ext_ns = base::SysUTF8ToNSString(ext);
if (![file_extensions_array containsObject:ext_ns]) {
[file_extensions_array addObject:ext_ns];
@@ -571,18 +575,46 @@ - (void)popupAction:(id)sender {
}
NSString* path = url.path;
- // There is a bug in macOS where, despite a request to disallow file
- // selection, files/packages are able to be selected. If indeed file
- // selection was disallowed, drop any files selected.
- // https://crbug.com/40861123, FB11405008
- if (!open_panel.canChooseFiles) {
+ if (base::mac::MacOSMajorVersion() < 14) {
+ // There is a bug in macOS (https://crbug.com/40861123, FB11405008)
+ // where, despite a request to disallow file selection, files/packages
+ // are able to be selected. If indeed file selection was disallowed,
+ // drop any files selected. This issue is fixed in macOS 14, so only
+ // do the workaround on previous releases.
+ if (!open_panel.canChooseFiles) {
+ BOOL is_directory;
+ BOOL exists =
+ [NSFileManager.defaultManager fileExistsAtPath:path
+ isDirectory:&is_directory];
+ BOOL is_package =
+ [NSWorkspace.sharedWorkspace isFilePackageAtPath:path];
+ if (!exists || !is_directory || is_package) {
+ continue;
+ }
+ }
+ }
+
+ // As long as FB13721802 remains unfixed, this class uses extensions to
+ // filter what files are available rather than UTTypes. This deprecated
+ // API has a problem, however. If you specify an extension to be shown
+ // as available, then the NSOpenPanel will assume that any directory
+ // that has that extension is a package, and will offer it to the user
+ // for selection even if directory selection isn't otherwise allowed.
+ // Therefore, if directories are disallowed, filter out any that find
+ // their way in if they're not actually packages.
+ //
+ // TODO(https://crbug.com/440106155, FB13721802): Possibly reconsider
+ // using -panel:shouldEnableURL: if the speed impact is judged to be
+ // acceptable nowadays, and drop this band-aid.
+ if (!open_panel.canChooseDirectories) {
BOOL is_directory;
BOOL exists =
[NSFileManager.defaultManager fileExistsAtPath:path
isDirectory:&is_directory];
BOOL is_package =
[NSWorkspace.sharedWorkspace isFilePackageAtPath:path];
- if (!exists || !is_directory || is_package) {
+ if (!exists || (is_directory && !is_package)) {
+ NSLog(@"dropping %@", path);
continue;
}
}

Some files were not shown because too many files have changed in this diff Show More