Compare commits

..

338 Commits

Author SHA1 Message Date
trop[bot]
de8008a6af fix: revoke Read access after removing file via FileSystemAccess API (#49745)
Refs https://chromium-review.googlesource.com/6677249

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-11 14:28:55 -05:00
trop[bot]
510c9e12dd ci: add markdownlint problem matcher (#49763)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-11 13:57:10 -05:00
trop[bot]
e3f6f96a25 docs: fix typos across documentation (#49757)
Fix 40 typos across 25 documentation files including misspellings,
missing words, doubled words, wrong words, and grammatical errors.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: ron <ronald_eddy@yahoo.com>
2026-02-11 16:50:06 +01:00
trop[bot]
78c7dc3d84 fix: address upstream Chromium shift to enable CoreAudio Tap API for audio capture used in electron's desktopCapturer (🍏 macOS). (#49739)
* fix: Enable CoreAudio Tap API for Audio Capture (🍏 macOS)

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

* fix: addressed markdown issue which caused pre-commit hook failure

🧑‍🔧 : Ref : https://github.com/electron/electron/pull/49717#issuecomment-3874660013

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

* fix: updated docs to cover `desktopCapturer` nuances with macOS

📝 : PR https://github.com/electron/electron/pull/49717

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bug-Reaper <llama@soundsafari.io>
2026-02-11 12:50:08 +01:00
trop[bot]
e22252c689 docs: fix framerate limit when osr with shared texture (#49728)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-09 15:36:55 +01:00
trop[bot]
9c29c7c00e ci: fix patches changes detected in apply patches workflow (#49708)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-06 21:30:14 -08:00
trop[bot]
d7d5db8631 fix: restore macos 12 support in Node 24 (#49703)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-02-06 13:38:33 -08:00
trop[bot]
e6f231925f refactor: use ComPtr pattern for MSIX to avoid exception handling (#49686)
* Revert "fix: fix Windows MSIX release build errors (#49613)"

This reverts commit 4b5d5f9dd5.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* refactor: use WRL ComPtr pattern for MSIX to avoid exception handling

The MSIX auto-updater code was using C++/WinRT (winrt::* namespace), which requires exception handling (/EHsc). Mixing exception and non-exception handling code in the same binary is problematic at runtime. This commit refactors electron_api_msix_updater.cc to use an upstream Chromium pattern and eliminates the need for special exception handling build flags

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: import correct packages

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: consolidate IPackage declarations

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* refactor: use IPackageManager/IPackageManager5/IPackageManager9 and IPackage/IPackage2/IPackage4/IPackage6 interfaces as needed for different API methods.

Also consolidates duplicate completion handler logic, fixes a bug in
RegisterRestartOnUpdate where the command line string could go out of
scope, and removes unused includes.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-02-05 13:09:20 -08:00
trop[bot]
f1517f53e0 refactor: don't log error just for unsigned code (#49676)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-02-05 13:13:13 -05:00
trop[bot]
7863318e51 fix: default accelerator for role-based menu items (#49668)
fix: apply default accelerator for role-based menu items

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-05 10:58:19 -05:00
trop[bot]
b07765b8c2 ci: use squash merge for apply patches workflow (#49673)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-04 18:49:44 -08:00
trop[bot]
2dbdf223b7 feat: add focusOnNavigation flag to WebPreferences (#49511)
* feat: add focusOnNavigation webPreference

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* WebContentsView tests

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* fix

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* fix

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kyle Cutler <kycutler@microsoft.com>
2026-02-04 15:44:03 -05:00
trop[bot]
0abdb91b78 fix: alt-space should route through 'system-context-menu' (#49642)
fix: alt-space should route through system-context-menu

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-04 18:53:55 +01:00
trop[bot]
64ef870e34 fix: remove menu observer before destroying menu_controller_ (#49658)
* fix: remove menu observer before destroying menu_controller_

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: resolves private inheritance conflict

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-02-04 18:53:41 +01:00
trop[bot]
f295327047 ci: handle PRs with no checks in rerun apply patches (#49664)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-04 09:46:37 -08:00
trop[bot]
efc8595b25 docs: add Wayland note to win.getPosition() and win.getBounds() (#49659)
docs: add Wayland note to win.getPosition()

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-04 11:51:11 -05:00
trop[bot]
f874dba057 fix(squirrel.mac): clean up old staged updates before downloading new update (#49639)
fix: clean up old staged updates before downloading new update

When checkForUpdates() is called while an update is already staged,
Squirrel creates a new temporary directory for the download without
cleaning up the old one. This can lead to disk usage growth when
new versions are released while the app hasn't restarted.

This adds a force parameter to pruneUpdateDirectories that bypasses
the AwaitingRelaunch state check. This is called before creating a
new temp directory, ensuring old staged updates are cleaned up.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Andy Locascio <loc@anthropic.com>
2026-02-03 21:43:55 +01:00
trop[bot]
47990a354f build: remove Core Graphics private macOS APIs on MAS (#49643)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 14:49:04 -05:00
trop[bot]
3d5986e29a fix: wrong cause and removed flag in cookie change listener (#49631)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: mrchaofan <lcfme@icloud.com>
2026-02-03 14:00:30 -05:00
trop[bot]
b4563125d9 fix: menu state in macOS dock menus (#49625)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 12:06:48 -05:00
trop[bot]
a86261ad08 fix: possible crash in FileSystem API (#49636)
Refs https://chromium-review.googlesource.com/6880247

Fixes a crash that can arise in the File System Access API in the
following scenario:

1. Create fileHandle1 at path1.
2. Call fileHandle1.remove() or user manually delete the file.
3. Create fileHandle2 at path2.
4. fileHandle2.move(path1).

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 11:32:23 -05:00
trop[bot]
58f4af4636 fix: issues with xdg activation on Linux (#49594)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-02 14:32:46 -05:00
trop[bot]
594b38fb7d fix: handle out of order recording errors in skia graphite (#49621)
* fix: Handle out of order recording errors in skia graphite

Refs https://issues.chromium.org/issues/458722690

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: fix .patches file

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-02-02 14:31:17 -05:00
trop[bot]
26079bd762 feat: msix auto-updater (#49586) 2026-02-02 14:21:40 +01:00
trop[bot]
d7bdf92817 fix: duplicate fullscreen macOS menu item (#49598) 2026-02-02 14:20:37 +01:00
trop[bot]
ee3afeb27b docs: app.getGPUInfo() may reject (#49618)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2026-02-02 11:18:13 +01:00
trop[bot]
abe2fd8c2c refactor: address PathProvider TODO (#49599)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-02 09:38:46 +01:00
trop[bot]
9198ecf95a docs: add jsign instructions for Azure Trusted Signing on Linux/macOS (#49603)
* docs: add jsign instructions for Azure Trusted Signing on Linux/macOS

Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>

* docs: add clickable jsign link for Azure Trusted Signing

Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>
2026-02-02 09:38:25 +01:00
trop[bot]
d76da9ac83 build(dev-deps): bump @electron/lint-roller to 3.2.0 (#49576)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-30 13:25:29 -05:00
David Sanders
1aa08a4de4 ci: rework reapply patches (#49581)
ci: rework reapply patches (#49552)
2026-01-30 13:21:59 -05:00
trop[bot]
32281a6d08 fix: macOS menu item accelerators when item disabled (#49591)
fix: macOS menu item acceerators when item disabled

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-30 13:16:11 -05:00
trop[bot]
158c5e8366 ci: trigger website docs update on release published (#49568)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 20:57:04 -08:00
trop[bot]
702a17d6bf test: remove split dependency (#49554)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 15:44:18 -08:00
trop[bot]
ad5c8483c7 fix: chrome://accessibility drift (#49561)
https://chromium-review.googlesource.com/c/chromium/src/+/6870052

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-28 15:37:16 +01:00
trop[bot]
5e36ae10d9 ci: reapply patches if PR base branch updates them (#49534)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-27 16:16:45 +01:00
trop[bot]
c3f6a15467 docs: correct type for process.noDeprecation (#49546)
* docs: correct type for process.noDeprecation

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* docs: mark `noDeprecation` as optional instead

Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-27 11:34:36 +01:00
trop[bot]
2041abcaf2 chore: bump chromium to 146.0.7650.0 (41-x-y) (#49529)
chore: bump chromium to 146.0.7650.0 41-x-y

* chore: bump chromium in DEPS to 146.0.7650.0

* 7496671: WaaP: Control hung delay for Initial WebUI

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7496671

* 7494302: [//media] Rename renderable_gpu_memory_buffer_video_frame_pool*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7494302

* chore: update patches

* 7502996: [DevTools] Add ability to toggle Chromium feature flags from DevTools

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7502996

* 7456200: Vectorize StringImpl::CopyChars and EqualIgnoringASCIICase using Highway.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200

* 7236627: spellcheck: supply full spelling marker info, incld. marker type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7236627

* chore: rm dependency on wtf::string from blink public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200
added a public dependency on //third_party/highway for
//third_party/blink/renderer/platform/wtf:wtf which will not be
inherited by //content/renderer since wtf is internal dependency of
blink leading to the following compilation error

```
In file included from ../../content/public/renderer/window_features_converter.cc:5:
In file included from ../../content/public/renderer/window_features_converter.h:10:
In file included from ../../third_party/blink/public/web/web_window_features.h:38:
In file included from ../../third_party/blink/renderer/platform/wtf/text/wtf_string.h:40:
../../third_party/blink/renderer/platform/wtf/text/string_impl.h:27:10: fatal error: 'hwy/highway.h' file not found
   27 | #include <hwy/highway.h>
      |          ^~~~~~~~~~~~~~~
1 error generated.
```

Use `gn desc out/Testing content/renderer:renderer_sources --blame`
to verify the inherited config and dependency list.

* 7493995: Restore directive part of wasm-eval error message

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7493995

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-01-27 11:02:16 +01:00
trop[bot]
1b16b6a315 docs: add type reference links in Menu and MenuItem API documentation (#49526)
* docs: add type reference links in Menu and MenuItem API documentation

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

* docs: revert type links in Menu return types to fix parser

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sourav Bera <sbera987654321@gmail.com>
2026-01-26 14:27:53 +01:00
trop[bot]
86196dc588 chore: bump chromium to 146.0.7645.0 (41-x-y) (#49497)
* chore: bump chromium in DEPS to 146.0.7643.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 146.0.7645.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7402162: Refactor app shims to call ContentMain

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7402162

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7454282: Add master key management for HTTP Cache Encryption

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7454282

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7490440: Reland "Delete unused base::Contains()"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7490440

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7414864: Pass CSSParserLocalContext down to CSSMathExpressionNodeParser

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7414864

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7460969: Move child_process_id.h to common

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7460969

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7474608: [api] Remove deprecated v8::PropertyCallbackInfo<T>::This()

Refs https://chromium-review.googlesource.com/c/v8/v8/+/7474608

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7461067: [Viz] Rename kPreferGpuMemoryBuffer

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7461067

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7487174: Remove GLHelper

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7487174

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7457538: Set timeout from multi source page context fetcher

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7457538

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-26 11:58:09 +01:00
trop[bot]
a77a2ad64f fix: second argument to shell.writeShortcutLink is optional (#49503)
fix: second argument to shell.writeShortcutLink is optional

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-26 11:57:56 +01:00
trop[bot]
d582f1fbaa fix: avoid startup crash when V8 sandbox is disabled (#49504)
* fix: avoid startup crash when V8 sandbox is disabled

Co-authored-by: David Franco <davidfrsan@gmail.com>

* chore: update patch

Co-authored-by: David Franco <david@metrica-sports.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Franco <davidfrsan@gmail.com>
Co-authored-by: David Franco <david@metrica-sports.com>
2026-01-23 14:30:00 -05:00
trop[bot]
173d0d16dc fix: return early from platform_util::Beep() on Linux if there is no default GDK display (#49483)
fix: return early from beep on linux if there is no default gdk display

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-01-22 15:00:38 -05:00
trop[bot]
b244963d63 fix: potential devtools crash on empty (#49488)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-22 09:46:08 +01:00
trop[bot]
95417f9e46 docs: document that shell.trashItem requires backslashes (#49481)
docs: Update shell.md: Document that shell.trashItem requires backslashes

In Windows many functions relating to files (e.g. shell.openItem, the Node fs functions, as well as native Win32 APIs) will accept either type of slash / or \ as a folder separator.

shell.trashItem does not work with / as folder separator in Windows. This documentation change explains that.

See also:
https://github.com/electron/electron/issues/28831

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: sam marshall <s.marshall@open.ac.uk>
2026-01-21 14:51:12 -05:00
trop[bot]
5976fa394b docs: add a few API history fragments (#49478)
* docs: add a few API history fragments

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* manual fixes

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-01-21 13:12:06 -05:00
trop[bot]
5ed82c16e8 revert: use deprecated setAllowedFileTypes in macOS dialogs (#49470)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove stray import

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-21 17:57:39 +01:00
electron-roller[bot]
486a9a61d2 chore: bump chromium to 146.0.7635.0 (main) (#49408)
* chore: bump chromium in DEPS to 146.0.7635.0

* chore: update patch hunk headers

* 7078551: [wasm] Refactor caching API

https://chromium-review.googlesource.com/c/v8/v8/+/7078551

* 7141498: [api] Remove unused context parameter from FixedArray::Get

https://chromium-review.googlesource.com/c/v8/v8/+/7141498

* 7454865: Add timeouts to content API for CopyFromSurface

https://chromium-review.googlesource.com/c/chromium/src/+/7454865

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 15:37:02 +01:00
Niklas Wenzel
7851a34c2d docs: fix webContents.hostWebContents types (#49424) 2026-01-19 10:45:23 +01:00
Shelley Vohr
faa21a748f fix: MAS rejection for private APIs (#49391) 2026-01-18 10:34:16 +01:00
Shelley Vohr
5bd2938f6a fix: try clearing InspectableWebContents delegate earlier (#49406)
fix: try clearing InspectableWebContents delegate earlier
2026-01-16 21:36:34 +01:00
electron-roller[bot]
f149efe32e chore: bump node to v24.13.0 (main) (#49189)
* chore: bump node in DEPS to v24.12.0

* src: use CP_UTF8 for wide file names on win32

https://github.com/nodejs/node/pull/60575

* test,crypto: handle a few more BoringSSL tests

https://github.com/nodejs/node/pull/59030

* chore: fixup patch indices

* chore: re-add accidentally removed sslv23 test

* chore: fixup crypto patch rebase

* test: make buffer sizes 32bit-aware in test-internal-util-construct-sab

https://github.com/nodejs/node/pull/61026

* src: add internal binding for constructing SharedArrayBuffers

https://github.com/nodejs/node/pull/60497

* chore: bump node in DEPS to v24.13.0

* chore: fixup patch indices

* chore: fixup sandboxed pointers patch

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-16 11:08:38 -05:00
Daniel Gräfe
5dd509d2f4 fix: restore AXDocument accessibility attribute for representedFilename on macOS (#49346)
Starting from Chromium 134.0.6989.0 (Electron 35.0.0-beta.5), the
NativeWidgetMacNSWindow class overrides accessibilityDocument to return
the web content URL from the accessibility tree, but doesn't fall back
to NSWindow's default behavior when that URL is empty.

This broke Electron's setRepresentedFilename() API - the file path was
still set on the NSWindow, but no longer exposed via the AXDocument
accessibility attribute that screen readers use.

This fix adds an accessibilityDocument override in ElectronNSWindow that
checks representedFilename first, falling back to Chromium's behavior
for web content URLs.

Fixes: https://github.com/electron/electron/issues/XXXXX

Co-authored-by: Claude Opus 4.5 <noreply@anthropic.com>
2026-01-16 10:27:29 +01:00
Alex Schwartz
bdd7730a24 fix: make toplevel icon Wayland protocol work (#49290) 2026-01-16 09:55:52 +01:00
dependabot[bot]
060e76f1b6 build(deps): bump actions/upload-artifact from 5.0.0 to 6.0.0 (#49220)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](330a01c490...b7c566a772)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-16 09:55:38 +01:00
David Sanders
2fbf1f5c72 ci: detect patch needs update error with problem matcher (#49405) 2026-01-15 19:18:50 -08:00
Charles Kerr
c769361af2 fix: warning: default arguments on virtual or override methods (#49398)
fix: warning: default arguments on virtual or override methods are prohibited [google-default-arguments]

we never override these, so just make them nonvirtual
2026-01-15 16:09:43 -08:00
electron-roller[bot]
6ea7d6d5a4 chore: bump chromium to 146.0.7633.0 (main) (#49390)
* chore: bump chromium in DEPS to 146.0.7633.0

* chore: fixup patch indices

* chore: fix unsafe buffer usage in browser_linux.cc

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-15 10:52:42 -05:00
Charles Kerr
27b3a32307 chore: update patches (#49399) 2026-01-14 22:33:23 -08:00
Charles Kerr
ddeb970f18 refactor: make ReplyChannel inherit from gin::Wrappable (#49339)
* refactor: make ReplyChannel inherit from gin::Wrappable

* chore: add kElectronReplyChannel to chore_add_electron_objects_to_wrappablepointertag.patch

* fix: use gin::PerIsolateData::DisposeObserver

* fix: lifetime issues

* chore: rm perisolatedata hook in favor of prefinalizer

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-14 18:35:01 -06:00
electron-roller[bot]
5d80264944 chore: bump chromium to 145.0.7628.0 (main) (#49331)
* chore: bump chromium in DEPS to 145.0.7620.0

* chore: bump chromium in DEPS to 145.0.7622.0

* chore: bump chromium in DEPS to 145.0.7624.0

* chore: bump chromium in DEPS to 145.0.7626.0

* chore: bump chromium in DEPS to 145.0.7628.0

* 7362759: Migrate various base::Contains() to contains() in ui | https://chromium-review.googlesource.com/c/chromium/src/+/7362759

* chore: update patches

* 7411324: url: Mark deprecated functions as UNSAFE_BUFFER_USAGE

https://chromium-review.googlesource.com/c/chromium/src/+/7411324

* 7366867: Store property info in CSSParserLocalContext for random()

https://chromium-review.googlesource.com/c/chromium/src/+/7366867

* 7277406: Exclude PiP from getDisplayMedia picker thumbnails

https://chromium-review.googlesource.com/c/chromium/src/+/7277406

* 7253489: activity_reporter: Create stub module owned by browser_process

https://chromium-review.googlesource.com/c/chromium/src/+/7253489

* 7404514: Create device parental controls delegate

https://chromium-review.googlesource.com/c/chromium/src/+/7404514

* 7269504: Update histograms to use the updated MediaStreamRequestResult enum

https://chromium-review.googlesource.com/c/chromium/src/+/7269504

* fixup! 7253489: activity_reporter: Create stub module owned by browser_process

* 7368549: Reland "Use native rollup"

https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7368549

* 4803165: Enable suppressing input event dispatch while paint-holding.

https://chromium-review.googlesource.com/c/chromium/src/+/4803165

* chore: make device_parental_controls lazy

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-14 15:34:24 +01:00
Erick Zhao
dae76c2885 docs: remove stale example and standardize DevTools capitalization (#49321)
* docs: remove stale example and standardize `DevTools` capitalization

* Update docs/api/web-contents.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

---------

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>
2026-01-14 10:35:53 +01:00
Erick Zhao
a368c5da0c docs: improve build-tools instructions (#49294)
* docs: improve build-tools instructions

* address comments

* update directory structure

* update

* nits

* node -> electron_node

* update macos build version

* Update docs/development/build-instructions-gn.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-14 09:51:55 +01:00
Keeley Hammond
1b2679b315 fix: revert os_crypt async cookie provider implementation (#49382)
* Revert "fix: provide explicit cookie encryption provider for cookie encryption (#49348)"

This reverts commit 95f097a392.

* Revert "fix: fix cookie encryption provider loading on Windows and Linux (#49371)"

This reverts commit 0e4ee9f03a.

* revert: 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-14 09:34:00 +01:00
Shelley Vohr
15acf70760 build: roll build-image to a82b87d (#49377)
build: roll build-image to a82b87d
2026-01-13 12:13:14 +01:00
dependabot[bot]
324eb0eb1c build(deps): bump github/codeql-action from 4.31.7 to 4.31.10 (#49376)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.7 to 4.31.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cf1bb45a27...cdefb33c0f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-13 10:25:10 +01:00
Keeley Hammond
0e4ee9f03a fix: fix cookie encryption provider loading on Windows and Linux (#49371)
* fix: support cookie encryption provider cross-platform

* fix: add async macos key provider
2026-01-12 19:39:29 -08:00
Charles Kerr
ae94cefdba refactor: add static ReplyChannel::SendError() helper (#49338)
* refactor: add static void ReplyChannel::SendError()

* refactor: use static SendError() instead of instantiating a temporary

* refactor: remove non-static version of SendError()

* refactor: remove redundant callback-is-non-null checks
2026-01-12 17:02:58 -06:00
Shelley Vohr
409c29b12b build: roll build-tools SHA to 4430e4a (#49362)
build: roll build-tools SHA to 4430e4a
2026-01-12 12:22:30 -05:00
Shelley Vohr
b0e012f14e build: update on-create-command for siso (#49357) 2026-01-12 14:30:48 +01:00
Calvin
9a5ffd920c feat: suppress devtools console logging (#49292)
* feat: suppress devtools console logging

* Emit messages as-is in testing builds

* Promote `DCHECK_IS_ON()` to preprocessor check
2026-01-12 11:31:33 +01:00
Charles Kerr
cf2e283332 fix: clang-tidy warnings, pt. 1 (#49083)
* fix: google-readability-casting warning about the uint32_t cast

* fix: modernize-use-equals-default warnings

* fix: readability-redundant-member-init warning

* fix: modernize-make-unique warnings

* fix: modernize-use-emplace

warning: use emplace_back instead of push_back

* refactor: address code review feedback
2026-01-09 22:57:38 -08:00
Niklas Wenzel
d6a6312fc8 build: update NMV to 145 (#49349) 2026-01-09 18:14:18 -08:00
Keeley Hammond
95f097a392 fix: provide explicit cookie encryption provider for cookie encryption (#49348)
fix: provide explicit cookie encryption provider

Fixes 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-09 11:53:58 -08:00
Niklas Wenzel
b380755514 chore: remove stakeholders mention from PR template (#49317) 2026-01-09 00:36:40 -08:00
David Sanders
3985daa81c chore: improvements to script/run-clang-tidy.ts (#49335)
* chore: disable color output for clang-tidy in CI

* chore: small QoL improvements to run-clang-tidy.ts

* chore: add --fix option to script/run-clang-tidy.ts
2026-01-08 22:05:44 -08:00
Erick Zhao
5901d8a6d8 docs: document ELECTRON_SKIP_BINARY_DOWNLOAD (#49320) 2026-01-07 14:54:22 -08:00
electron-roller[bot]
eee60f202c chore: bump chromium to 145.0.7618.0 (main) (#49314)
* chore: bump chromium in DEPS to 145.0.7618.0

* 7399531: [GTK] Don't preselect file dialog accept buttons | https://chromium-review.googlesource.com/c/chromium/src/+/7399531

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-07 15:01:56 -05:00
Charles Kerr
b5a7d81c7d refactor: have GetXdgAppId() return a std::optional<std::string> (#49318)
* refactor: GetXdgAppId() now returns std::optional<std::string>

* refactor: slightly simplify app.setDesktopName() ts calls

* refactor: add better documentation for dekstop-entry in XDG notifications
2026-01-07 14:30:09 -05:00
dependabot[bot]
a89b2cd9bc build(deps): bump actions/download-artifact from 6.0.0 to 7.0.0 (#49221)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](018cc2cf5b...37930b1c2a)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-06 15:48:38 -05:00
Niklas Wenzel
44fa30695f docs: update roundedCorners documentation (#49195) 2026-01-05 16:27:46 -05:00
Niklas Wenzel
2ab56adbbd test: remove outdated disabled test (#49196) 2026-01-05 16:27:01 -05:00
electron-roller[bot]
a1f0ef80d4 chore: bump chromium to 145.0.7616.0 (main) (#49279)
* chore: bump chromium in DEPS to 145.0.7605.0

* chore: bump chromium in DEPS to 145.0.7606.0

* chore: bump chromium in DEPS to 145.0.7608.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7610.0

* chore: update patches

* [InputVizard] Fix missing touch cancel in InputTransferHandlerAndroid
using InputEventSource

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7302368

* chore: bump chromium in DEPS to 145.0.7611.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7614.0

* chore: bump chromium in DEPS to 145.0.7615.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7616.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-05 13:34:36 -05:00
dependabot[bot]
c1a031be83 build(deps): bump actions-cool/issues-helper from 3.7.3 to 3.7.5 (#49282)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.3 to 3.7.5.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](3809910bc1...e2ff99831a)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-05 12:26:03 -05:00
John Kleinschmidt
c8bb700509 build: fixup release notes generation (#49302) 2026-01-05 11:11:40 -05:00
Calvin
46922de638 fix: drag regions in child windows (#49231)
* fix: drag regions in child windows

* Update comments
2026-01-05 10:34:01 -05:00
Niklas Wenzel
75ea93a279 chore: remove quiet period mention from PR template (#49298) 2026-01-05 10:12:07 -05:00
John Kleinschmidt
ace0beaa3f build: add logging to notes generator (#49300) 2026-01-05 09:49:51 -05:00
electron-roller[bot]
9eb43f3286 chore: bump chromium to 145.0.7604.0 (main) (#49265)
* chore: bump chromium in DEPS to 145.0.7599.0

* chore: bump chromium in DEPS to 145.0.7600.0

* chore: bump chromium in DEPS to 145.0.7602.0

* chore: bump chromium in DEPS to 145.0.7604.0

* chore: update patches (trivial only)

* [bytesize] Migrate network data in Task Manager to ByteSize.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/7266090

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-28 20:40:50 -08:00
electron-roller[bot]
809ab09b6f chore: bump chromium to 145.0.7596.0 (main) (#49224)
* chore: bump chromium in DEPS to 145.0.7588.0

* fix(patch-conflict): update scroll_bounce_flag for split overscroll methods

Chromium split IsElasticOverscrollEnabled() into two methods:
IsElasticOverscrollEnabledOnRoot() and IsElasticOverscrollSupported().
Updated patch to apply the scroll-bounce command-line switch to both
methods.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7233733

* fix(patch-conflict): update exclusive_access patch context

Upstream refactored the profile variable declaration. Updated patch to
match new surrounding context with brace-style if statement.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239252

* fix(patch-conflict): update screen capture kit non-shareable filter

Upstream refactored PiP window exclusion to use GetWindowsToExclude()
helper function. Updated patch to combine non-shareable window filtering
with the new helper's output.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7274596

* fix(patch-conflict): update corner smoothing CSS property id position

Upstream added new internal overscroll CSS properties. Updated patch to
add kElectronCornerSmoothing after the new entries.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234051

* fix(patch-conflict): update permission patches for new permission types

Upstream added new permission types: LOCAL_NETWORK, LOOPBACK_NETWORK,
and GEOLOCATION_APPROXIMATE. Updated Electron permission patches to
include these new types and renumber Electron-specific permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7231952

* fix(patch-conflict): update memory query fallback for new function signature

Upstream added AmountOfTotalPhysicalMemory() with PCHECK. Updated patch
to maintain fallback logic with correct ByteSize return type.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254886

* chore: update patch hunk headers

* fix(patch): update reclient-configs patch to use new file mode

The fix_add_python_remote_wrapper patch was using 'copy from' mode
which caused inconsistent behavior between local and CI git versions.
Changed to 'new file' mode for consistent patch application.

* fix(patch-conflict): remove duplicate GEOLOCATION_APPROXIMATE case

Upstream moved GEOLOCATION_APPROXIMATE earlier in the switch statement
in GetPermissionString(). The 3-way merge kept both the old and new
positions, causing a duplicate case error.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6397637

* chore: update libcxx filenames for new headers

* chore: bump chromium in DEPS to 145.0.7590.0

* chore: update patch hunk headers

* fix(patch): update memory fallback return type to ByteSize

Upstream changed the return type from ByteCount to ByteSize.

* fix: suppress nodiscard warning in node_file.cc

libc++ added [[nodiscard]] to std::filesystem::copy_options operator|=
which causes build failures with -Werror.

* 7229082: update CopyFromSurface to use CopyFromSurfaceResult

Upstream changed CopyFromSurface callback to return
base::expected<viz::CopyOutputBitmapWithMetadata, std::string>
instead of SkBitmap, enabling better error handling.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7229082

* 7254070: add ip_address_space param to OnLocalNetworkAccessPermissionRequired

Upstream added IPAddressSpace parameter to check address space for
proper permission handling in Local Network Access.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254070

* 7136679: add spelling_markers param to RequestCheckingOfText

Upstream added spelling_markers parameter to report misspelling
ranges from Blink to Spellcheck to IME.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7136679

* 7240487: remove second param from RegisterWebSafeIsolatedScheme

Upstream removed the schemes_okay_to_appear_as_origin_headers_ parameter.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7240487

* 7254577: use explicit WebElement constructor

WebElement default constructor now requires explicit construction
rather than brace initialization.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254577

* 7256335: remove override from CreateGlobalFeaturesForTesting

Upstream removed BrowserProcess::CreateGlobalFeaturesForTesting virtual
method so the override specifier is no longer valid.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7256335

* chore: add missing SingleThreadTaskRunner include

A transitive include of SingleThreadTaskRunner was removed upstream,
requiring an explicit include.

Ref: Unable to locate specific CL (transitive include change)

* 7260483: add LOCAL_NETWORK, LOOPBACK_NETWORK permission type cases

Upstream added new permission types for Local Network Access split
permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7260483

* chore: update patch hunk headers

* 7264893: update postMessage tests for file: origin serialization change

Chromium now serializes file: origins as 'null' in MessageEvent per spec.
This is a security improvement aligning with the HTML spec behavior.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893

* fix: add paths to custom scheme URLs in protocol tests

Custom scheme URLs without paths (e.g. test-scheme://foo) cause a
DCHECK crash in ASAN builds when CorsURLLoader tries to log the
request via GenerateRequestLine -> PathForRequest, which asserts
that the path is non-empty.

Adding trailing slashes ensures URLs have valid paths.

* chore: bump chromium in DEPS to 145.0.7592.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 145.0.7594.0

* chore: bump chromium in DEPS to 145.0.7596.0

* chore: update accelerator.patch

no manual changes; patch applied with fuzz 2 (offset 1 line)

* chore: update patches (trivial only)

* chore: node ./script/gen-libc++-filenames.js

---------

Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-25 17:15:53 -06:00
Samuel Attard
3df3a6a736 fix: webRequest.onBeforeSendHeaders not being able to modify reserved headers (#49226)
* fix: `webRequest.onBeforeSendHeaders` not being able to modify reserved headers

* chore: add unit test for reserved header
2025-12-19 23:08:40 +13:00
Samuel Attard
7433c14af5 chore: add CLAUDE.md and Chromium Upgrade claude skill (#49229)
* chore: add CLAUDE.md and Chromium Upgrade claude skill

* Update script/lint.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-12-19 13:07:58 +13:00
electron-roller[bot]
a90ccc753b chore: bump chromium to 145.0.7577.0 (main) (#49175)
* chore: bump chromium in DEPS to 145.0.7572.0

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Polished the edits and formatted the result. No real changes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7232079 "7232079: Use WindowsToExclude to exclude PiP window in macOS screencapture device"

* chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7214586 "7214586: Refactor SelectFileDialogLinuxPortal to request XDG portal on demand"
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910 "7237910: Remove g_gtk_ui global"

* 7228586: Migrate SystemMemoryInfo from ByteCount to ByteSize

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7228586

* 7207583: GlobalRenderFrameHostId to ChildProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7207583

* 7205548: Remove uses of BodyAsStringCallbackDeprecated (extensions/)

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7205548

* chore: bump chromium in DEPS to 145.0.7574.0

* chore: update libc++ filenames

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7246150 "7246150: Fix crash in ScreenCaptureKitDeviceMac due to null PIPScreenCaptureCoordinator"

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* fixup! chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

* 7239572: [OOPIF PDF] Enable OOPIF PDF by default on Windows/macOS/Linux

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239572

* chore: bump chromium in DEPS to 145.0.7576.0

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* chore: update patches (trivial only)

* chore: add note to keep patch that was upstreamed but reverted

fix_restore_original_resize_performance_on_macos.patch was organically upstreamed but that change got reverted just after the current roll's cutoff.

I've added a note in the patch contents so the patch sticks around and so we can keep it after the revert is included.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* chore: bump chromium in DEPS to 145.0.7577.0

* chore: update patches (trivial only)

* chore(patch-conflict): keep patch after revert

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* 7237910: Remove g_gtk_ui global

I tried to find a way to avoid the patch, but other approaches seemed complex and involved.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910

* 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7251900

* 7170174: [LNA] Retry requests for cached local resources

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7170174

* fix: PDFs use OOPIF (behavior change)

* fixup! 7237910: Remove g_gtk_ui global

* fixup! 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-16 12:32:38 -05:00
John Kleinschmidt
e181fd040f build: drop dugite as a dependency (#49194) 2025-12-12 13:43:12 -05:00
David Sanders
a486185e10 ci: disallow non-maintainer changes to Yarn files (#49186) 2025-12-11 09:25:29 -05:00
John Kleinschmidt
8cefc8425c build: upgrade yarn to 4.12.0 (#49176) 2025-12-10 14:04:14 -05:00
electron-roller[bot]
fe477ce3aa chore: bump chromium to 145.0.7568.0 (main) (#49145)
* chore: bump chromium in DEPS to 145.0.7562.0

* fix(patch-conflict): update code cache patch for PersistentCache refactor

Upstream refactored code cache to use PersistentCache with new class-based
implementation (NoopCodeCacheHost, LocalCodeCacheHost, CodeCacheWithPersistentCacheHost).
Updated patch to integrate custom scheme support into the new structure while
preserving ProcessLockURLIsCodeCacheScheme checks for embedder-registered schemes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7044986

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update dialog patch for RequestXdgDesktopPortal API

Upstream changed from SetSystemdScopeUnitNameForXdgPortal to RequestXdgDesktopPortal
API pattern. Updated OnServiceStarted signature and kept OnSystemdUnitStarted callback
that calls Electron's file_dialog::StartPortalAvailabilityTestInBackground().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7204285

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): remove reference to deleted AbortByPlaceholderLayout flag

Upstream removed the AbortByPlaceholderLayout runtime flag from
runtime_enabled_features.json5. Updated patch to only add ElectronCSSCornerSmoothing
without the removed flag reference.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7226494

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): guard media_file_system_registry for ChromeOS only

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7100719
moved media_file_system_registry to be ChromeOS-only since Media
Galleries is a Chrome Apps API and Chrome Apps are only available
on Chrome OS now.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): update VideoPixelFormat API for SharedImageFormat

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7207153
removed VideoPixelFormatToGfxBufferFormat as part of migration to
SharedImageFormat. Update to use VideoPixelFormatToSharedImageFormat
which directly returns the SharedImageFormat.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): extend profile methods patch for ShouldEnableXfaForms

The ShouldEnableXfaForms function uses Profile::FromBrowserContext()
which is not available in Electron. Wrap the profile-dependent code
in #if 0 to fall through to the feature flag default.

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: bump chromium in DEPS to 145.0.7563.0

* chore: bump chromium in DEPS to 145.0.7565.0

* chore: bump chromium in DEPS to 145.0.7567.0

* chore: bump chromium in DEPS to 145.0.7568.0

* fix(patch-conflict): update content_main_delegate.h context for IsInitFeatureListEarly

Upstream added a new IsInitFeatureListEarly() virtual method to ContentMainDelegate
just before where our GetBrowserV8SnapshotFilename() method is added. Updated patch
context to account for this new method.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-update): include v8-cppgc.h for CppHeap complete type

The std::unique_ptr<v8::CppHeap> default argument in node.h requires
the complete CppHeap type definition for the destructor. Added the
v8-cppgc.h include to provide the full type definition.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): move NativeAppWindowFrameViewMacClient before constructor

The std::unique_ptr<NativeAppWindowFrameViewMacClient> member requires
the complete type definition to be visible at the point of the constructor
because the unique_ptr destructor may be instantiated during exception
handling. Moved the class definition before the NativeWindowMac constructor.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update create_browser_v8_snapshot_file_name_fuse context for IsInitFeatureListEarly

The upstream added IsInitFeatureListEarly() virtual method declaration to
ContentMainDelegate class. Updated the patch context to account for this
new function being present before the GetBrowserV8SnapshotFilename()
declaration we add.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-update): remove reverted IsInitFeatureListEarly from v8 snapshot patch

The upstream added IsInitFeatureListEarly() was reverted, so the patch should
not include this declaration. Only GetBrowserV8SnapshotFilename() should be
added by the create_browser_v8_snapshot_file_name_fuse patch.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7230430

Co-Authored-By: Claude <noreply@anthropic.com>

* 6171655: include single_thread_task_runner.h for complete type

Added include for base/task/single_thread_task_runner.h in osr_converter.cc
to resolve incomplete type error when using
base::SingleThreadTaskRunner::GetCurrentDefault().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6171655

Co-Authored-By: Claude <noreply@anthropic.com>

* 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

Upstream removed GetChromiumGitRevision() function from embedder_support.
Updated to use CHROMIUM_GIT_REVISION macro directly via
build/util/chromium_git_revision.h as recommended in the Chromium CL.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7224136

Co-Authored-By: Claude <noreply@anthropic.com>

* fixup! 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

* fix(build): add missing include

`components/dbus/xdg/systemd.h` for `void OnSystemdUnitStarted(dbus_xdg::SystemdUnitStatus)` in the same patch.

* fix(build): adapt to string-view-ification change in windows jump_list.cc

7186922: Fix unsafe buffer usage in base/win/win_util.cc
https://chromium-review.googlesource.com/c/chromium/src/+/7186922

* chore: update libc++ filenames

* fixup! fix(build): add missing include

* fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

* fixup! fix(build): guard media_file_system_registry for ChromeOS only

* fixup! fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-10 10:28:31 -05:00
John Kleinschmidt
bab6bd3dae build: use @electron-ci/dev-root for package.json default (#49154) 2025-12-09 14:49:12 -05:00
dependabot[bot]
33f6942565 build(deps): bump actions/stale from 10.1.0 to 10.1.1 (#49159)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.0 to 10.1.1.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5f858e3efb...997185467f)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:50 -05:00
dependabot[bot]
a1b2e82778 build(deps): bump actions-cool/issues-helper from 3.7.2 to 3.7.3 (#49157)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.2 to 3.7.3.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](9861779a69...3809910bc1)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:13 -05:00
dependabot[bot]
1e06b74cd2 build(deps): bump github/codeql-action from 4.31.6 to 4.31.7 (#49155)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.6 to 4.31.7.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fe4161a26a...cf1bb45a27)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.7
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:15:08 -05:00
dependabot[bot]
fe0caa0e0d build(deps): bump actions/checkout from 6.0.0 to 6.0.1 (#49158)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.0 to 6.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](1af3b93b68...8e8c483db8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:14:41 -05:00
dependabot[bot]
cd48083be8 build(deps): bump actions/setup-node from 6.0.0 to 6.1.0 (#49156)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.0.0 to 6.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](2028fbc5c2...395ad32622)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:13:56 -05:00
John Kleinschmidt
8d5b104c17 build: upgrade github-app-auth to 3.2.0 (#49152) 2025-12-09 09:49:37 -05:00
John Kleinschmidt
6e134a8ad9 build: use powershell for Electron build step (#49144) 2025-12-08 16:03:40 -05:00
electron-roller[bot]
95e87e46ab chore: bump chromium to 144.0.7547.0 (main) (#49058)
* chore: bump chromium in DEPS to 144.0.7543.0

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

* chore: update patches

* chore: update filenames.libcxx.gni

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

* chore: bump chromium in DEPS to 144.0.7545.0

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7547.0

* chore: update patches

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

* fixup Add support for UnownedUserData in GlobalFeatures

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

* fixup BUILD.gn for lint

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

* chore: skip setting LPAC ACLs

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <70381+ckerr@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Samuel Attard <MarshallOfSound@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-12-04 16:40:04 -08:00
Jan Hannemann
90e338df50 fix: run toast creation on background thread (#49106)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

* fix: comments
2025-12-02 15:27:22 -08:00
dependabot[bot]
1b3fc9c174 build(deps): bump actions/checkout from 4.2.2 to 6.0.0 (#49125)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.2.2...1af3b93b6815bc44a9784bd300feb67ff0d1eeb3)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:02:06 -05:00
dependabot[bot]
c51018281f build(deps): bump github/codeql-action from 4.31.5 to 4.31.6 (#49124)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.5 to 4.31.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fdbfb4d275...fe4161a26a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:01:21 -05:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
Keeley Hammond
c7aa0b537d chore: cherry-pick ec6c18478382 from v8 (#48335)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches
2025-09-16 19:08:15 -07:00
Robo
048d620701 fix: remove unneeded handlescope from JS callbacks (#48318)
fix: remove handlescope from JS callbacks
2025-09-16 06:56:38 +09:00
Charles Kerr
15cdae1cf0 refactor: make api::NetLog inherit from gin::Wrappable (#48308)
* refactor: remove unused v8::Isolate* arg from NetLog ctor

* refactor: allocate api::NetLog on cpp heap

* refactor: make electron::api::Session::net_log_ a cppgc::Member<api::NetLog>

* refactor: remove unnecessary EscapableHandleScope

* chore: code style consistency
2025-09-16 06:29:46 +09:00
Shelley Vohr
bac383c219 feat: add fileSystem to ses.setPermissionCheckHandler (#48170)
feat: add fileSystem to ses.setPermissionCheckHandler
2025-09-15 17:00:58 -04:00
John Kleinschmidt
49eb165ef9 ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48319)
cleanup
2025-09-15 16:31:49 -04:00
Charles Kerr
a468ed7f10 refactor: narrow or remove gin arguments (#48300)
* refactor: narrow App:SetJumpList() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow WebContents::AddWorkSpace() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowMessageBox() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowOpenDialog() arg from gin::Arguments* to v8::Isolate*

* refactor: remove unused gin::Arguments* arg from OverrideGlobalPropertyFromIsolatedWorld()

* refactor: narrow WebContents::StartDrag() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow NetLog::StopLogging() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow Protocol::IsProtocolHandled() arg from gin::Arguments* to v8::Isolate*
2025-09-13 08:19:07 +09:00
Calvin
5444738721 fix: set ozone platform for wayland (#48301)
* fix: set ozone platform for wayland

* whoops, includes. thx charles
2025-09-13 08:17:06 +09:00
Charles Kerr
a6959ca97b refactor: allocate api::Debugger on cpp heap (#48266)
* refactor: remove unused isolate arg from Debugger ctor

* refactor: make Debugger ctor, dtor public

needed for cppgc::MakeGarbageCollected()

This is what upstream does, e.g. https://chromium-review.googlesource.com/c/chromium/src/+/6722236

* fixup! refactor: remove unused isolate arg from Debugger ctor

mark Debugger ctor as explicit

* refactor: in EventEmitterMixin, handle both old and new WrapperInfo types

* refactor: make electron::api::Debugger inherit from gin::Wrappable

* refactor: add api::Debugger::GetTypeName()

* refactor: add api::Debugger::GetClassName()
2025-09-11 16:03:17 -04:00
dependabot[bot]
45353ae38c build(deps): bump actions/setup-node from 4.4.0 to 5.0.0 (#48282)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.4.0 to 5.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](49933ea528...a0853c2454)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 21:35:54 -05:00
Charles Kerr
f702327dce refactor: avoid unused inheritance in ServiceWorkerMain (#48279)
ServiceWorkerMain does not need to inherit from EventEmitterMixin
2025-09-10 11:16:35 -05:00
dependabot[bot]
fda3a3d493 build(deps): bump github/codeql-action from 3.29.11 to 3.30.1 (#48283)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.11 to 3.30.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3c3833e0f8...f1f6e5f6af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 09:47:34 -05:00
Michaela Laurencin
dae5dad167 docs: update release timeline for unsupported v35 (#48285) 2025-09-09 15:03:48 -07:00
John Kleinschmidt
940ebb6c7a chore: update patches (#48278) 2025-09-08 15:44:47 -04:00
electron-roller[bot]
793565e4be chore: bump chromium to 141.0.7390.7 (main) (#48212)
* chore: bump chromium in DEPS to 141.0.7381.3

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7382.0

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7384.0

* chore: bump chromium in DEPS to 141.0.7386.0

* [Extensions] Move devtools_page and chrome_url_overrides handlers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6862700

* Reland "[api] Advance deprecation of GetIsolate"

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6875273

* Move "system integrated UI" concept out of NativeTheme.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6867375

* chore: update patches

* Reland "[PermissionOptions] Return PermissionResult in callback for requests"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6851838

* Reland "[exit-time-destructors] Enable by default"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update patches

* [FSA] Revoke Read access after removing file via FileSystemAccess API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6677249

* chore: IWYU

* [DevToolsUIBindings] Accept an object for `dispatchHttpRequest` params

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6877528

* chore: IWYU

* Pass navigation UI parameters on EnterFullscreen in EAM

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6874923

* chore: rm band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch

* Remove unused PreHandleMouseEvent

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6880411

* 6878583: siso: update to version 1.4.1

https://chromium-review.googlesource.com/c/chromium/src/+/6878583

* Fold native_theme_browser into native_theme.

https://chromium-review.googlesource.com/c/chromium/src/+/6882627

* fixup: Reland "[exit-time-destructors] Enable by default

https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update filenames.libcxx.gni

* chore: IWYU

* fixup: chore: IWYU

* fixup: Reland "[exit-time-destructors] Enable by default

* fixup: Reland "[exit-time-destructors] Enable by default

* Remove common_theme.*; place its method in NativeTheme instead.

https://chromium-review.googlesource.com/c/chromium/src/+/6886029

* fixup: Reland "[exit-time-destructors] Enable by default

* Better track when WebPreferences need updates for color-related changes.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6886797

* chore: bump chromium in DEPS to 141.0.7390.7

* 6904664: Reland "Make BrowserContext::GetPath() const"

https://chromium-review.googlesource.com/c/chromium/src/+/6904664

* Restore read access after certain file modification operations

https://chromium-review.googlesource.com/c/chromium/src/+/6861041

* fixup: Move "system integrated UI" concept out of NativeTheme.

* fixup: Reland "[exit-time-destructors] Enable by default

* chore: update patches

* 6906096: Remove GetSysSkColor().

https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* Inline implementation of SysColorChangeListener into the lone user.

https://chromium-review.googlesource.com/c/chromium/src/+/6905083

Also 6906096: Remove GetSysSkColor(). | https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* fixup: 6906096: Remove GetSysSkColor()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-08 12:57:15 +02:00
electron-roller[bot]
1f322ebce3 chore: bump node to v22.19.0 (main) (#48222)
* chore: bump node in DEPS to v22.19.0

* chore: fixup patch indices

* crypto: add tls.setDefaultCACertificates()

https://github.com/nodejs/node/pull/58822

* esm: js-string Wasm builtins in ESM Integration

https://github.com/nodejs/node/pull/59179

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-05 17:16:45 -04:00
Samuel Attard
f009e077f2 build: update spec deps for clean audit (#48238) 2025-09-03 15:05:49 -04:00
659 changed files with 34309 additions and 19906 deletions

1
.claude/.gitignore vendored Normal file
View File

@@ -0,0 +1 @@
settings.local.json

24
.claude/settings.json Normal file
View File

@@ -0,0 +1,24 @@
{
"permissions": {
"allow": [
"Bash(e sync)",
"Bash(e patches --list-targets:*)",
"Bash(git add:*)",
"Bash(git am:*)",
"Bash(git commit:*)",
"Bash(git log:*)",
"Bash(git show:*)",
"Bash(e patches:*)",
"Bash(e sync:*)",
"Skill(electron-chromium-upgrade)",
"Read(*)",
"Bash(echo:*)",
"Bash(e build:*)",
"Bash(tee:*)",
"Bash(git diff:*)",
"Bash(git rev-parse:*)"
],
"deny": [],
"ask": []
}
}

View File

@@ -0,0 +1,199 @@
---
name: electron-chromium-upgrade
description: Guide for performing Chromium version upgrades in the Electron project. Use when working on the roller/chromium/main branch to fix patch conflicts during `e sync --3`. Covers the patch application workflow, conflict resolution, analyzing upstream Chromium changes, and proper commit formatting for patch fixes.
---
# Electron Chromium Upgrade: Phase One
## Summary
Run `e sync --3` repeatedly, fixing patch conflicts as they arise, until it succeeds. Then run `e patches all` and commit changes atomically.
## Success Criteria
Phase One is complete when:
- `e sync --3` exits with code 0 (no patch failures)
- `e patches all` has been run to export all changes
- All changes are committed per the commit guidelines below
Do not stop until these criteria are met.
**CRITICAL** Do not delete or skip patches unless 100% certain the patch is no longer needed. Complicated conflicts or hard to resolve issues should be presented to the user after you have exhausted all other options. Do not delete the patch just because you can't solve it.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (where most patches apply)
- `patches/`: Patch files organized by target
- `docs/development/patches.md`: Patch system documentation
## Workflow
1. Delete the `.git/rr-cache` in both the `electron` and `..` folder to ensure no accidental rerere replays occur from before this upgrade phase attempt started
2. Run `e sync --3` (the `--3` flag enables 3-way merge, always required)
3. If succeeds → skip to step 6
4. If patch fails:
- Identify target repo and patch from error output
- Analyze failure (see references/patch-analysis.md)
- Fix conflict in target repo's working directory
- Run `git am --continue` in affected repo
- Repeat until all patches for that repo apply
- IMPORTANT: Once `git am --continue` succeeds you MUST run `e patches {target}` to export fixes
- Return to step 1
5. When `e sync --3` succeeds, run `e patches all`
6. **Read `references/phase-one-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
Before committing any Phase One changes, you MUST read `references/phase-one-commit-guidelines.md` and follow its instructions exactly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e sync --3` | Clone deps and apply patches with 3-way merge |
| `git am --continue` | Continue after resolving conflict (run in target repo) |
| `e patches {target}` | Export commits from target repo to patch files |
| `e patches all` | Export all patches from all targets |
| `e patches --list-targets` | List targets and config paths |
## Patch System Mental Model
```
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
## When to Edit Patches
| Situation | Action |
|-----------|--------|
| During active `git am` conflict | Fix in target repo, then `git am --continue` |
| Modifying patch outside conflict | Edit `.patch` file directly |
| Creating new patch (rare, avoid) | Commit in target repo, then `e patches {target}` |
Fix existing patches 99% of the time rather than creating new ones.
## Patch Fixing Rules
1. **Preserve authorship**: Keep original author in TODO comments (from patch `From:` field)
2. **Never change TODO assignees**: `TODO(name)` must retain original name
3. **Update descriptions**: If upstream changed (e.g., `DCHECK``CHECK_IS_TEST`), update patch commit message to reflect current state
## Final Deliverable
After Phase One, write a summary of every change: what was fixed, why, reasoning, and Chromium CL links.
# Electron Chromium Upgrade: Phase Two
## Summary
Run `e build -k 999` repeatedly, fixing build issues as they arise, until it succeeds. Then run `e start --version` to validate Electron launches and commit changes atomically.
Run Phase Two immediately after Phase One is complete.
## Success Criteria
Phase Two is complete when:
- `e build -k 999` exits with code 0 (no build failures)
- `e start --version` has been run to check Electron launches
- All changes are committed per the commit guidelines below
Do not stop until these criteria are met. Do not delete code or features, never comment out code in order to take short cut. Make all existing code, logic and intention work.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions. Chromium APIs frequently are renamed or refactored. In every case the code in Electron must be updated to account for the change in Chromium, strongly avoid making changes to the code in chromium to fix Electrons build.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (do not touch this code to fix build issues, just read it to obtain context)
## Workflow
1. Run `e build -k 999` (the `-k 999` flag is a flag to ninja to say "do not stop until you find that many errors" it is an attempt to get as much error
context as possible for each time we run build)
2. If succeeds → skip to step 6
3. If build fails:
- Identify underlying file in "electron" from the compilation error message
- Analyze failure
- Fix build issue by adapting Electron's code for the change in Chromium
- Run `e build -t {target_that_failed}.o` to build just the failed target we were specifically fixing
- You can identify the target_that_failed from the failure line in the build log. E.g. `FAILED: 2e506007-8d5d-4f38-bdd1-b5cd77999a77 "./obj/electron/chromium_src/chrome/process_singleton_posix.o" CXX obj/electron/chromium_src/chrome/process_singleton_posix.o` the target name is `obj/electron/chromium_src/chrome/process_singleton_posix.o`
- **Read `references/phase-two-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
- Return to step 1
4. **CRITICAL**: After ANY commit (especially patch commits), immediately run `git status` in the electron repo
- Look for other modified `.patch` files that only have index/hunk header changes
- These are dependent patches affected by your fix
- Commit them immediately with: `git commit -am "chore: update patch hunk headers"`
- This prevents losing track of necessary updates
5. Return to step 1
6. When `e build` succeeds, run `e start --version`
7. Check if you have any pending changes in the Chromium repo by running `git status`
- If you have changes follow the instructions below in "A. Patch Fixes" to correctly commit those modifications into the appropriate patch file
Before committing any Phase Two changes, you MUST read `references/phase-two-commit-guidelines.md` and follow its instructions exactly.
## Build Error Detection
When monitoring `e build -k 999` output, filter for errors using this regex pattern:
error:|FAILED:|fatal:|subcommand failed|build finished
The build output is extremely verbose. Filtering is essential to catch errors quickly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e build -k 999` | Builds Electron and won't stop until either all targets attempted or 999 errors found |
| `e build -t {target}.o` | Build just one specific target to verify a fix |
| `e start --version` | Validate Electron launches after successful build |
## Two Types of Build Fixes
### A. Patch Fixes (for files in chromium_src or patched Chromium files)
When the error is in a file that Electron patches (check with `grep -l "filename" patches/chromium/*.patch`):
1. Edit the file in the Chromium source tree (e.g., `/src/chrome/browser/...`)
2. Create a fixup commit targeting the original patch commit:
```bash
cd .. # to chromium repo
git add <modified-file>
git commit --fixup=<original-patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
3. Export the updated patch: e patches chromium
4. Commit the updated patch file in the electron repo following the `references/phase-one-commit-guidelines.md`, then commit changes following those instructions exactly. **READ THESE GUIDELINES BEFORE COMMITTING THESE CHANGES**
To find the original patch commit to fixup: `git log --oneline | grep -i "keyword from patch name"`
The base commit for rebase is the Chromium commit before patches were applied. Find it by checking the `refs/patches/upstream-head` ref.
B. Electron Code Fixes (for files in shell/, electron/, etc.)
When the error is in Electron's own source code:
1. Edit files directly in the electron repo
2. Commit directly (no patch export needed)
Dependent Patch Updates
IMPORTANT: When you modify a patch, other patches that apply to the same file may have their hunk headers invalidated. After committing a patch fix:
1. Run git status in the electron repo
2. Look for other modified .patch files with just index/hunk header changes
3. Commit these with: git commit -m "chore: update patch hunk headers"
# Critical: Read Before Committing
- Before ANY Phase One commits: Read `references/phase-one-commit-guidelines.md`
- Before ANY Phase Two commits: Read `references/phase-two-commit-guidelines.md`
# Skill Directory Structure
This skill has additional reference files in `references/`:
- patch-analysis.md - How to analyze patch failures
- phase-one-commit-guidelines.md - Commit format for Phase One
- phase-two-commit-guidelines.md - Commit format for Phase Two
Read these when referenced in the workflow steps.

View File

@@ -0,0 +1,69 @@
# Analyzing Patch Failures
## Investigation Steps
1. **Read the patch file** at `patches/{target}/{patch_name}.patch`
2. **Examine current state** of the file in Chromium at mentioned line numbers
3. **Check recent upstream changes:**
```bash
cd .. # or relevant target repo
git log --oneline -10 -- {file}
```
4. **Find Chromium CL** in commit messages:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/{CL_NUMBER}
```
## Common Failure Patterns
| Pattern | Cause | Solution |
|---------|-------|----------|
| Context lines don't match | Surrounding code changed | Update context in patch |
| File not found | File renamed/moved | Update patch target path |
| Function not found | Refactored upstream | Find new function name |
| `DCHECK` → `CHECK_IS_TEST` | Macro change | Update to new macro |
| Deleted code | Feature removed | Verify patch still needed |
## Using Git Blame
To find the CL that changed specific lines:
```bash
cd ..
git blame -L {start},{end} -- {file}
git log -1 {commit_sha} # Look for Reviewed-on: line
```
## Verifying Patch Necessity
Before deleting a patch, verify:
1. The patched functionality was intentionally removed upstream
2. Electron doesn't need the patch for other reasons
3. No other code depends on the patched behavior
When in doubt, keep the patch and adapt it.
## Phase Two: Build-Time Patch Issues
Sometimes patches that applied successfully in Phase One cause build errors in Phase Two. This can happen when:
1. **Incomplete types**: A patch disables a header include, but new upstream code uses the type
2. **Missing members**: A patch modifies a class, but upstream added new code referencing the original
### Finding Which Patch Affects a File
```bash
grep -l "filename.cc" patches/chromium/*.patch
```
Matching Existing Patch Patterns
When fixing build errors in patched files, examine the existing patch to understand its style:
- Does it use #if 0 / #endif guards?
- Does it use #if BUILDFLAG(...) conditionals?
- What's the pattern for disabled functionality?
Apply fixes consistent with the existing patch style.

View File

@@ -0,0 +1,52 @@
# Phase One Commit Guidelines
Only follow these instructions if there are uncommitted changes to `patches/` after Phase One succeeds.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Atomic Commits
For each fix made to a patch, create a separate commit:
```
fix(patch-conflict): {concise title}
{Brief explanation, 1-2 paragraphs max}
Ref: {Chromium CL link}
```
IMPORTANT: Ensure that any changes made to patch content as a result of a change in Chromium is committed individually. Each change should have it's own commit message and it's own REF.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
## Finding CL References
Use `git log` or `git blame` on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Final Cleanup
After all fix commits, stage remaining changes:
```bash
git add patches
git commit -m "chore: update patch hunk headers"
```
## Example Commit
```
fix(patch-conflict): update web_contents_impl.cc context for navigation refactor
The upstream navigation code was refactored to use NavigationRequest directly
instead of going through NavigationController. Updated surrounding context
to match new code structure.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/1234567
```

View File

@@ -0,0 +1,82 @@
# Phase Two Commit Guidelines
Only follow these instructions if there are uncommitted changes in the Electron repo after any fixes are made during Phase Two that result a target that was failing, successfully building.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Two Commit Types
### For Electron Source Changes (shell/, electron/, etc.)
```
{CL-Number}: {concise description of API change}
{Brief explanation of what upstream changed and how Electron was adapted}
Ref: {Chromium CL link}
```
IMPORTANT: Ensure that any change made to electron as a result of a change in Chromium is committed individually. Each change should have it's own commit message and it's own REF. Logically grouped into commits that make sense rather than one giant commit.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
You may include multiple "Ref" links if required.
For a CL link in the format `https://chromium-review.googlesource.com/c/chromium/src/+/2958369` the "CL-Number" is `2958369`
### For Patch Updates (patches/chromium/*.patch)
Use the same fixup workflow as Phase One:
1. Fix in Chromium source tree
2. Fixup commit + rebase
3. Export with `e patches chromium`
4. Commit the patch file:
```
fix(patch-update): {concise description}
{Brief explanation}
Ref: {Chromium CL link}
```
## Dependent Patch Header Updates
After any patch modification, check for other affected patches:
```bash
git status
# If other .patch files show as modified with only hunk header changes:
git add patches/
git commit -m "chore: update patch hunk headers"
```
## Finding CL References
Use git log or git blame on Chromium source files. Look for:
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
If no CL found after searching: Ref: Unable to locate CL
## Example Commits
### Electron Source Fix
fix: update GetPlugins to GetPluginsAsync for API change
The upstream Chromium API changed:
- Old: GetPlugins(callback) - took a callback
- New: GetPluginsAsync(callback) - async version takes a callback
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/1234567
### Patch Fix
fix(patch-conflict): update picture-in-picture for gesture handling refactor
Upstream added new gesture handling code that accesses live caption dialog.
The live caption functionality is disabled in Electron's patch, so wrapped
the new code in #if 0 guards to match existing pattern.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7654321

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -48,7 +48,8 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
\"gen\": {
\"args\": [
\"import(\\\"//electron/build/args/testing.gn\\\")\",
\"use_remoteexec = true\"
\"use_remoteexec = true\",
\"use_siso=true\"
],
\"out\": \"Testing\"
},
@@ -58,7 +59,7 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
},
\"\$schema\": \"file:///home/builduser/.electron_build_tools/evm-config.schema.json\",
\"configValidationLevel\": \"strict\",
\"remoteBuild\": \"reclient\",
\"remoteBuild\": \"siso\",
\"preserveSDK\": 5
}
" >$buildtools/configs/evm.testing.json

View File

@@ -10,7 +10,7 @@ Contributors guide: https://github.com/electron/electron/blob/main/CONTRIBUTING.
#### Checklist
<!-- Remove items that do not apply. For completed items, change [ ] to [x]. -->
- [ ] PR description included and stakeholders cc'd
- [ ] PR description included
- [ ] `npm test` passes
- [ ] tests are [changed or added](https://github.com/electron/electron/blob/main/docs/development/testing.md)
- [ ] relevant API documentation, tutorials, and examples are updated and follow the [documentation style guide](https://github.com/electron/electron/blob/main/docs/development/style-guide.md)

View File

@@ -45,6 +45,7 @@ runs:
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Build Electron ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
rm -rf "src/out/Default/Electron Framework.framework"
@@ -70,10 +71,37 @@ runs:
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Build Electron (Windows) ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
cd src\electron
git pack-refs
cd ..
$env:NINJA_SUMMARIZE_BUILD = 1
if ("${{ inputs.is-release }}" -eq "true") {
e build --target electron:release_build
} else {
e build --target electron:testing_build
}
Copy-Item out\Default\.ninja_log out\electron_ninja_log
node electron\script\check-symlinks.js
# Upload build stats to Datadog
if ($env:DD_API_KEY) {
try {
npx node electron\script\build-stats.mjs out\Default\siso.exe.INFO --upload-stats
} catch {
Write-Host "Build stats upload failed, continuing..."
}
} else {
Write-Host "Skipping build-stats.mjs upload because DD_API_KEY is not set"
}
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
@@ -184,7 +212,7 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash

View File

@@ -143,16 +143,17 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matcher
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
npx node src/electron/script/patches-stats.mjs --upload-stats || true
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD

View File

@@ -37,6 +37,22 @@ runs:
installation-dir: third_party/esbuild
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/esbuild/${platform}
- name: Fix rollup
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
dependency: rollup_libs
deps-file: src/third_party/devtools-frontend/src/DEPS
installation-dir: third_party/rollup_libs
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/rollup_libs/${platform}
- name: Sync native rollup libs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/devtools-frontend/src
python3 scripts/deps/sync_rollup_libs.py
- name: Fix rustc
if: ${{ inputs.target-platform != 'linux' }}
shell: bash

View File

@@ -64,15 +64,26 @@ runs:
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
export BUILD_TOOLS_SHA=4430e4a505e0f4fa2a41b707a10a36f780bbdd26
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -6,7 +6,7 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
id: yarn-cache
with:
@@ -18,4 +18,14 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

View File

@@ -0,0 +1,16 @@
{
"problemMatcher": [
{
"owner": "markdownlint",
"pattern": [
{
"regexp": "^(.+):(\\d+):(\\d+)\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"message": 4
}
]
}
]
}

View File

@@ -19,6 +19,16 @@
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

73
.github/workflows/apply-patches.yml vendored Normal file
View File

@@ -0,0 +1,73 @@
name: Apply Patches
on:
pull_request:
permissions: {}
concurrency:
group: apply-patches-${{ github.ref }}
cancel-in-progress: true
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
has-patches: ${{ steps.filter.outputs.patches }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
persist-credentials: false
ref: ${{ github.event.pull_request.head.sha }}
# Use dorny/paths-filter instead of the path filter under the on: pull_request: block
# so that the output can be used to conditionally run the apply-patches job, which lets
# the job be marked as a required status check (conditional skip counts as a success).
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
id: filter
with:
filters: |
patches:
- DEPS
- 'patches/**'
apply-patches:
needs: setup
if: ${{ needs.setup.outputs.has-patches == 'true' }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
persist-credentials: false
ref: ${{ github.event.pull_request.base.ref }}
- name: Merge PR HEAD
working-directory: src/electron
env:
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
git config user.email "electron@github.com"
git config user.name "Electron Bot"
git fetch origin refs/pull/${PR_NUMBER}/head
git merge --squash FETCH_HEAD
git commit -n -m "Squashed commits"
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux

View File

@@ -3,19 +3,23 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 20.19.x
node-version: 24.12.x
- name: Setting Up Dig Site
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
@@ -41,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f #v6.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -16,15 +16,25 @@ jobs:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020 # v4.4.0
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f # v6.1.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- name: Sparse checkout repository
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
@@ -73,6 +83,8 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -6,11 +6,15 @@ on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -19,7 +23,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -30,8 +34,10 @@ jobs:
build-git-cache-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -41,7 +47,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -52,10 +58,12 @@ jobs:
build-git-cache-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -64,7 +72,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
skip-macos:
type: boolean
@@ -43,10 +43,13 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -54,7 +57,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -63,13 +66,17 @@ jobs:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -80,6 +87,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
@@ -89,6 +98,8 @@ jobs:
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
@@ -98,6 +109,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -111,7 +124,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -126,6 +139,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -141,7 +156,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -155,6 +170,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -171,7 +188,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -185,6 +202,8 @@ jobs:
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
@@ -195,6 +214,8 @@ jobs:
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
@@ -207,6 +228,8 @@ jobs:
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
@@ -310,7 +333,7 @@ jobs:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -400,6 +423,8 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
steps:

View File

@@ -1,16 +1,20 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -31,6 +32,8 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -72,7 +75,7 @@ jobs:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@e2ff99831a4f13625d35064e2b3dfe65c07a0396 # v3.7.5
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,6 +11,7 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -28,6 +29,7 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -35,18 +37,29 @@ jobs:
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -77,7 +90,6 @@ jobs:
labelExists = true;
} catch {}
const { ElectronVersions } = await import('${{ github.workspace }}/node_modules/@electron/fiddle-core/dist/index.js');
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
@@ -134,7 +146,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@e2ff99831a4f13625d35064e2b3dfe65c07a0396 # v3.7.5
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -10,6 +10,7 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,9 +17,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -31,7 +35,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -40,6 +44,8 @@ jobs:
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-linux
with:
environment: production-release
@@ -55,6 +61,8 @@ jobs:
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-linux
with:
environment: production-release
@@ -70,6 +78,8 @@ jobs:
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-linux
with:
environment: production-release

104
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,104 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -32,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -44,6 +48,8 @@ jobs:
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
@@ -59,6 +65,8 @@ jobs:
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
@@ -74,6 +82,8 @@ jobs:
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release
@@ -89,6 +99,8 @@ jobs:
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-macos
with:
environment: production-release

View File

@@ -7,6 +7,8 @@ on:
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -64,14 +64,13 @@ concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -86,6 +85,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
@@ -19,11 +21,13 @@ jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -50,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -19,11 +21,13 @@ jobs:
lint:
name: Lint
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -61,9 +65,11 @@ jobs:
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add ESLint problem matcher
- name: Add problem matchers
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
run: |
echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
echo "::add-matcher::src/electron/.github/problem-matchers/markdownlint.json"
- name: Run Lint
shell: bash
run: |
@@ -74,11 +80,11 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json

View File

@@ -59,6 +59,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -81,6 +83,8 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
@@ -91,7 +95,7 @@ jobs:
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -115,9 +119,9 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 20.19.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
@@ -159,7 +163,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0

View File

@@ -35,10 +35,7 @@ concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -53,6 +50,10 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
@@ -68,11 +69,12 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
@@ -117,7 +119,7 @@ jobs:
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -166,12 +168,12 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
@@ -195,10 +197,7 @@ jobs:
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
- name: Run Electron Tests
shell: bash
env:
@@ -224,7 +223,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -241,9 +240,14 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
- name: Upload Test results to Datadog
@@ -255,13 +259,14 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -39,6 +41,8 @@ jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +97,8 @@ jobs:
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +138,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

View File

@@ -11,6 +11,7 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
@@ -28,6 +29,7 @@ jobs:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -0,0 +1,71 @@
name: Rerun PR Apply Patches
on:
push:
branches:
- main
- '[1-9][0-9]-x-y'
paths:
- 'DEPS'
- 'patches/**'
permissions: {}
jobs:
rerun-apply-patches:
runs-on: ubuntu-latest
permissions:
actions: write
checks: read
contents: read
pull-requests: read
steps:
- name: Find PRs and Rerun Apply Patches
env:
GH_REPO: ${{ github.repository }}
GH_TOKEN: ${{ github.token }}
run: |
BRANCH="${GITHUB_REF#refs/heads/}"
# Find all open PRs targeting this branch
PRS=$(gh pr list --base "$BRANCH" --state open --limit 250 --json number)
echo "$PRS" | jq -c '.[]' | while read -r pr; do
PR_NUMBER=$(echo "$pr" | jq -r '.number')
echo "Processing PR #${PR_NUMBER}"
# Find the Apply Patches workflow check for this PR
CHECK=$(gh pr view "$PR_NUMBER" --json statusCheckRollup --jq '[.statusCheckRollup[] | select(.workflowName == "Apply Patches" and .name == "apply-patches")] | first')
if [ -z "$CHECK" ] || [ "$CHECK" = "null" ]; then
echo " No Apply Patches workflow found for PR #${PR_NUMBER}"
continue
fi
CONCLUSION=$(echo "$CHECK" | jq -r '.conclusion')
if [ "$CONCLUSION" = "SKIPPED" ]; then
echo " apply-patches job was skipped for PR #${PR_NUMBER} (no patches)"
continue
fi
LINK=$(echo "$CHECK" | jq -r '.detailsUrl')
# Extract the run ID from the link (format: .../runs/RUN_ID/job/JOB_ID)
RUN_ID=$(echo "$LINK" | grep -oE 'runs/[0-9]+' | cut -d'/' -f2)
if [ -z "$RUN_ID" ]; then
echo " Could not extract run ID from link: ${LINK}"
continue
fi
# Check if the workflow is currently in progress
RUN_STATUS=$(gh run view "$RUN_ID" --json status --jq '.status')
if [ "$RUN_STATUS" = "in_progress" ] || [ "$RUN_STATUS" = "queued" ] || [ "$RUN_STATUS" = "waiting" ]; then
echo " Workflow run ${RUN_ID} is ${RUN_STATUS}, cancelling..."
gh run cancel "$RUN_ID" --force
gh run watch "$RUN_ID"
fi
gh run rerun "$RUN_ID"
done

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f # v6.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@3c3833e0f8c1c83d449a7478aa59c036a9165498 # v3.29.5
uses: github/codeql-action/upload-sarif@cdefb33c0f6224e58673d9004f47f7cb3e328b89 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:

View File

@@ -11,6 +11,7 @@ jobs:
check-stable-prep-items:
name: Check Stable Prep Items
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -10,13 +10,14 @@ permissions: {}
jobs:
stale:
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@997185467fa4f803885201cee163a9f38240193d # tag: v10.1.1
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,10 +28,11 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
permissions: {}
if: ${{ always() }}
needs: stale
steps:
@@ -39,7 +41,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@997185467fa4f803885201cee163a9f38240193d # tag: v10.1.1
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -0,0 +1,39 @@
name: Update Website Docs
on:
release:
types: [published]
permissions: {}
jobs:
update-website-docs:
name: Update Website Docs
runs-on: ubuntu-latest
environment: website-docs-updater
permissions:
contents: read
id-token: write # needed for secret-service-action
steps:
- name: Get GitHub App token
id: secret-service
uses: electron/secret-service-action@3476425e8b30555aac15b1b7096938e254b0e155 # v1.0.0
- name: Check if this release is the latest
id: check-if-latest-release
env:
GH_REPO: electron/electron
GH_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
LATEST_RELEASE_TAG="$(gh release view --json tagName --jq '.tagName')"
if [ "$LATEST_RELEASE_TAG" = "${GITHUB_REF#refs/tags/}" ]; then
echo "isLatestRelease=true" >> $GITHUB_OUTPUT
else
echo "isLatestRelease=false" >> $GITHUB_OUTPUT
fi
- name: Trigger website docs update
if: ${{ steps.check-if-latest-release.outputs.isLatestRelease }}
env:
GH_REPO: electron/website
GH_TOKEN: ${{ fromJSON(steps.secret-service.outputs.secrets).WEBSITE_DOCS_UPDATER_APP_TOKEN }}
run: |
gh workflow run update-docs.yml -f sha=$GITHUB_SHA

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -36,7 +40,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -48,6 +52,8 @@ jobs:
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-windows
with:
environment: production-release
@@ -62,6 +68,8 @@ jobs:
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-windows
with:
environment: production-release
@@ -76,6 +84,8 @@ jobs:
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
needs: checkout-windows
with:
environment: production-release

2
.gitignore vendored
View File

@@ -53,3 +53,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

942
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

12
.yarnrc.yml Normal file
View File

@@ -0,0 +1,12 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

View File

@@ -446,6 +446,7 @@ source_set("electron_lib") {
"shell/services/node/public/mojom",
"//base:base_static",
"//base/allocator:buildflags",
"//build/util:chromium_git_revision",
"//chrome:strings",
"//chrome/app:command_ids",
"//chrome/app/resources:platform_locale_settings",
@@ -480,6 +481,7 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
@@ -500,6 +502,7 @@ source_set("electron_lib") {
"//third_party/blink/public/platform/media",
"//third_party/boringssl",
"//third_party/electron_node:libnode",
"//third_party/highway:libhwy",
"//third_party/inspector_protocol:crdtp",
"//third_party/leveldatabase",
"//third_party/libyuv",
@@ -527,6 +530,7 @@ source_set("electron_lib") {
"//base",
"//base:i18n",
"//content/public/app",
"//ui/base/unowned_user_data",
]
include_dirs = [
@@ -592,6 +596,7 @@ source_set("electron_lib") {
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -760,11 +765,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]

226
CLAUDE.md Normal file
View File

@@ -0,0 +1,226 @@
# Electron Development Guide
## Project Overview
Electron is a framework for building cross-platform desktop applications using web technologies. It embeds Chromium for rendering and Node.js for backend functionality.
## Directory Structure
```text
electron/ # This repo (run `e` commands here)
├── shell/ # Core C++ application code
│ ├── browser/ # Main process implementation (107+ API modules)
│ ├── renderer/ # Renderer process code
│ ├── common/ # Shared code between processes
│ ├── app/ # Application entry points
│ └── services/ # Node.js service integration
├── lib/ # TypeScript/JavaScript library code
│ ├── browser/ # Main process JS (47 API implementations)
│ ├── renderer/ # Renderer process JS
│ └── common/ # Shared JS modules
├── patches/ # Patches for upstream dependencies
│ ├── chromium/ # ~159 patches to Chromium
│ ├── node/ # ~48 patches to Node.js
│ └── ... # Other targets (v8, boringssl, etc.)
├── spec/ # Test suite (1189+ TypeScript test files)
├── docs/ # API documentation and guides
├── build/ # Build configuration
├── script/ # Build and automation scripts
└── chromium_src/ # Chromium source overrides
../ # Parent directory is Chromium source
```
## Build Tools Setup
Electron uses `@electron/build-tools` for development. The `e` command is the primary CLI.
**Installation:**
```bash
npm i -g @electron/build-tools
```
**Configuration location:** `~/.electron_build_tools/configs/`
## Essential Commands
### Configuration Management
| Command | Purpose |
|---------|---------|
| `e init <name> --root=<path> --bootstrap testing` | Create new build config and sync |
| `e use <name>` | Switch to a different build configuration |
| `e show current` | Display active configuration name |
| `e show configs` | List all available configurations |
### Build & Development Loop
| Command | Purpose |
|---------|---------|
| `e sync` | Fetch/update all source code and apply patches |
| `e sync --3` | Sync with 3-way merge (required for Chromium upgrades) |
| `e build` | Build Electron (runs GN + Ninja) |
| `e build -k 999` | Build and continue on errors (up to 999) |
| `e build -t <target>` | Build specific target (e.g., `electron:node_headers`) |
| `e start` | Run the built Electron executable |
| `e start --version` | Verify Electron launches and print version |
| `e test` | Run the test suite |
| `e debug` | Run Electron in debugger (lldb on macOS, gdb on Linux) |
### Patch Management
| Command | Purpose |
|---------|---------|
| `e patches <target>` | Export patches for a target (chromium, node, v8, etc.) |
| `e patches all` | Export all patches from all targets |
| `e patches --list-targets` | List available patch targets |
## Typical Development Workflow
```bash
# 1. Ensure you're on the right config
e show current
# 2. Sync to get latest code
e sync
# 3. Make your changes in shell/ or lib/ or ../
# 4. Build
e build
# 5. Test your changes (Leave the user to do this, don't run these commands unless asked)
e start
e test
# 6. If you modified patched files in Chromium:
cd .. # Go to Chromium repo
git add <files>
git commit -m "description of change"
cd electron
e patches chromium # Export the patch
```
## Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) to add features or modify behavior.
**How patches work:**
```text
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
**Patch configuration:** `patches/config.json` maps patch directories to target repos.
**Key rules:**
- Fix existing patches 99% of the time rather than creating new ones
- Preserve original authorship in TODO comments
- Never change TODO assignees (`TODO(name)` must retain original name)
- Each patch file includes commit message explaining its purpose
**Creating/modifying patches:**
1. Make changes in the target repo (e.g., `../` for Chromium)
2. Create a git commit
3. Run `e patches <target>` to export
## Testing
**Test location:** `spec/` directory
**Running tests:**
```bash
e test # Run full test suite
```
**Test frameworks:** Mocha, Chai, Sinon
## Build Configuration
**GN build arguments:** Located in `build/args/`:
- `testing.gn` - Debug/testing builds
- `release.gn` - Release builds
- `all.gn` - Common arguments for all builds
**Main build file:** `BUILD.gn`
**Feature flags:** `buildflags/buildflags.gni`
## Chromium Upgrade Workflow
When working on the `roller/chromium/main` branch to upgrade Chromium activate the "Electron Chromium Upgrade" skill.
## Code Style
**C++:** Follows Chromium style, enforced by clang-format
**TypeScript/JavaScript:** ESLint configuration in `.eslintrc.json`
**Linting:**
```bash
npm run lint # Run all linters
npm run lint:clang-format # C++ formatting
```
## Key Files
| File | Purpose |
|------|---------|
| `BUILD.gn` | Main GN build configuration |
| `DEPS` | Dependency versions and checkout paths |
| `patches/config.json` | Patch target configuration |
| `filenames.gni` | Source file lists by platform |
| `package.json` | Node.js dependencies and scripts |
## Environment Variables
| Variable | Purpose |
|----------|---------|
| `GN_EXTRA_ARGS` | Additional GN arguments (useful in CI) |
| `ELECTRON_RUN_AS_NODE=1` | Run Electron as Node.js |
## Useful Git Commands for Chromium
```bash
# Find CL that changed a file
cd ..
git log --oneline -10 -- {file}
git blame -L {start},{end} -- {file}
# Look for Chromium CL reference in commit
git log -1 {commit_sha} # Find "Reviewed-on:" line
# Find which patch affects a file
grep -l "filename.cc" patches/chromium/*.patch
```
## CI/CD
GitHub Actions workflows in `.github/workflows/`:
- `build.yml` - Main build workflow
- `pipeline-electron-lint.yml` - Linting
- `pipeline-segment-electron-test.yml` - Testing
## Common Issues
**Patch conflict during sync:**
- Use `e sync --3` for 3-way merge
- Check if file was renamed/moved upstream
- Verify patch is still needed
**Build error in patched file:**
- Find the patch: `grep -l "filename" patches/chromium/*.patch`
- Match existing patch style (#if 0 guards, BUILDFLAG conditionals, etc.)
**Remote build issues:**
- Try `e build --no-remote` to build locally
- Check reclient/siso configuration in your build config

13
DEPS
View File

@@ -2,17 +2,17 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'142.0.7444.134',
'146.0.7650.0',
'node_version':
'v22.21.1',
'v24.13.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
'74ab5baccc6f7202c8ac69a8d1e152c29dc1ea76',
'mantle_version':
'78d3966b3c331292ea29ec38661b25df0a245948',
'2a8e2123a3931038179ee06105c9e6ec336b12ea',
'engflow_reclient_configs_version':
'955335c30a752e9ef7bff375baab5e0819b6c00d',
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.22.22',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -155,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 140
node_module_version = 145
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"

View File

@@ -383,6 +383,8 @@ static_library("chrome") {
"//chrome/browser/pdf/chrome_pdf_stream_delegate.h",
"//chrome/browser/pdf/pdf_extension_util.cc",
"//chrome/browser/pdf/pdf_extension_util.h",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.cc",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.h",
"//chrome/browser/pdf/pdf_viewer_stream_manager.cc",
"//chrome/browser/pdf/pdf_viewer_stream_manager.h",
"//chrome/browser/plugins/pdf_iframe_navigation_throttle.cc",
@@ -391,6 +393,8 @@ static_library("chrome") {
deps += [
"//components/pdf/browser",
"//components/pdf/renderer",
"//ui/base/interaction",
"//ui/webui/resources/cr_components/help_bubble:mojo_bindings",
]
}
} else {

View File

@@ -110,11 +110,9 @@ async function loadApplicationPackage (packagePath: string) {
} else if (packageJson.name) {
app.name = packageJson.name;
}
if (packageJson.desktopName) {
app.setDesktopName(packageJson.desktopName);
} else {
app.setDesktopName(`${app.name}.desktop`);
}
app.setDesktopName(packageJson.desktopName || `${app.name}.desktop`);
// Set v8 flags, deliberately lazy load so that apps that do not use this
// feature do not pay the price
if (packageJson.v8Flags) {

View File

@@ -612,7 +612,7 @@ Returns `string` - The current application directory.
may backup this directory to cloud storage.
* `sessionData` The directory for storing data generated by `Session`, such
as localStorage, cookies, disk cache, downloaded dictionaries, network
state, devtools files. By default this points to `userData`. Chromium may
state, DevTools files. By default this points to `userData`. Chromium may
write very large disk cache here, so if your app does not rely on browser
storage like localStorage or cookies to save user data, it is recommended
to set this directory to other locations to avoid polluting the `userData`
@@ -633,7 +633,7 @@ Returns `string` - The current application directory.
Returns `string` - A path to a special directory or file associated with `name`. On
failure, an `Error` is thrown.
If `app.getPath('logs')` is called without called `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
If `app.getPath('logs')` is called without calling `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
### `app.getFileIcon(path[, options])`
@@ -648,7 +648,7 @@ Returns `Promise<NativeImage>` - fulfilled with the app's icon, which is a [Nati
Fetches a path's associated icon.
On _Windows_, there a 2 kinds of icons:
On _Windows_, there are 2 kinds of icons:
* Icons associated with certain file extensions, like `.mp3`, `.png`, etc.
* Icons inside the file itself, like `.exe`, `.dll`, `.ico`.
@@ -764,7 +764,7 @@ app.getPreferredSystemLanguages() // ['fr-CA', 'en-US', 'zh-Hans-FI', 'es-419']
Both the available languages and regions and the possible return values differ between the two operating systems.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region,and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region, and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
### `app.addRecentDocument(path)` _macOS_ _Windows_
@@ -1216,10 +1216,17 @@ Disables hardware acceleration for current app.
This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently enabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.
### `app.disableDomainBlockingFor3DAPIs()`
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
domain basis if the GPU processes crashes too frequently. This function
domain basis if the GPU process crashes too frequently. This function
disables that behavior.
This method can only be called before app is ready.
@@ -1278,6 +1285,8 @@ For `infoType` equal to `basic`:
Using `basic` should be preferred if only basic information like `vendorId` or `deviceId` is needed.
Promise is rejected if the GPU is completely disabled, i.e. no hardware and software implementations are available.
### `app.setBadgeCount([count])` _Linux_ _macOS_
* `count` Integer (optional) - If a value is provided, set the badge to the provided value otherwise, on macOS, display a plain white dot (e.g. unknown number of notifications). On Linux, if a value is not provided the badge will not display.

View File

@@ -32,9 +32,19 @@ update process. Apps that need to disable ATS can add the
### Windows
On Windows, you have to install your app into a user's machine before you can
use the `autoUpdater`, so it is recommended that you use
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib] to generate a Windows installer.
On Windows, the `autoUpdater` module automatically selects the appropriate update mechanism
based on how your app is packaged:
* **MSIX packages**: If your app is running as an MSIX package (created with [electron-windows-msix][msix-lib] and detected via [`process.windowsStore`](process.md#processwindowsstore-readonly)),
the module uses the MSIX updater, which supports direct MSIX file links and JSON update feeds.
* **Squirrel.Windows**: For apps installed via traditional installers (created with
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib]),
the module uses Squirrel.Windows for updates.
You don't need to configure which updater to use; Electron automatically detects the packaging
format and uses the appropriate one.
#### Squirrel.Windows
Apps built with Squirrel.Windows will trigger [custom launch events](https://github.com/Squirrel/Squirrel.Windows/blob/51f5e2cb01add79280a53d51e8d0cfa20f8c9f9f/docs/using/custom-squirrel-events-non-cs.md#application-startup-commands)
that must be handled by your Electron application to ensure proper setup and teardown.
@@ -55,6 +65,14 @@ The installer generated with Squirrel.Windows will create a shortcut icon with a
same ID for your app with `app.setAppUserModelId` API, otherwise Windows will
not be able to pin your app properly in task bar.
#### MSIX Packages
When your app is packaged as an MSIX, the `autoUpdater` module provides additional
functionality:
* Use the `allowAnyVersion` option in `setFeedURL()` to allow updates to older versions (downgrades)
* Support for direct MSIX file links or JSON update feeds (similar to Squirrel.Mac format)
## Events
The `autoUpdater` object emits the following events:
@@ -92,7 +110,7 @@ Returns:
Emitted when an update has been downloaded.
On Windows only `releaseName` is available.
With Squirrel.Windows only `releaseName` is available.
> [!NOTE]
> It is not strictly necessary to handle this event. A successfully
@@ -100,6 +118,13 @@ On Windows only `releaseName` is available.
### Event: 'before-quit-for-update'
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/12619
```
-->
This event is emitted after a user calls `quitAndInstall()`.
When this API is called, the `before-quit` event is not emitted before all windows are closed. As a result you should listen to this event if you wish to perform actions before the windows are closed while a process is quitting, as well as listening to `before-quit`.
@@ -110,11 +135,23 @@ The `autoUpdater` object has the following methods:
### `autoUpdater.setFeedURL(options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/5879
description: "Added `headers` as a second parameter."
- pr-url: https://github.com/electron/electron/pull/11925
description: "Changed API to accept a single `options` argument (contains `url`, `headers`, and `serverType` properties)."
```
-->
* `options` Object
* `url` string
* `url` string - The update server URL. For _Windows_ MSIX, this can be either a direct link to an MSIX file (e.g., `https://example.com/update.msix`) or a JSON endpoint that returns update information (see the [Squirrel.Mac][squirrel-mac] README for more information).
* `headers` Record\<string, string\> (optional) _macOS_ - HTTP request headers.
* `serverType` string (optional) _macOS_ - Can be `json` or `default`, see the [Squirrel.Mac][squirrel-mac]
README for more information.
* `allowAnyVersion` boolean (optional) _Windows_ - If `true`, allows downgrades to older versions for MSIX packages.
Defaults to `false`.
Sets the `url` and initialize the auto updater.
@@ -151,3 +188,4 @@ closed.
[electron-forge-lib]: https://www.electronforge.io/config/makers/squirrel.windows
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[event-emitter]: https://nodejs.org/api/events.html#events_class_eventemitter
[msix-lib]: https://github.com/electron-userland/electron-windows-msix

View File

@@ -756,6 +756,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -969,6 +972,9 @@ Moves window to `x` and `y`.
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1043,7 +1049,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1262,15 +1268,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1290,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -862,6 +862,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -1087,6 +1090,9 @@ Not supported on Wayland (Linux).
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1159,7 +1165,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1252,7 +1258,8 @@ Captures a snapshot of the page within `rect`. Omitting `rect` will capture the
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see [`did-fail-load`](web-contents.md#event-did-fail-load)).
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Same as [`webContents.loadURL(url[, options])`](web-contents.md#contentsloadurlurl-options).
@@ -1467,15 +1474,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1488,11 +1496,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -25,6 +25,11 @@ following properties:
with which the request is associated. Defaults to the empty string. The
`session` option supersedes `partition`. Thus if a `session` is explicitly
specified, `partition` is ignored.
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
custom protocol handlers registered for the request's URL scheme will not be
called. This allows forwarding an intercepted request to the built-in
handler. [webRequest](web-request.md) handlers will still be triggered
when bypassing custom protocols. Defaults to `false`.
* `credentials` string (optional) - Can be `include`, `omit` or
`same-origin`. Whether to send
[credentials](https://fetch.spec.whatwg.org/#credentials) with this
@@ -259,7 +264,7 @@ will not be allowed. The `finish` event is emitted just after the end operation.
Cancels an ongoing HTTP transaction. If the request has already emitted the
`close` event, the abort operation will have no effect. Otherwise an ongoing
event will emit `abort` and `close` events. Additionally, if there is an ongoing
response object,it will emit the `aborted` event.
response object, it will emit the `aborted` event.
#### `request.followRedirect()`

View File

@@ -2,10 +2,13 @@
> Perform copy and paste operations on the system clipboard.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) _Deprecated_ (non-sandboxed only)
> [!NOTE]
> Using the `clipboard` API from the renderer process is deprecated.
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> If you want to call this API from a renderer process,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.

View File

@@ -49,6 +49,10 @@ Disables the disk cache for HTTP requests.
Disable HTTP/2 and SPDY/3.1 protocols.
### --disable-geolocation _macOS_
Disables the Geolocation API. Permission requests for geolocation will be denied internally regardless of the decision made by a handler set via `session.setPermissionRequestHandler`. This functionality is currently implemented only for macOS. Has no effect on other platforms.
### --disable-renderer-backgrounding
Prevents Chromium from lowering the priority of invisible pages' renderer
@@ -168,7 +172,7 @@ Enables net log events to be saved and writes them to `path`.
Sets the verbosity of logging when used together with `--enable-logging`.
`N` should be one of [Chrome's LogSeverities][severities].
Note that two complimentary logging mechanisms in Chromium -- `LOG()`
Note that two complementary logging mechanisms in Chromium -- `LOG()`
and `VLOG()` -- are controlled by different switches. `--log-level`
controls `LOG()` messages, while `--v` and `--vmodule` control `VLOG()`
messages. So you may want to use a combination of these three switches
@@ -193,6 +197,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated
@@ -308,7 +317,7 @@ By default inspector websocket url is available in stderr and under /json/list e
### `--experimental-network-inspection`
Enable support for devtools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
Enable support for DevTools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
### `--no-deprecation`

View File

@@ -51,7 +51,12 @@ Returns:
* `event` Event
* `cookie` [Cookie](structures/cookie.md) - The cookie that was changed.
* `cause` string - The cause of the change with one of the following values:
* `explicit` - The cookie was changed directly by a consumer's action.
* `inserted` - The cookie was inserted.
* `inserted-no-change-overwrite` - The newly inserted cookie overwrote a cookie but
did not result in any change. For example, inserting an identical cookie will produce this cause.
* `inserted-no-value-change-overwrite` - The newly inserted cookie overwrote a cookie but
did not result in any value change, but it's web observable (e.g. updates the expiry).
* `explicit` - The cookie was deleted directly by a consumer's action.
* `overwrite` - The cookie was automatically removed due to an insert
operation that overwrote it.
* `expired` - The cookie was automatically removed as it expired.

View File

@@ -49,7 +49,7 @@ Use the `system-ui` keyword to match the smoothness to the OS design language.
| Value: | `60%` | `0%` |
| Example: | ![A rectangle with round corners whose smoothness matches macOS](../images/corner-smoothing-example-60.svg) | ![A rectangle with round corners whose smoothness matches Windows and Linux](../images/corner-smoothing-example-0.svg) |
### Controlling availibility
### Controlling availability
This CSS rule can be disabled using the Blink feature flag `ElectronCSSCornerSmoothing`.

View File

@@ -44,7 +44,7 @@ Returns:
* `reason` string - Reason for detaching debugger.
Emitted when the debugging session is terminated. This happens either when
`webContents` is closed or devtools is invoked for the attached `webContents`.
`webContents` is closed or DevTools is invoked for the attached `webContents`.
#### Event: 'message'

View File

@@ -94,18 +94,45 @@ The `desktopCapturer` module has the following methods:
Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`DesktopCapturerSource`](structures/desktop-capturer-source.md) objects, each `DesktopCapturerSource` represents a screen or an individual window that can be captured.
> [!NOTE]
> Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher,
> which can detected by [`systemPreferences.getMediaAccessStatus`][].
> * Capturing audio requires `NSAudioCaptureUsageDescription` Info.plist key on macOS 14.2 Sonoma and higher - [read more](#macos-versions-142-or-higher).
> * Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher, which can detected by [`systemPreferences.getMediaAccessStatus`][].
[`navigator.mediaDevices.getUserMedia`]: https://developer.mozilla.org/en/docs/Web/API/MediaDevices/getUserMedia
[`systemPreferences.getMediaAccessStatus`]: system-preferences.md#systempreferencesgetmediaaccessstatusmediatype-windows-macos
## Caveats
### Linux
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
---
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.
### MacOS versions 14.2 or higher
`NSAudioCaptureUsageDescription` Info.plist key must be added in-order for audio to be captured by `desktopCapturer`. If instead you are running electron from another program like a terminal or IDE then that parent program must contain the Info.plist key.
This is in order to facillitate use of Apple's new [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps#Configure-the-sample-code-project) by Chromium.
> [!WARNING]
> Failure of `desktopCapturer` to start an audio stream due to `NSAudioCaptureUsageDescription` permission not present will still create a dead audio stream however no warnings or errors are displayed.
As of electron `v39.0.0-beta.4` Chromium [made Apple's new `CoreAudio Tap API` the default](https://source.chromium.org/chromium/chromium/src/+/ad17e8f8b93d5f34891b06085d373a668918255e) for desktop audio capture. There is no fallback to the older `Screen & System Audio Recording` permissions system even if [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps) stream creation fails.
If you need to continue using `Screen & System Audio Recording` permissions for `desktopCapturer` on macOS versions 14.2 and later, you can apply a chromium feature flag to force use of that older permissions system:
```js
// main.js (right beneath your require/import statments)
app.commandLine.appendSwitch('disable-features', 'MacCatapLoopbackAudioForScreenShare')
```
---
### MacOS versions 12.7.6 or lower
`navigator.mediaDevices.getUserMedia` does not work on macOS versions 12.7.6 and prior for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this. Only in macOS 13 and onwards does Apple provide APIs to capture desktop audio without the need for a signed kernel extension.
It is possible to circumvent this limitation by capturing system audio with another macOS app like [BlackHole](https://existential.audio/blackhole/) or [Soundflower](https://rogueamoeba.com/freebies/soundflower/) and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -344,7 +344,7 @@ Displays a modal dialog that shows an error message.
This API can be called safely before the `ready` event the `app` module emits,
it is usually used to report errors in early stage of startup. If called
before the app `ready`event on Linux, the message will be emitted to stderr,
before the app `ready` event on Linux, the message will be emitted to stderr,
and no GUI dialog will appear.
### `dialog.showCertificateTrustDialog([window, ]options)` _macOS_ _Windows_

View File

@@ -159,6 +159,22 @@ Notification activated (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76
Notification replied to (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76-F88EC9D73D44)
```
### `ELECTRON_DEBUG_MSIX_UPDATER`
Adds extra logs to MSIX updater operations on Windows to aid in debugging. Extra logging will be displayed when MSIX update operations are initiated, including package updates, package registration, and restart registration. This helps diagnose issues with MSIX package updates and deployments.
Sample output:
```sh
UpdateMsix called with URI: https://example.com/app.msix
DoUpdateMsix: Starting
Calling AddPackageByUriAsync... URI: https://example.com/app.msix
Update options - deferRegistration: true, developerMode: false, forceShutdown: false, forceTargetShutdown: false, forceUpdateFromAnyVersion: false
Waiting for deployment...
Deployment finished.
MSIX Deployment completed.
```
### `ELECTRON_LOG_ASAR_READS`
When Electron reads from an ASAR file, log the read offset and file path to
@@ -186,3 +202,14 @@ the one downloaded by `npm install`. Usage:
```sh
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
### `ELECTRON_SKIP_BINARY_DOWNLOAD`
If you want to install your project's dependencies but don't need to use Electron functionality,
you can set the `ELECTRON_SKIP_BINARY_DOWNLOAD` environment variable to prevent the binary from being
downloaded. For instance, this feature can be useful in continuous integration environments when
running unit tests that mock out the `electron` module.
```sh
ELECTRON_SKIP_BINARY_DOWNLOAD=1 npm install
```

View File

@@ -57,7 +57,7 @@ The following methods are available on instances of `Extensions`:
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -83,7 +83,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.extensions.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -34,7 +34,7 @@ Returns:
* `error` Error - Typically holds an error string identifying failure root cause.
Emitted when an error was encountered while streaming response data events. For
instance, if the server closes the underlying while the response is still
instance, if the server closes the underlying connection while the response is still
streaming, an `error` event will be emitted on the response object and a `close`
event will subsequently follow on the request object.

View File

@@ -17,7 +17,7 @@ See [`Menu`](menu.md) for examples.
* `options` Object
* `click` Function (optional) - Will be called with
`click(menuItem, window, event)` when the menu item is clicked.
* `menuItem` MenuItem
* `menuItem` [MenuItem](menu-item.md)
* `window` [BaseWindow](base-window.md) | undefined - This will not be defined if no window is open.
* `event` [KeyboardEvent](structures/keyboard-event.md)
* `role` string (optional) - Can be `undo`, `redo`, `cut`, `copy`, `paste`, `pasteAndMatchStyle`, `delete`, `selectAll`, `reload`, `forceReload`, `toggleDevTools`, `resetZoom`, `zoomIn`, `zoomOut`, `toggleSpellChecker`, `togglefullscreen`, `window`, `minimize`, `close`, `help`, `about`, `services`, `hide`, `hideOthers`, `unhide`, `quit`, `showSubstitutions`, `toggleSmartQuotes`, `toggleSmartDashes`, `toggleTextReplacement`, `startSpeaking`, `stopSpeaking`, `zoom`, `front`, `appMenu`, `fileMenu`, `editMenu`, `viewMenu`, `shareMenu`, `recentDocuments`, `toggleTabBar`, `selectNextTab`, `selectPreviousTab`, `showAllTabs`, `mergeAllWindows`, `clearRecentDocuments`, `moveTabToNewWindow` or `windowMenu` - Define the action of the menu item, when specified the
@@ -34,7 +34,8 @@ See [`Menu`](menu.md) for examples.
* `sublabel` string (optional) _macOS_ - Available in macOS >= 14.4
* `toolTip` string (optional) _macOS_ - Hover text for this menu item.
* `accelerator` string (optional) - An [Accelerator](../tutorial/keyboard-shortcuts.md#accelerators) string.
* `icon` ([NativeImage](native-image.md) | string) (optional)
* `icon` ([NativeImage](native-image.md) | string) (optional) - Can be a
[NativeImage](native-image.md) or the file path of an icon.
* `enabled` boolean (optional) - If false, the menu item will be greyed out and
unclickable.
* `acceleratorWorksWhenHidden` boolean (optional) _macOS_ - default is `true`, and when `false` will prevent the accelerator from triggering the item if the item is not visible.
@@ -90,7 +91,7 @@ It can be called with `menuItem.click(event, focusedWindow, focusedWebContents)`
#### `menuItem.submenu`
A `Menu` (optional) containing the menu
A [`Menu`](menu.md) (optional) containing the menu
item's submenu, if present.
#### `menuItem.type`
@@ -106,7 +107,7 @@ A `string` (optional) indicating the item's role, if set. Can be `undo`, `redo`,
#### `menuItem.accelerator`
An `Accelerator` (optional) indicating the item's accelerator, if set.
An `Accelerator | null` indicating the item's accelerator, if set.
#### `menuItem.userAccelerator` _Readonly_ _macOS_
@@ -170,4 +171,4 @@ A `number` indicating an item's sequential unique id.
#### `menuItem.menu`
A `Menu` that the item is a part of.
A [`Menu`](menu.md) that the item is a part of.

View File

@@ -2,10 +2,15 @@
## Class: Menu
> Create native application menus and context menus.
> Create application menus and context menus.
Process: [Main](../glossary.md#main-process)
The presentation of menus varies depending on the operating system:
- Under Windows and Linux, menus are visually similar to Chromium.
- Under macOS, these will be native menus.
> [!TIP]
> See also: [A detailed guide about how to implement menus in your application](../tutorial/menus.md).
@@ -23,7 +28,7 @@ The `Menu` class has the following static methods:
#### `Menu.setApplicationMenu(menu)`
- `menu` Menu | null
- `menu` [Menu](menu.md) | null
Sets `menu` as the application menu on macOS. On Windows and Linux, the
`menu` will be set as each window's top menu.
@@ -34,7 +39,7 @@ indicate which letter should get a generated accelerator. For example, using
opens the associated menu. The indicated character in the button label then gets an
underline, and the `&` character is not displayed on the button label.
In order to escape the `&` character in an item name, add a proceeding `&`. For example, `&&File` would result in `&File` displayed on the button label.
In order to escape the `&` character in an item name, add a preceding `&`. For example, `&&File` would result in `&File` displayed on the button label.
Passing `null` will suppress the default menu. On Windows and Linux,
this has the additional effect of removing the menu bar from the window.
@@ -65,9 +70,9 @@ for more information on macOS' native actions.
#### `Menu.buildFromTemplate(template)`
- `template` (MenuItemConstructorOptions | MenuItem)[]
- `template` (MenuItemConstructorOptions | [MenuItem](menu-item.md))[]
Returns `Menu`
Returns [`Menu`](menu.md)
Generally, the `template` is an array of `options` for constructing a
[MenuItem](menu-item.md). The usage can be referenced above.

View File

@@ -202,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
Returns `NativeImage`
Creates a new `NativeImage` instance from the `NSImage` that maps to the
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
documentation for a list of possible values.
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
The `hslShift` is applied to the image with the following rules:
@@ -231,6 +230,15 @@ echo -e '#import <Cocoa/Cocoa.h>\nint main() { NSLog(@"%@", SYSTEM_IMAGE_NAME);
where `SYSTEM_IMAGE_NAME` should be replaced with any value from [this list](https://developer.apple.com/documentation/appkit/nsimagename?language=objc).
For SF Symbols, usage looks as follows:
```js
const image = nativeImage.createFromNamedImage('square.and.pencil')
```
where `'square.and.pencil'` is the symbol name from the
[SF Symbols app](https://developer.apple.com/sf-symbols/).
## Class: NativeImage
> Natively wrap images such as tray, dock, and application icons.

View File

@@ -36,7 +36,7 @@ everything will be reset to the OS default. By default `themeSource` is `system
Settings this property to `dark` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `true` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the dark UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the dark UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the dark UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `dark` mode.
* The `updated` event will be emitted
@@ -44,7 +44,7 @@ Settings this property to `dark` will have the following effects:
Settings this property to `light` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `false` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the light UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the light UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the light UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `light` mode.
* The `updated` event will be emitted
@@ -83,4 +83,4 @@ Currently, Windows high contrast is the only system setting that triggers forced
### `nativeTheme.prefersReducedTransparency` _Readonly_
A `boolean` that indicates the whether the user has chosen via system accessibility settings to reduce transparency at the OS level.
A `boolean` that indicates whether the user has chosen via system accessibility settings to reduce transparency at the OS level.

View File

@@ -71,7 +71,7 @@ will disable the support for `asar` archives in Node's built-in modules.
### `process.noDeprecation`
A `boolean` that controls whether or not deprecation warnings are printed to `stderr`.
A `boolean` (optional) that controls whether or not deprecation warnings are printed to `stderr`.
Setting this to `true` will silence deprecation warnings. This property is used
instead of the `--no-deprecation` command line flag.
@@ -99,13 +99,13 @@ property is used instead of the `--throw-deprecation` command line flag.
A `boolean` that controls whether or not deprecations printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for deprecations.
This property is instead of the `--trace-deprecation` command line flag.
This property is used instead of the `--trace-deprecation` command line flag.
### `process.traceProcessWarnings`
A `boolean` that controls whether or not process warnings printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for process warnings
(including deprecations). This property is instead of the `--trace-warnings` command
(including deprecations). This property is used instead of the `--trace-warnings` command
line flag.
### `process.type` _Readonly_
@@ -128,8 +128,8 @@ A `string` representing Electron's version string.
### `process.windowsStore` _Readonly_
A `boolean`. If the app is running as a Windows Store app (appx), this property is `true`,
for otherwise it is `undefined`.
A `boolean`. If the app is running as an MSIX package (including AppX for Windows Store),
this property is `true`, otherwise it is `undefined`.
### `process.contextId` _Readonly_

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session
@@ -1216,7 +1216,7 @@ function createWindow () {
mainWindow.webContents.session.setBluetoothPairingHandler((details, callback) => {
bluetoothPinCallback = callback
// Send a IPC message to the renderer to prompt the user to confirm the pairing.
// Send an IPC message to the renderer to prompt the user to confirm the pairing.
// Note that this will require logic in the renderer to handle this message and
// display a prompt to the user.
mainWindow.webContents.send('bluetooth-pairing-request', details)
@@ -1264,7 +1264,7 @@ session.defaultSession.allowNTLMCredentialsForDomains('*')
Overrides the `userAgent` and `acceptLanguages` for this session.
The `acceptLanguages` must a comma separated ordered list of language codes, for
The `acceptLanguages` must be a comma separated ordered list of language codes, for
example `"en-US,fr,de,ko,zh-CN,ja"`.
This doesn't affect existing `WebContents`, and each `WebContents` can use
@@ -1512,7 +1512,7 @@ will not work on non-persistent (in-memory) sessions.
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -1538,7 +1538,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -9,6 +9,13 @@ For including the share menu as a submenu of other menus, please use the
## Class: ShareMenu
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25629
```
-->
> Create share menu on macOS.
Process: [Main](../glossary.md#main-process)

View File

@@ -0,0 +1,58 @@
# sharedTexture
> Import shared textures into Electron and converts platform specific handles into [`VideoFrame`](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame). Supports all Web rendering systems, and can be transferred across Electron processes. Read [here](https://github.com/electron/electron/blob/main/shell/common/api/shared_texture/README.md) for more information.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
## Methods
The `sharedTexture` module has the following methods:
**Note:** Experimental APIs are marked as such and could be removed in the future.
### `sharedTexture.importSharedTexture(options)` _Experimental_
* `options` Object - Options for importing shared textures.
* `textureInfo` [SharedTextureImportTextureInfo](structures/shared-texture-import-texture-info.md) - The information of the shared texture to import.
* `allReferencesReleased` Function (optional) - Called when all references in all processes are released. You should keep the imported texture valid until this callback is called.
Imports the shared texture from the given options.
> [!NOTE]
> This method is only available in the main process.
Returns `SharedTextureImported` - The imported shared texture.
### `sharedTexture.sendSharedTexture(options, ...args)` _Experimental_
* `options` Object - Options for sending shared texture.
* `frame` [WebFrameMain](web-frame-main.md) - The target frame to transfer the shared texture to. For `WebContents`, you can pass `webContents.mainFrame`. If you provide a `webFrameMain` that is not a main frame, you'll need to enable `webPreferences.nodeIntegrationInSubFrames` for this, since this feature requires [IPC](https://www.electronjs.org/docs/latest/api/web-frame-main#frameipc-readonly) between main and the frame.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments to pass to the renderer process.
Send the imported shared texture to a renderer process. You must register a receiver at renderer process before calling this method. This method has a 1000ms timeout. Ensure the receiver is set and the renderer process is alive before calling this method.
> [!NOTE]
> This method is only available in the main process.
Returns `Promise<void>` - Resolves when the transfer is complete.
### `sharedTexture.setSharedTextureReceiver(callback)` _Experimental_
* `callback` Function\<Promise\<void\>\> - The function to receive the imported shared texture.
* `receivedSharedTextureData` Object - The data received from the main process.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments passed from the main process.
Set a callback to receive imported shared textures from the main process.
> [!NOTE]
> This method is only available in the renderer process.
## Properties
The `sharedTexture` module has the following properties:
### `sharedTexture.subtle` _Experimental_
A [`SharedTextureSubtle`](structures/shared-texture-subtle.md) property, provides subtle APIs for interacting with shared texture for advanced users.

View File

@@ -29,6 +29,14 @@ Show the given file in a file manager. If possible, select the file.
### `shell.openPath(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/20682
breaking-changes-header: api-changed-shellopenitem-is-now-shellopenpath
```
-->
* `path` string
Returns `Promise<string>` - Resolves with a string containing the error message corresponding to the failure if a failure occurred, otherwise "".
@@ -37,6 +45,18 @@ Open the given file in the desktop's default manner.
### `shell.openExternal(url[, options])`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/4508
description: "Added `activate` option."
- pr-url: https://github.com/electron/electron/pull/15065
description: "Added `workingDirectory` option."
- pr-url: https://github.com/electron/electron/pull/37139
description: "Added `logUsage` option."
```
-->
* `url` string - Max 2081 characters on Windows.
* `options` Object (optional)
* `activate` boolean (optional) _macOS_ - `true` to bring the opened application to the foreground. The default is `true`.
@@ -50,6 +70,14 @@ Open the given external protocol URL in the desktop's default manner. (For examp
### `shell.trashItem(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25114
breaking-changes-header: deprecated-shellmoveitemtotrash
```
-->
* `path` string - path to the item to be moved to the trash.
Returns `Promise<void>` - Resolves when the operation has been completed.
@@ -58,6 +86,10 @@ Rejects if there was an error while deleting the requested item.
This moves a path to the OS-specific trash location (Trash on macOS, Recycle
Bin on Windows, and a desktop-environment-specific location on Linux).
The path must use the default path separator for the platform (backslash on
Windows). Use `path.resolve()` from the `node:path` module to ensure correct
handling on all filesystems.
### `shell.beep()`
Play the beep sound.

View File

@@ -72,6 +72,9 @@
some GTK+3 desktop environments. Default is `false`.
* `transparent` boolean (optional) - Makes the window [transparent](../../tutorial/custom-window-styles.md#transparent-windows).
Default is `false`. On Windows, does not work unless the window is frameless.
When you add a [`View`](../view.md) to a `BaseWindow`, you'll need to call
[`view.setBackgroundColor`](../view.md#viewsetbackgroundcolorcolor) with a transparent
background color on that view to make its background transparent as well.
* `type` string (optional) - The type of window, default is normal window. See more about
this below.
* `visualEffectState` string (optional) _macOS_ - Specify how the material
@@ -99,9 +102,9 @@
* `trafficLightPosition` [Point](point.md) (optional) _macOS_ -
Set a custom position for the traffic light buttons in frameless windows.
* `roundedCorners` boolean (optional) _macOS_ _Windows_ - Whether frameless window
should have rounded corners. Default is `true`. Setting this property
to `false` will prevent the window from being fullscreenable on macOS.
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
should have rounded corners. Default is `true`. On Windows versions older than
Windows 11 Build 22000 this property has no effect, and frameless windows will
not have rounded corners.
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
frameless windows on Windows, which adds the standard window frame. Setting it
to `false` will remove window shadow and window animations, and disable window

View File

@@ -7,7 +7,7 @@
* `depthPerComponent` number - The number of bits per color component.
* `detected` boolean - `true` if the display is detected by the system.
* `displayFrequency` number - The display refresh rate.
* `id` number - Unique identifier associated with the display. A value of of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `id` number - Unique identifier associated with the display. A value of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `internal` boolean - `true` for an internal display and `false` for an external display.
* `label` string - User-friendly label, determined by the platform.
* `maximumCursorSize` [Size](size.md) - Maximum cursor size in native pixels.

View File

@@ -15,6 +15,6 @@ In order for extra notification buttons to work on macOS your app must meet the
following criteria.
* App is signed
* App has it's `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
* App has its `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
If either of these requirements are not met the button won't appear.

View File

@@ -0,0 +1,12 @@
# SharedTextureImportTextureInfo Object
* `pixelFormat` string - The pixel format of the texture.
* `bgra` - 32bpp BGRA (byte-order), 1 plane.
* `rgba` - 32bpp RGBA (byte-order), 1 plane.
* `rgbaf16` - Half float RGBA, 1 plane.
* `nv12` - 12bpp with Y plane followed by a 2x2 interleaved UV plane.
* `colorSpace` [ColorSpace](color-space.md) (optional) - The color space of the texture.
* `codedSize` [Size](size.md) - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) (optional) - A subsection of [0, 0, codedSize.width, codedSize.height]. In common cases, it is the full section area.
* `timestamp` number (optional) - A timestamp in microseconds that will be reflected to `VideoFrame`.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle.

View File

@@ -0,0 +1,9 @@
# SharedTextureImportedSubtle Object
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release the resources. If you transferred and get multiple `SharedTextureImported` objects, you have to `release` every one of them. The resource on the GPU process will be destroyed when the last one is released.
* `callback` Function (optional) - Callback when the GPU command buffer finishes using this shared texture. It provides a precise event to safely release dependent resources. For example, if this object is created by `finishTransferSharedTexture`, you can use this callback to safely release the original one that called `startTransferSharedTexture` in other processes. You can also release the source shared texture that was used to `importSharedTexture` safely.
* `startTransferSharedTexture` Function\<[SharedTextureTransfer](shared-texture-transfer.md)\> - Create a `SharedTextureTransfer` that can be serialized and transferred to other processes.
* `getFrameCreationSyncToken` Function\<[SharedTextureSyncToken](shared-texture-sync-token.md)\> - This method is for advanced users. If used, it is typically called after `finishTransferSharedTexture`, and should be passed to the object which was called `startTransferSharedTexture` to prevent the source object release the underlying resource before the target object actually acquire the reference at gpu process asyncly.
* `setReleaseSyncToken` Function - This method is for advanced users. If used, this object's underlying resource will not be released until the set sync token is fulfilled at gpu process. By using sync tokens, users are not required to use release callbacks for lifetime management.
* `syncToken` [SharedTextureSyncToken](shared-texture-sync-token.md) - The sync token to set.

View File

@@ -0,0 +1,6 @@
# SharedTextureImported Object
* `textureId` string - The unique identifier of the imported shared texture.
* `getVideoFrame` Function\<[VideoFrame](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame)\> - Create a `VideoFrame` that uses the imported shared texture in the current process. You can call `VideoFrame.close()` once you've finished using the object. The underlying resources will wait for GPU finish internally.
* `release` Function - Release this object's reference of the imported shared texture. The underlying resource will be alive until every reference is released.
* `subtle` [SharedTextureImportedSubtle](shared-texture-imported-subtle.md) - Provides subtle APIs to interact with the imported shared texture for advanced users.

View File

@@ -0,0 +1,6 @@
# SharedTextureSubtle Object
* `importSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Imports the shared texture from the given options. Returns the imported shared texture.
* `textureInfo` [SharedTextureImportTextureInfo](shared-texture-import-texture-info.md) - The information of shared texture to import.
* `finishTransferSharedTexture` Function\<[SharedTextureImportedSubtle](shared-texture-imported-subtle.md)\> - Finishes the transfer of the shared texture and gets the transferred shared texture. Returns the imported shared texture from the transfer object.
* `transfer` [SharedTextureTransfer](shared-texture-transfer.md) - The transfer object of the shared texture.

View File

@@ -0,0 +1,3 @@
# SharedTextureSyncToken Object
* `syncToken` string - The opaque data for sync token.

View File

@@ -0,0 +1,10 @@
# SharedTextureTransfer Object
* `transfer` string _Readonly_ - The opaque transfer data of the shared texture. This can be transferred across Electron processes.
* `syncToken` string _Readonly_ - The opaque sync token data for frame creation.
* `pixelFormat` string _Readonly_ - The pixel format of the transferring texture.
* `codedSize` [Size](size.md) _Readonly_ - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) _Readonly_ - A subsection of [0, 0, codedSize.width(), codedSize.height()]. In common cases, it is the full section area.
* `timestamp` number _Readonly_ - A timestamp in microseconds that will be reflected to `VideoFrame`.
Use `sharedTexture.subtle.finishTransferSharedTexture` to get [`SharedTextureImportedSubtle`](shared-texture-imported-subtle.md) back.

View File

@@ -40,7 +40,7 @@
* `javascript` boolean (optional) - Enables JavaScript support. Default is `true`.
* `webSecurity` boolean (optional) - When `false`, it will disable the
same-origin policy (usually using testing websites by people), and set
`allowRunningInsecureContent` to `true` if this options has not been set
`allowRunningInsecureContent` to `true` if this option has not been set
by user. Default is `true`.
* `allowRunningInsecureContent` boolean (optional) - Allow an https page to run
JavaScript, CSS or plugins from http URLs. Default is `false`.
@@ -156,6 +156,8 @@
`WebContents` when the preferred size changes. Default is `false`.
* `transparent` boolean (optional) - Whether to enable background transparency for the guest page. Default is `true`. **Note:** The guest page's text and background colors are derived from the [color scheme](https://developer.mozilla.org/en-US/docs/Web/CSS/color-scheme) of its root element. When transparency is enabled, the text color will still change accordingly but the background will remain transparent.
* `enableDeprecatedPaste` boolean (optional) _Deprecated_ - Whether to enable the `paste` [execCommand](https://developer.mozilla.org/en-US/docs/Web/API/Document/execCommand). Default is `false`.
* `focusOnNavigation` boolean (optional) - Whether to focus the WebContents
when navigating. Default is `true`.
[chrome-content-scripts]: https://developer.chrome.com/extensions/content_scripts#execution-environment
[runtime-enabled-features]: https://source.chromium.org/chromium/chromium/src/+/main:third_party/blink/renderer/platform/runtime_enabled_features.json5

View File

@@ -62,7 +62,7 @@ console.log(webContents)
### `webContents.getAllWebContents()`
Returns `WebContents[]` - An array of all `WebContents` instances. This will contain web contents
for all windows, webviews, opened devtools, and devtools extension background pages.
for all windows, webviews, opened DevTools, and DevTools extension background pages.
### `webContents.getFocusedWebContents()`
@@ -383,7 +383,7 @@ Emitted after a server side redirect occurs during navigation. For example a 30
redirect.
This event cannot be prevented, if you want to prevent redirects you should
checkout out the `will-redirect` event above.
check out the `will-redirect` event above.
#### Event: 'did-navigate'
@@ -958,7 +958,7 @@ win.loadURL('https://github.com')
#### Event: 'devtools-reload-page'
Emitted when the devtools window instructs the webContents to reload
Emitted when the DevTools window instructs the webContents to reload
#### Event: 'will-attach-webview'
@@ -1079,7 +1079,7 @@ Emitted when the [mainFrame](web-contents.md#contentsmainframe-readonly), an `<i
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors.
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Loads the `url` in the window. The `url` must contain the protocol prefix,
e.g. the `http://` or `file://`. If the load should bypass http cache then
@@ -1465,7 +1465,7 @@ Ignore application menu shortcuts while this web contents is focused.
without a recognized 'action' value will result in a console error and have
the same effect as returning `{action: 'deny'}`.
Called before creating a window a new window is requested by the renderer, e.g.
Called before creating a window when a new window is requested by the renderer, e.g.
by `window.open()`, a link with `target="_blank"`, shift+clicking on a link, or
submitting a form with `<form target="_blank">`. See
[`window.open()`](window-open.md) for more details and how to use this in
@@ -1865,66 +1865,20 @@ Removes the specified path from DevTools workspace.
* `devToolsWebContents` WebContents
Uses the `devToolsWebContents` as the target `WebContents` to show devtools.
Uses the `devToolsWebContents` as the target `WebContents` to show DevTools.
The `devToolsWebContents` must not have done any navigation, and it should not
be used for other purposes after the call.
By default Electron manages the devtools by creating an internal `WebContents`
By default, Electron manages the DevTools by creating an internal `WebContents`
with native view, which developers have very limited control of. With the
`setDevToolsWebContents` method, developers can use any `WebContents` to show
the devtools in it, including `BrowserWindow`, `BrowserView` and `<webview>`
tag.
the DevTools in it, such as [`BrowserWindow`](./browser-window.md) or [`WebContentsView`](./web-contents-view.md).
Note that closing the devtools does not destroy the `devToolsWebContents`, it
is caller's responsibility to destroy `devToolsWebContents`.
Note that closing the DevTools does not destroy the `devToolsWebContents`, it
is the caller's responsibility to destroy `devToolsWebContents` manually.
An example of showing devtools in a `<webview>` tag:
```html
<html>
<head>
<style type="text/css">
* { margin: 0; }
#browser { height: 70%; }
#devtools { height: 30%; }
</style>
</head>
<body>
<webview id="browser" src="https://github.com"></webview>
<webview id="devtools" src="about:blank"></webview>
<script>
const { ipcRenderer } = require('electron')
const emittedOnce = (element, eventName) => new Promise(resolve => {
element.addEventListener(eventName, event => resolve(event), { once: true })
})
const browserView = document.getElementById('browser')
const devtoolsView = document.getElementById('devtools')
const browserReady = emittedOnce(browserView, 'dom-ready')
const devtoolsReady = emittedOnce(devtoolsView, 'dom-ready')
Promise.all([browserReady, devtoolsReady]).then(() => {
const targetId = browserView.getWebContentsId()
const devtoolsId = devtoolsView.getWebContentsId()
ipcRenderer.send('open-devtools', targetId, devtoolsId)
})
</script>
</body>
</html>
```
```js
// Main process
const { ipcMain, webContents } = require('electron')
ipcMain.on('open-devtools', (event, targetContentsId, devtoolsContentsId) => {
const target = webContents.fromId(targetContentsId)
const devtools = webContents.fromId(devtoolsContentsId)
target.setDevToolsWebContents(devtools)
target.openDevTools()
})
```
An example of showing devtools in a `BrowserWindow`:
An example of showing DevTools in a `BrowserWindow`:
```js title='main.js'
const { app, BrowserWindow } = require('electron')
@@ -1944,31 +1898,31 @@ app.whenReady().then(() => {
#### `contents.openDevTools([options])`
* `options` Object (optional)
* `mode` string - Opens the devtools with specified dock state, can be
* `mode` string - Opens the DevTools with specified dock state, can be
`left`, `right`, `bottom`, `undocked`, `detach`. Defaults to last used dock state.
In `undocked` mode it's possible to dock back. In `detach` mode it's not.
* `activate` boolean (optional) - Whether to bring the opened devtools window
* `activate` boolean (optional) - Whether to bring the opened DevTools window
to the foreground. The default is `true`.
* `title` string (optional) - A title for the DevTools window (only in `undocked` or `detach` mode).
Opens the devtools.
Opens the DevTools.
When `contents` is a `<webview>` tag, the `mode` would be `detach` by default,
explicitly passing an empty `mode` can force using last used dock state.
On Windows, if Windows Control Overlay is enabled, Devtools will be opened with `mode: 'detach'`.
On Windows, if Windows Control Overlay is enabled, DevTools will be opened with `mode: 'detach'`.
#### `contents.closeDevTools()`
Closes the devtools.
Closes the DevTools view.
#### `contents.isDevToolsOpened()`
Returns `boolean` - Whether the devtools is opened.
Returns `boolean` - Whether the DevTools view is opened.
#### `contents.isDevToolsFocused()`
Returns `boolean` - Whether the devtools view is focused .
Returns `boolean` - Whether the DevTools view is focused .
#### `contents.getDevToolsTitle()`
@@ -2214,7 +2168,7 @@ Returns `boolean` - If _offscreen rendering_ is enabled returns whether it is cu
* `fps` Integer
If _offscreen rendering_ is enabled sets the frame rate to the specified number.
Only values between 1 and 240 are accepted.
When `webPreferences.offscreen.useSharedTexture` is `false` only values between 1 and 240 are accepted.
#### `contents.getFrameRate()`
@@ -2410,11 +2364,12 @@ A [`NavigationHistory`](navigation-history.md) used by this webContents.
#### `contents.hostWebContents` _Readonly_
A [`WebContents`](web-contents.md) instance that might own this `WebContents`.
A `WebContents | null` property that represents a [`WebContents`](web-contents.md)
instance that might own this `WebContents`.
#### `contents.devToolsWebContents` _Readonly_
A `WebContents | null` property that represents the of DevTools `WebContents` associated with a given `WebContents`.
A `WebContents | null` property that represents the DevTools `WebContents` associated with a given `WebContents`.
> [!NOTE]
> Users should never store this object because it may become `null`

View File

@@ -197,7 +197,7 @@ dispatch errors of isolated worlds to foreign worlds.
* `info` Object
* `securityOrigin` string (optional) - Security origin for the isolated world.
* `csp` string (optional) - Content Security Policy for the isolated world.
* `name` string (optional) - Name for isolated world. Useful in devtools.
* `name` string (optional) - Name for isolated world. Useful in DevTools.
Set the security origin, content security policy and name of the isolated world.

View File

@@ -12,6 +12,35 @@ This document uses the following convention to categorize breaking changes:
* **Deprecated:** An API was marked as deprecated. The API will continue to function, but will emit a deprecation warning, and will be removed in a future release.
* **Removed:** An API or feature was removed, and is no longer supported by Electron.
## Planned Breaking API Changes (41.0)
### Behavior Changed: PDFs no longer create a separate WebContents
Previously, PDF resources created a separate guest [WebContents](https://www.electronjs.org/docs/latest/api/web-contents) for rendering. Now, PDFs are rendered within the same WebContents instead. If you have code to detect PDF resources, use the [frame tree](https://www.electronjs.org/docs/latest/api/web-frame-main) instead of WebContents.
Under the hood, Chromium [enabled](https://chromium-review.googlesource.com/c/chromium/src/+/7239572) a feature that changes PDFs to use out-of-process iframes (OOPIFs) instead of the `MimeHandlerViewGuest` extension.
### Behavior Changed: Updated Cookie Change Cause in the Cookie 'changed' Event
We have updated the [cookie](https://www.electronjs.org/docs/latest/api/cookies#event-changed) change cause in the cookie 'changed' event.
When a new cookie is set, the change cause is `inserted`.
When a cookie is deleted, the change cause remains `explicit`.
When the cookie being set is identical to an existing one (same name, domain, path, and value, with no actual changes), the change cause is `inserted-no-change-overwrite`.
When the value of the cookie being set remains unchanged but some of its attributes are updated, such as the expiration attribute, the change cause will be `inserted-no-value-change-overwrite`.
## Planned Breaking API Changes (40.0)
### Deprecated: `clipboard` API access from renderer processes
Using the `clipboard` API directly in the renderer process is deprecated.
If you want to call this API from a renderer process, place the API call in
your preload script and expose it using the [contextBridge](https://www.electronjs.org/docs/latest/api/context-bridge) API.
### Behavior Changed: MacOS dSYM files now compressed with tar.xz
Debug symbols for MacOS (dSYM) now use xz compression in order to handle larger file sizes. `dsym.zip` files are now
`dsym.tar.xz` files. End users using debug symbols may need to update their zip utilities.
## Planned Breaking API Changes (39.0)
### Deprecated: `--host-rules` command line switch
@@ -37,6 +66,22 @@ webContents.setWindowOpenHandler((details) => {
})
```
### Behavior Changed: `NSAudioCaptureUsageDescription` should be included in your app's Info.plist file to use `desktopCapturer` (🍏 macOS ≥14.2)
Per [Chromium update](https://source.chromium.org/chromium/chromium/src/+/ad17e8f8b93d5f34891b06085d373a668918255e) which enables Apple's newer [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps#Configure-the-sample-code-project) by default, you now must have `NSAudioCaptureUsageDescription` defined in your `Info.plist` to use `desktopCapturer`.
Electron's `desktopCapturer` will create a dead audio stream if the new permission is absent however no errors or warnings will occur. This is partially a side-effect of Chromium not falling back to the older `Screen & System Audio Recording` permissions system if the new system fails.
To restore previous behavior:
```js
// main.js (right beneath your require/import statments)
app.commandLine.appendSwitch(
'disable-features',
'MacCatapLoopbackAudioForScreenShare'
)
```
### Behavior Changed: shared texture OSR `paint` event data structure
When using shared texture offscreen rendering feature, the `paint` event now emits a more structured object.
@@ -55,7 +100,7 @@ Users can force XWayland by passing `--ozone-platform=x11`.
### Removed: `ORIGINAL_XDG_CURRENT_DESKTOP` environment variable
Previously, Electron changed the value of `XDG_CURRENT_DESKTOP` internally to `Unity`, and stored the original name of the desktop session
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overriden and now reflects the actual desktop environment.
in a separate variable. `XDG_CURRENT_DESKTOP` is no longer overridden and now reflects the actual desktop environment.
### Removed: macOS 11 support
@@ -136,7 +181,7 @@ window is not currently visible.
`app.commandLine` was only meant to handle chromium switches (which aren't case-sensitive) and switches passed via `app.commandLine` will not be passed down to any of the child processes.
If you were using `app.commandLine` to control the behavior of the main process, you should do this via `process.argv`.
If you were using `app.commandLine` to control the behavior of the main process, you should do this via `process.argv`.
### Deprecated: `NativeImage.getBitmap()`
@@ -166,7 +211,7 @@ from upstream Chromium.
### Deprecated: `null` value for `session` property in `ProtocolResponse`
Previously, setting the ProtocolResponse.session property to `null`
Would create a random independent session. This is no longer supported.
would create a random independent session. This is no longer supported.
Using single-purpose sessions here is discouraged due to overhead costs;
however, old code that needs to preserve this behavior can emulate it by
@@ -177,7 +222,7 @@ and then using it in `ProtocolResponse.session`.
When calling `Session.clearStorageData(options)`, the `options.quota`
property is deprecated. Since the `syncable` type was removed, there
is only type left -- `'temporary'` -- so specifying it is unnecessary.
is only one type left -- `'temporary'` -- so specifying it is unnecessary.
### Deprecated: Extension methods and events on `session`
@@ -506,7 +551,7 @@ more information.
### Removed: The `--disable-color-correct-rendering` switch
This switch was never formally documented but it's removal is being noted here regardless. Chromium itself now has better support for color spaces so this flag should not be needed.
This switch was never formally documented but its removal is being noted here regardless. Chromium itself now has better support for color spaces so this flag should not be needed.
### Behavior Changed: `BrowserView.setAutoResize` behavior on macOS
@@ -1197,7 +1242,7 @@ more details.
### API Changed: `webContents.printToPDF()`
`webContents.printToPDF()` has been modified to conform to [`Page.printToPDF`](https://chromedevtools.github.io/devtools-protocol/tot/Page/#method-printToPDF) in the Chrome DevTools Protocol. This has been changes in order to
`webContents.printToPDF()` has been modified to conform to [`Page.printToPDF`](https://chromedevtools.github.io/devtools-protocol/tot/Page/#method-printToPDF) in the Chrome DevTools Protocol. This has been changed in order to
address changes upstream that made our previous implementation untenable and rife with bugs.
**Arguments Changed**
@@ -2664,6 +2709,18 @@ Replace with: https://atom.io/download/electron
The following list includes the breaking API changes made in Electron 2.0.
### `autoUpdater`
```js
// Deprecated
autoUpdater.setFeedURL(url, headers)
// Replace with
autoUpdater.setFeedURL({
url,
headers
})
```
### `BrowserWindow`
```js

View File

@@ -6,30 +6,104 @@ Follow the guidelines below for building **Electron itself**, for the purposes o
## Platform prerequisites
Check the build prerequisites for your platform before proceeding
Check the build prerequisites for your platform before proceeding:
* [macOS](build-instructions-macos.md#prerequisites)
* [Linux](build-instructions-linux.md#prerequisites)
* [Windows](build-instructions-windows.md#prerequisites)
## Build Tools
## Setting up `@electron/build-tools` (recommended)
[Electron's Build Tools](https://github.com/electron/build-tools) automate much of the setup for compiling Electron from source with different configurations and build targets. If you wish to set up the environment manually, the instructions are listed below.
[Electron Build Tools](https://github.com/electron/build-tools) automate much of the setup for
compiling Electron from source with different configurations and build targets.
Most of the [manual setup](#manual-setup-advanced) instructions can be replaced by simpler Build Tools commands.
> [!TIP]
> Build Tools also gives you access to [remote execution and caching of build actions](./reclient.md),
> which will dramatically improve build times.
Electron Build Tools can be installed globally from npm:
```sh
npm install -g @electron/build-tools
```
Once installed, the `e` command should be globally available in your command line. The `e init`
command bootstraps a local checkout of Electron:
```sh
# The 'Hello, World!' of build-tools: get and build `main`
# Choose the directory where Electron's source and build files will reside.
# You can specify any path you like; this command defaults to `$PWD/electron`.
# If you're going to use multiple branches, you may want something like:
# `--root=~/electron/branch` (e.g. `~/electron-gn/main`)
e init --root=~/electron --bootstrap testing
```
The `--bootstrap` flag also runs `e sync` (synchronizes source code branches from
[`DEPS`](https://github.com/electron/electron/blob/main/DEPS) using
[`gclient`](https://chromium.googlesource.com/chromium/tools/depot_tools.git/+/HEAD/README.gclient.md))
and `e build` (compiles the Electron binary into the `${root}/src/out` folder).
> [!IMPORTANT]
>
> Sometime after the initial `e sync` phase, you will be asked to run `e d rbe login` to auth into
> remote build execution and proceed into the build. This may take about 20-30 minutes!
Once the build is done compiling, you can test it by running `e start` (or by loading it into
[Electron Fiddle](http://electronjs.org/fiddle)).
### Navigating the project
Some quick tips on building once your checkout is set up:
* **Directory structure:** Within the project, Chromium code is synced to `${root}/src/` while Electron's code (i.e. code in
https://github.com/electron/electron) lives in `${root}/src/electron/`. Note that both directories
have their own git repositories.
* **Updating your checkout:** Run git commands such as `git checkout <branch>` and `git pull` from `${root}/src/electron`.
Whenever you update your commit `HEAD`, make sure to `e sync` before `e build` to sync dependencies
such as Chromium and Node.js. This is especially relevant because the Chromium version in
[`DEPS`](https://github.com/electron/electron/blob/main/DEPS) changes frequently.
* **Rebuilding:** When making changes to code in `${root}/src/electron/` in a local branch, you only need to re-run `e build`.
* **Adding patches:** When contributing changes in `${root}/src/` outside of `${root}/src/electron/`, you need to do so
via Electron's [patch system](./patches.md). The `e patches` command can export all relevant patches to
`${root}/src/electron/patches/` once your code change is ready.
> [!IMPORTANT]
> Unless you're applying upstream patches, you should treat `${root}/src/` as a read-only folder and
> spend most of your development time in `${root}/src/electron/`. You should not need to make any
> changes or run `git` commands in `${root}/src/`.
> [!TIP]
> Detailed documentation for all available `e` commands can be found in the
> repository's [README.md](https://github.com/electron/build-tools/blob/main/README.md). You can
> also run `e --help` to list all commands and use the `--help` flag on any command to get more
> usage info.
> [!TIP]
> For more information on project structure, see the [Source Code Directory Structure](./source-code-directory-structure.md)
> guide.
<details>
<!-- markdownlint-disable-next-line MD033 -->
<summary><strong>Manual setup (advanced)</strong></summary>
## Manual setup (advanced)
Electron uses [GN](https://gn.googlesource.com/gn) for project generation and
[ninja](https://ninja-build.org/) for building. Project configurations can
be found in the `.gn` and `.gni` files.
[siso](https://chromium.googlesource.com/build/+/refs/heads/main/siso/README.md) for building.
Project configurations can be found in the `.gn` and `.gni` files in the `electron/electron` repo.
## GN Files
### GN files
The following `gn` files contain the main rules for building Electron:
* `BUILD.gn` defines how Electron itself is built and
includes the default configurations for linking with Chromium.
* `build/args/{testing,release,all}.gn` contain the default build arguments for
building Electron.
* [`BUILD.gn`](https://github.com/electron/electron/blob/main/BUILD.gn) defines how Electron itself
is built and includes the default configurations for linking with Chromium.
* [`build/args/{testing,release,all}.gn`](https://github.com/electron/electron/tree/main/build/args)
contain the default build arguments for building Electron.
## GN prerequisites
### GN prerequisites
You'll need to install [`depot_tools`][depot-tools], the toolset
used for fetching Chromium and its dependencies.
@@ -56,7 +130,7 @@ $ mkdir -p "${GIT_CACHE_PATH}"
# This will use about 16G.
```
## Getting the code
### Getting the code
```sh
$ mkdir electron && cd electron
@@ -68,7 +142,7 @@ $ gclient sync --with_branch_heads --with_tags
> Instead of `https://github.com/electron/electron`, you can use your own fork
> here (something like `https://github.com/<username>/electron`).
### A note on pulling/pushing
#### A note on pulling/pushing
If you intend to `git pull` or `git push` from the official `electron`
repository in the future, you now need to update the respective folder's
@@ -83,12 +157,13 @@ $ git branch --set-upstream-to=origin/main
$ cd -
```
:memo: `gclient` works by checking a file called `DEPS` inside the
`src/electron` folder for dependencies (like Chromium or Node.js).
> [!TIP]
> `gclient` works by checking a file called `DEPS` inside the
`${root}/src/electron` folder for dependencies (like Chromium or Node.js).
Running `gclient sync -f` ensures that all dependencies required
to build Electron match that file.
So, in order to pull, you'd run the following commands:
In order to pull, you'd run the following commands:
```sh
$ cd src/electron
@@ -96,7 +171,7 @@ $ git pull
$ gclient sync -f
```
## Building
### Building
**Set the environment variable for chromium build tools**
@@ -156,7 +231,7 @@ $ gn gen out/Release --args="import(\`"//electron/build/args/release.gn\`")"
```
> [!NOTE]
> This will generate a `out/Testing` or `out/Release` build directory under `src/` with the testing or release build depending upon the configuration passed above. You can replace `Testing|Release` with another names, but it should be a subdirectory of `out`.
> This will generate a `out/Testing` or `out/Release` build directory under `${root}/src/` with the testing or release build depending upon the configuration passed above. You can replace `Testing|Release` with another names, but it should be a subdirectory of `out`.
Also you shouldn't have to run `gn gen` again—if you want to change the build arguments, you can run `gn args out/Testing` to bring up an editor. To see the list of available build configuration options, run `gn args out/Testing --list`.
@@ -189,7 +264,7 @@ $ ./out/Testing/electron.exe
$ ./out/Testing/electron
```
### Packaging
#### Packaging
To package the electron build as a distributable zip file:
@@ -197,7 +272,7 @@ To package the electron build as a distributable zip file:
$ ninja -C out/Release electron:electron_dist_zip
```
### Cross-compiling
#### Cross-compiling
To compile for a platform that isn't the same as the one you're building on,
set the `target_cpu` and `target_os` GN arguments. For example, to compile an
@@ -223,7 +298,7 @@ and [`target_cpu`][target_cpu values].
[target_os values]: https://gn.googlesource.com/gn/+/main/docs/reference.md#built_in-predefined-variables-target_os_the-desired-operating-system-for-the-build-possible-values
[target_cpu values]: https://gn.googlesource.com/gn/+/main/docs/reference.md#built_in-predefined-variables-target_cpu_the-desired-cpu-architecture-for-the-build-possible-values
#### Windows on Arm (experimental)
#### Windows on Arm
To cross-compile for Windows on Arm, [follow Chromium's guide](https://chromium.googlesource.com/chromium/src/+/refs/heads/main/docs/windows_build_instructions.md#Visual-Studio) to get the necessary dependencies, SDK and libraries, then build with `ELECTRON_BUILDING_WOA=1` in your environment before running `gclient sync`.
@@ -241,12 +316,12 @@ gclient sync -f --with_branch_heads --with_tags
Next, run `gn gen` as above with `target_cpu="arm64"`.
## Tests
### Tests
To run the tests, you'll first need to build the test modules against the
same version of Node.js that was built as part of the build process. To
generate build headers for the modules to compile against, run the following
under `src/` directory.
under `${root}/src/` directory.
```sh
$ ninja -C out/Testing electron:node_headers
@@ -262,7 +337,7 @@ $ npm run test -- \
--enable-logging -g 'BrowserWindow module'
```
## Sharing the git cache between multiple machines
### Sharing the git cache between multiple machines
It is possible to share the gclient git cache with other machines by exporting it as
SMB share on linux, but only one process/machine can be using the cache at a
@@ -284,11 +359,14 @@ This can be set quickly in powershell (ran as administrator):
New-ItemProperty -Path "HKLM:\System\CurrentControlSet\Services\Lanmanworkstation\Parameters" -Name DirectoryCacheLifetime -Value 0 -PropertyType DWORD -Force
```
</details>
## Troubleshooting
### gclient sync complains about rebase
### `sync` complains about rebase
If `gclient sync` is interrupted the git tree may be left in a bad state, leading to a cryptic message when running `gclient sync` in the future:
If `e sync` (or `gclient sync`) is interrupted, the git tree may be left in a bad state, leading to
a cryptic message when running `sync` in the future:
```plaintext
2> Conflict while rebasing this branch.
@@ -296,17 +374,19 @@ If `gclient sync` is interrupted the git tree may be left in a bad state, leadin
2> See man git-rebase for details.
```
If there are no git conflicts or rebases in `src/electron`, you may need to abort a `git am` in `src`:
If there are no git conflicts or rebases in `${root}/src/electron`, you may need to abort a `git am`
in `${root}/src`:
```sh
$ cd ../
$ git am --abort
$ cd electron
$ gclient sync -f
$ e sync -f
```
This may also happen if you have checked out a branch (as opposed to having a detached head) in `electron/src/`
or some other dependencys repository. If that is the case, a `git checkout --detach HEAD` in the appropriate repository should do the trick.
This may also happen if you have checked out a branch (as opposed to having a detached head) in `${root}/src/`
or some other dependencys repository. If that is the case, a `git checkout --detach HEAD` in the
appropriate repository should do the trick.
### I'm being asked for a username/password for chromium-internal.googlesource.com
@@ -315,16 +395,6 @@ If you see a prompt for `Username for 'https://chrome-internal.googlesource.com'
your locally installed version of Visual Studio (by default, `depot_tools` will
try to download a Google-internal version that only Googlers have access to).
### `e` Module not found
If `e` is not recognized despite running `npm i -g @electron/build-tools`, ie:
```sh
Error: Cannot find module '/Users/<user>/.electron_build_tools/src/e'
```
We recommend installing Node through [nvm](https://github.com/nvm-sh/nvm). This allows for easier Node version management, and is often a fix for missing `e` modules.
### RBE authentication randomly fails with "Token not valid"
This could be caused by the local clock time on the machine being off by a small amount. Use [time.is](https://time.is/) to check.

View File

@@ -6,77 +6,17 @@ Follow the guidelines below for building **Electron itself** on Linux, for the p
## Prerequisites
* At least 25GB disk space and 8GB RAM.
* Python >= 3.9.
* [Node.js](https://nodejs.org/download/) >= 22.12.0
* [clang](https://clang.llvm.org/get_started.html) 3.4 or later.
* Development headers of GTK 3 and libnotify.
Due to Electron's dependency on Chromium, prerequisites and dependencies for Electron change over time. [Chromium's documentation on building on Linux](https://chromium.googlesource.com/chromium/src/+/HEAD/docs/linux/build_instructions.md) has up to date information for building Chromium on Linux. This documentation can generally
be followed for building Electron on Linux as well.
On Ubuntu >= 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libasound2-dev libcap-dev \
libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python3-dbusmock openjdk-8-jre
```
On Ubuntu < 20.04, install the following libraries:
```sh
$ sudo apt-get install build-essential clang libdbus-1-dev libgtk-3-dev \
libnotify-dev libgnome-keyring-dev \
libasound2-dev libcap-dev libcups2-dev libxtst-dev \
libxss1 libnss3-dev gcc-multilib g++-multilib curl \
gperf bison python-dbusmock openjdk-8-jre
```
On RHEL / CentOS, install the following libraries:
```sh
$ sudo yum install clang dbus-devel gtk3-devel libnotify-devel \
libgnome-keyring-devel xorg-x11-server-utils libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock openjdk-8-jre
```
On Fedora, install the following libraries:
```sh
$ sudo dnf install clang dbus-devel gperf gtk3-devel \
libnotify-devel libgnome-keyring-devel libcap-devel \
cups-devel libXtst-devel alsa-lib-devel libXrandr-devel \
nss-devel python-dbusmock
```
On Arch Linux / Manjaro, install the following libraries:
```sh
$ sudo pacman -Syu base-devel clang libdbus gtk2 libnotify \
libgnome-keyring alsa-lib libcap libcups libxtst \
libxss nss gcc-multilib curl gperf bison \
python2 python-dbusmock jdk8-openjdk
```
Other distributions may offer similar packages for installation via package
managers such as pacman. Or one can compile from source code.
Additionally, Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) can be referenced to get the current dependencies that Electron requires in addition to what Chromium installs via [build/install-deps.sh](https://chromium.googlesource.com/chromium/src/+/HEAD/build/install-build-deps.sh).
### Cross compilation
If you want to build for an `arm` target you should also install the following
dependencies:
If you want to build for an `arm` target, you can use Electron's [Linux dependency installer](https://github.com/electron/build-images/blob/main/tools/install-deps.sh) to install the additional dependencies by passing the `--arm argument`:
```sh
$ sudo apt-get install libc6-dev-armhf-cross linux-libc-dev-armhf-cross \
g++-arm-linux-gnueabihf
```
Similarly for `arm64`, install the following:
```sh
$ sudo apt-get install libc6-dev-arm64-cross linux-libc-dev-arm64-cross \
g++-aarch64-linux-gnu
$ sudo install-deps.sh --arm
```
And to cross-compile for `arm` or targets, you should pass the

View File

@@ -6,7 +6,7 @@ Follow the guidelines below for building **Electron itself** on macOS, for the p
## Prerequisites
* macOS >= 11.6.0
* macOS >= 12
* [Xcode](https://developer.apple.com/technologies/tools/). The exact version
needed depends on what branch you are building, but the latest version of
Xcode is generally a good bet for building `main`.
@@ -40,7 +40,7 @@ If you are on arm64 architecture, the build script may be pointing to the wrong
### Certificates fail to verify
installing [`certifi`](https://pypi.org/project/certifi/) will fix the following error:
Installing [`certifi`](https://pypi.org/project/certifi/) will fix the following error:
```sh
________ running 'python3 src/tools/clang/scripts/update.py' in '/Users/<user>/electron'

Some files were not shown because too many files have changed in this diff Show More