Compare commits

...

458 Commits

Author SHA1 Message Date
trop[bot]
8b9e721047 fix: don't re-parse URL unnecessarily when handling dialogs (#50399)
* fix: fallback to opaque URL when needed inside dialog callback

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* refactor: remove additional URL parsing entirely when showing dialogs

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* test: add crash test case for URL-less dialogs

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* refactor: exit on events instead of on timeout for dialog crash test

Co-authored-by: Robo <hop2deep@gmail.com>

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: make linter happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: make linter actually happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* fix: address failing `safeDialogs` tests

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-20 13:46:37 -04:00
trop[bot]
43bb93908c fix: correct utility process exit code on Windows (#50386)
* fix: correct utility process exit code on Windows

On Windows, process exit codes are 32-bit unsigned integers (DWORD).
When passed from Chromium to Electron as a signed int and then
implicitly converted to uint64_t, values with the high bit set
(e.g., NTSTATUS codes) undergo sign extension, producing incorrect
values.

Cast the exit code to uint32_t before widening to uint64_t to
prevent sign extension and preserve the original Windows exit code.

Fixes #49455

Co-authored-by: João Silva <joaomrsilva@tecnico.ulisboa.pt>

* fix: narrow HandleTermination and Shutdown to uint32_t, add tests

Co-authored-by: João Silva <joaomrsilva@tecnico.ulisboa.pt>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: João Silva <joaomrsilva@tecnico.ulisboa.pt>
2026-03-19 18:48:27 -07:00
trop[bot]
b0055e0500 fix: improved the appearance of shadows and borders on frameless windows on Wayland (#50213)
fix: improved the appearance of shadows and borders on frameless windows on Wayland (#50007)

* remove painting from linux frame layout

* use chromium csd strategy for frameless windows

* Apply suggestions from code review

Remove unneeded virtual methods



* removed inline destructors

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2026-03-19 15:42:58 -04:00
trop[bot]
9a7381a328 ci: output build cache hit rate as GHA annotation (#50370)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-19 12:04:12 -04:00
trop[bot]
af3e0fca24 fix: always call the original impl in swizzled mousedown impls (#50354)
fix: always call the original implementation in swizzled mousedown implementations

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-18 20:11:50 -07:00
trop[bot]
99d879b52e chore: Respect HTTP(S) proxy env variable for Yarn (#50350)
Respect HTTP(S) proxy env variable for Yarn

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Filip Mösner <filip.mosner@seznam.cz>
2026-03-18 20:03:10 -07:00
electron-roller[bot]
3d8105ae7f chore: bump chromium to 146.0.7680.153 (41-x-y) (#50346)
* chore: bump chromium in DEPS to 146.0.7680.153

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
2026-03-18 17:49:48 -04:00
trop[bot]
aba01d38dc fix: correctly track BaseWindow::IsActive() on MacOS (#50340)
fix: correctly set IsActive() in BaseWindow on MacOS

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kyle Cutler <kycutler@microsoft.com>
2026-03-18 17:11:46 -04:00
trop[bot]
a0f01336a3 fix: ensure WebContents::WasShown runs when window is shown (#50343)
Avoids a freeze when failing to enter fullscreen on macOS.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Beutner <beutner.john@gmail.com>
2026-03-18 14:53:09 -04:00
trop[bot]
4a98b4e27e docs: fix markdown formatting in fuses.md (#50333)
* docs: fix markdown formatting in fuses.md

* Use bulleted list (was being run together on one line)
* Wrap ASCII diagram in code block

Co-authored-by: Ryan Zimmerman <ryan@exodus.io>

* docs: apply suggestions from code review

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Ryan Zimmerman <ryan@exodus.io>

* docs: fix misapplied suggestion

Co-authored-by: Ryan Zimmerman <ryan@exodus.io>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Ryan Zimmerman <ryan@exodus.io>
2026-03-18 16:09:27 +01:00
trop[bot]
44bc2c8cef fix: user resizable transparent windows on win32 (#50298)
test: revert win32 frameless and transparent resizable expectations

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Justin Mayfield <tooker@gmail.com>
2026-03-17 09:46:52 +01:00
trop[bot]
4e9e7335bc test: fix esm issue in node-spec-runner (#50295)
Chromium added a top-level package.json in CL:7485999 that sets
the type to module and breaks commonjs tests run via
node-spec-runner.js. This commit temporarily changes the type to
commonjs while running the tests, then changes it back to module when done.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 15:44:40 -04:00
trop[bot]
cd88382756 fix: add ASAR support to additional copy methods (#50286)
* fix: add ASAR support for additional copy methods

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* test: add tests for ASAR support for additional copy messages

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-16 13:56:00 -04:00
trop[bot]
105c5591d0 docs: update the example of webContents.setWindowOpenHandler to cla… (#50293)
docs: reorganize the comments for clarifying `webContents.setWindowOpenHandler` example

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: z0gSh1u <zx.cs@qq.com>
2026-03-16 12:53:05 -04:00
trop[bot]
90b3a2341d build: remove redundant bits of ncrypto node patch (#50279)
build: remove redundant ncrypto node patch

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 16:03:05 +01:00
electron-roller[bot]
21f9474f4f chore: bump chromium to 146.0.7680.80 (41-x-y) (#50262)
* chore: bump chromium in DEPS to 146.0.7680.80

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 15:18:28 +01:00
trop[bot]
c3e397ed2d fix: prefer browser runtime over node in DevTools HostRuntime detection (#50276)
Upstream DevTools' HostRuntime checks `IS_NODE` before `IS_BROWSER` when
selecting the platform runtime. In Electron, `process` is available in
renderer processes, so `IS_NODE` evaluates to `true` in the DevTools
context. This causes DevTools to dynamically import the Node.js platform
runtime, which uses `node:worker_threads`. DevTools Web Workers running
under the `devtools://` protocol cannot load Node.js built-in modules,
so the import fails and breaks features like the formatter worker.

Fix by swapping the check order to prefer `IS_BROWSER` when both are
true. This is safe because in pure Node.js environments (the only case
where the node runtime is needed), `window` and `self` are both
undefined, so `IS_BROWSER` is always `false` regardless of check order.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 12:55:46 +01:00
trop[bot]
d84dca2818 build: skip archiving patch conflict fix artifact (#50257)
The update-patches artifact is a single .patch file, so zipping it
is unnecessary overhead. With archive: false, gh run download fetches
the raw file directly without requiring a decompression step.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Claude <noreply@anthropic.com>
2026-03-13 18:51:49 -07:00
trop[bot]
bb20d0c352 docs: point pull requests guide to build tools (#50253)
* docs: point pull requests guide to build tools

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* update for `--fork`

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-03-13 16:16:09 -04:00
electron-roller[bot]
c66fc559b2 chore: bump chromium to 146.0.7680.76 (41-x-y) (#50244)
* chore: bump chromium in DEPS to 146.0.7680.76

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
2026-03-13 15:00:47 -04:00
trop[bot]
76f34911f2 build: add patch conflict resolution workflow with CI artifacts (#50239)
ci: upload patch conflict fix as artifact in apply-patches

When patch-up.js cannot auto-push the 3-way-merged patch diff (e.g. on
fork PRs), the checkout action already writes patches/update-patches.patch
and tells the user to check CI artifacts — but nothing was uploading it.

This adds the missing upload-artifact step to the apply-patches job so
the resolved diff is available for download, and documents in CLAUDE.md
that pulling this artifact and applying it with `git am` is the fast
path for fixing patch conflicts on PR branches without a full local sync.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Claude <noreply@anthropic.com>
2026-03-13 10:10:48 +01:00
trop[bot]
5d381dd27e ci: update actions/cache to 5.0.3 (#50238)
chore: update actions/cache to 5.0.3

Needed due to https://github.blog/changelog/2025-09-19-deprecation-of-node-20-on-github-actions-runners/

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-13 10:04:48 +01:00
Keeley Hammond
42d7f2783b chore: cherry-pick d5b0cb2acffe from v8 (#50233)
* chore: cherry-pick d5b0cb2acffe from v8

* chore: update patches

---------

Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
2026-03-13 03:11:14 +00:00
Keeley Hammond
61b4c6b93e chore: cherry-pick 248acd90d9a3 from skia (#50234)
* chore: add skia patch dir

* chore: cherry-pick 248acd90d9a3 from skia

* chore: fix the dumbest comma, patch
2026-03-13 03:04:12 +00:00
John Kleinschmidt
b9ca21156b ci: add timeout to test step (#50206)
ci: add timeout to test step (#50186)

Additionally, take a screenshot on timeout so that we can debug why there is a hang
2026-03-12 14:40:26 +01:00
trop[bot]
23960241f9 fix: preserve staged update dir when pruning orphaned updates on macOS (#50217)
* fix: preserve staged update dir when pruning orphaned update dirs on macOS

The previous squirrel.mac patch cleaned up all staged update directories
before starting a new download. This kept disk usage bounded but broke
quitAndInstall() if called while a subsequent checkForUpdates() was in
flight — the already-staged bundle would be deleted out from under it.

This reworks the patch to read ShipItState.plist and preserve the
directory it references, deleting only truly orphaned update.XXXXXXX
directories. Disk footprint stays bounded (at most 2 dirs: staged +
in-progress) and quitAndInstall() remains safe mid-check.

Also adds test coverage for the quitAndInstall/checkForUpdates race and
a triple-stack scenario where 3 updates arrive without a restart.

Refs https://github.com/electron/electron/issues/50200

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-03-12 01:50:13 +00:00
trop[bot]
6d2986302c fix: prevent traffic light buttons flashing on deminiaturize (#50209)
* fix: prevent traffic light buttons flashing on deminiaturize

When a window with a custom `trafficLightPosition` is minimized and
restored, macOS re-layouts the title bar container during the
deminiaturize animation, causing the traffic light buttons to briefly
appear at their default position before being repositioned.

Fix this by hiding the buttons container in `windowWillMiniaturize` and
restoring them (with a redraw to the correct position) in
`windowDidDeminiaturize`.

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: address feedback from review

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-11 17:00:10 -04:00
trop[bot]
01b99cd9a9 docs: document Wayland frameless window shadow behaviour (#50195)
docs: update linux frameless window docs to account for hasShadow:false

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: George Xu <george.xu@slack-corp.com>
2026-03-11 15:37:32 -04:00
electron-roller[bot]
a8f64f684f chore: bump chromium to 146.0.7680.72 (41-x-y) (#50196)
chore: bump chromium in DEPS to 146.0.7680.72

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-03-11 15:35:29 -04:00
trop[bot]
ca1b77d9b7 fix: don't call TaskDialogIndirect with disabled parent windows (#50191)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-10 18:05:58 -07:00
trop[bot]
3678edfa37 feat: WebContents.getOrCreateDevToolsTargetId() (#50176)
* Feat: support getDevToolsId() on WebContents

* Rename to `getOrCreateDevToolsTargetId`

* build: use spawn instead of spawnSync for build (#49774)

* Fix build

* formatting

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kyle Cutler <67761731+kycutler@users.noreply.github.com>
2026-03-10 12:22:32 -04:00
Shelley Vohr
cb4d31ae61 fix: bind offscreen paint callback to child WebContents (#50152)
fix: bind offscreen paint callback to child WebContents

Previously, MaybeOverrideCreateParamsForNewWindow bound the
OffScreenWebContentsView's paint callback to the parent WebContents
using base::Unretained(this). This was both unsafe (dangling pointer
risk if the parent is destroyed before the child) and semantically
incorrect — paint events belong to the child window, not the opener.

Replace the callback in MaybeOverrideCreateParamsForNewWindow with
base::DoNothing(), then rebind it to the child WebContents in
AddNewContents via a new SetCallback method on OffScreenWebContentsView.
2026-03-10 09:43:51 +01:00
trop[bot]
616a63bc73 refactor: use WHATWG URL instead of url.parse (#50143)
refactor: use WHATWG URL instead of url.parse

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-09 19:58:45 -07:00
Samuel Attard
e78e2ca996 fix: correct parsing of second-instance additionalData (#50154)
- POSIX: validate StringToSizeT result and token count when splitting
  the socket message into argv and additionalData; previously a
  malformed message could produce incorrect slicing.
- Windows: base64-encode additionalData before embedding in the
  null-delimited wchar_t buffer. The prior reinterpret_cast approach
  dropped everything after the first aligned 0x0000 in the serialized
  payload, so complex objects could arrive truncated.

Manually backported from #50119
2026-03-09 19:22:57 -07:00
trop[bot]
cea004c31e docs: fix ipc highlight lines (#50181)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-03-09 18:31:21 -07:00
trop[bot]
a14f661c58 fix: read nodeIntegrationInWorker from per-frame WebPreferences (#50134)
* fix: read nodeIntegrationInWorker from per-frame WebPreferences

Previously the renderer checked a process-wide command-line switch to
decide whether to create a Node.js environment for dedicated workers.
When a renderer process hosted multiple WebContents with different
nodeIntegrationInWorker values (e.g. via window.open with overridden
webPreferences in setWindowOpenHandler), all workers in the process
used whichever value the first WebContents set on the command line.

Instead, plumb the flag through blink's WorkerSettings at worker
creation time, copying it from the initiating frame's WebPreferences.
The check on the worker thread then reads the per-worker value. Nested
workers inherit the flag from their parent worker via
WorkerSettings::Copy.

The --node-integration-in-worker command-line switch is removed as it
is no longer consumed.

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-09 23:26:10 +00:00
trop[bot]
64354677bf fix: validate protocol scheme names in setAsDefaultProtocolClient (#50155)
fix: validate protocol scheme names in setAsDefaultProtocolClient

On Windows, `app.setAsDefaultProtocolClient(protocol)` directly
concatenates the protocol string into the registry key path with no
validation. A protocol name containing `\` could write to an arbitrary
subkey under `HKCU\Software\Classes\`, potentially hijacking existing
protocol handlers.

To fix this, add `Browser::IsValidProtocolScheme()` which validates that a protocol
name conforms to the RFC 3986 scheme grammar:

  scheme = ALPHA *( ALPHA / DIGIT / "+" / "-" / "." )

This rejects backslashes, forward slashes, whitespace, and any other
characters not permitted in URI schemes.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-09 23:06:57 +00:00
trop[bot]
15dd5dc396 fix: use requesting frame origin in permission helper and device choosers (#50148)
* fix: use requesting frame origin instead of top-level URL for permissions

`WebContentsPermissionHelper::RequestPermission` passes
`web_contents_->GetLastCommittedURL()` as the origin to the permission
manager instead of the actual requesting frame's origin. This enables
origin confusion when granting permissions to embedded third-party iframes,
since app permission handlers see the top-level origin instead of the
iframe's. The same pattern exists in the HID, USB, and Serial device
choosers, where grants are keyed to the primary main frame's origin rather
than the requesting frame's.

Fix this by using `requesting_frame->GetLastCommittedOrigin()` in all
affected code paths, renaming `details.requestingUrl` to
`details.requestingOrigin`, and populating it with the serialized
origin only.

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: keep requestingUrl name in permission handler details

The previous commit changed the details.requestingUrl field to
details.requestingOrigin in permission request/check handlers. That
field was already populated from the requesting frame's RFH, so the
rename was unnecessary and would break apps that read the existing
property. Revert to requestingUrl to preserve the existing API shape.

The functional changes to use the requesting frame in
WebContentsPermissionHelper and the HID/USB/Serial choosers remain.

Co-authored-by: Samuel Attard <sattard@anthropic.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-09 15:59:57 -07:00
trop[bot]
205cd53a06 fix: InspectorFrontendHost override in embedded windows (#50137)
fix: InspectorFrontendHost override in embedded windows

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-09 10:00:28 -05:00
trop[bot]
2c890e0adc fix: validate response header names and values before AddHeader (#50132)
Matches the existing validation applied to request headers in
electron_api_url_loader.cc.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-09 12:34:05 +01:00
trop[bot]
58ea9554f6 build: pin diff.renames for deterministic patch export (#50128)
git format-patch honors diff.renames, which defaults to 'true' (rename
detection only). If a user has diff.renames=copies configured at the
system or global level, exported patches may encode new files as copies
of similar existing files, causing spurious diffs against patches
exported on other machines. Pin diff.renames=true to match git's
default.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-09 10:33:14 +01:00
trop[bot]
1ab3e54129 fix: strictly validate sender for internal IPC reply channels (#50126)
The sender-mismatch check in invokeInWebContents and invokeInWebFrameMain
used a negative condition (`type === 'frame' && sender !== expected`),
which only rejected mismatched frame senders and accepted anything else.

Invert to a positive check so only the exact expected frame can resolve
the reply — matches the guard style used elsewhere in lib/browser/.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-09 10:33:07 +01:00
trop[bot]
26fb36b7fb fix: screen.getCursorScreenPoint() crash on Wayland (#50105)
* docs: document that getCursorScreenPoint() needs a Window on Wayland

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* feat: add IsWayland() helper

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* fix: Wayland crash in GetCursorScreenPoint()

fix: support Screen::GetCursorScreenPoint() on X11

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-08 19:20:34 +01:00
Ryan Fitzgerald
332b5b4097 fix: delete temporary blink* globals after restoring Blink implementations (#50117)
fix: delete temporary blink* globals after restoring Blink implementations (#49991)

ElectronRendererClient::DidCreateScriptContext (and the worker
equivalent) save Blink's fetch/Response/FormData/Request/Headers/
EventSource as temporary globalThis.blink* properties before Node
initialization may overwrite them. node/init.ts and worker/init.ts
restore the originals but previously never deleted the temporary
blink* globals.

They persisted as non-standard global pollution visible to page
content when contextIsolation is disabled -- a minor fingerprinting
signal and a bypass for any preload that wraps window.fetch (page
could call blinkfetch() instead).

Co-authored-by: Samuel Attard <sam@electronjs.org>
2026-03-08 00:05:08 -08:00
electron-roller[bot]
ad84f5b888 chore: bump chromium to 146.0.7680.65 (41-x-y) (#50101)
* chore: bump chromium in DEPS to 146.0.7680.65

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-08 06:22:51 +09:00
trop[bot]
f40c1a5796 fix: Revert "updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)" (#50111)
Revert "fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)"

This reverts commit 90c9de70ac.

Ref: https://github.com/electron/electron/issues/50050

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2026-03-06 21:05:19 -08:00
trop[bot]
c5978261a4 docs: cleanup desktop-capturer doc after chromium audio capture additions (#50114)
* docs: cleanup desktop-capturer doc after chromium audio capture additions

Co-authored-by: Michaela Laurencin <mlaurencin@electronjs.org>

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Michaela Laurencin <35157522+mlaurencin@users.noreply.github.com>

* disable linter for list in note

Co-authored-by: Michaela Laurencin <35157522+mlaurencin@users.noreply.github.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Michaela Laurencin <mlaurencin@electronjs.org>
Co-authored-by: Michaela Laurencin <35157522+mlaurencin@users.noreply.github.com>
2026-03-06 16:05:26 -05:00
trop[bot]
cb32daded3 docs: remove release schedule in favor of https://releases.electronjs.org/schedule (#50108)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-06 15:47:31 -05:00
trop[bot]
94bc0ec88c fix: prevent use-after-free in PowerMonitor via dangling OS callbacks (#50087)
PowerMonitor registered OS-level callbacks (HWND UserData and
WTS/suspend notifications on Windows, shutdown handler and lock-screen
observer on macOS) but never cleaned them up in its destructor. The JS
layer also only held the native object in a closure-local variable,
allowing GC to reclaim it while those registrations still referenced
freed memory.

Retain the native PowerMonitor at module level in power-monitor.ts so
it cannot be garbage-collected. Add DestroyPlatformSpecificMonitors()
to properly tear down OS registrations on destruction: on Windows,
unregister WTS and suspend notifications, clear GWLP_USERDATA, and
destroy the HWND; on macOS, remove the emitter from the global
MacLockMonitor and reset the Browser shutdown handler.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-05 15:24:12 -05:00
trop[bot]
1bd08111e7 docs: add more api history (C-D) (#50083)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-03-05 17:14:17 +01:00
trop[bot]
df065892fa fix: avoid redundant page-favicon-updated events on setBounds (#50085)
* fix: avoid duplicate calls in electron_api_web_contents

Co-authored-by: ANANYA542 <ananyashrma6512@gmail.com>

* Style: fix lint errors

Co-authored-by: ANANYA542 <ananyashrma6512@gmail.com>

* fix: prevent duplicate page-favicon-updated events and add regression test

Co-authored-by: Ananya542 <ananyashrma6512@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: ANANYA542 <ananyashrma6512@gmail.com>
2026-03-05 17:14:13 +01:00
trop[bot]
7520211f51 build: fix code-signing for MacOS x64 tests (#50073)
* fix: code-sign binaries for notification tests

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* test: remove redundent feedURL test

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* test: move squirrel feed tests to api-autoupdater

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* Revert "fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings"

This reverts commit 5ad9892a67.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* test: unsign tests requiring no signed app

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fixup! fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings

chore: fix patch shear

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-05 10:12:33 -06:00
trop[bot]
198b70e4bd fix: FTBFS when printing is disabled (#50077)
these variables hit with-Werror,-Wunused when printing is disabled

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-05 08:57:09 -06:00
trop[bot]
ac54002bac feat: show toast dismissal reason on Windows (#50029)
* feat: show toast dismissal reason on Windows

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* Update docs/api/notification.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-05 11:29:27 +01:00
trop[bot]
be87d0c08a fix: use proper quoting for exe paths and args on Windows (#50076)
Previously, GetProtocolLaunchPath and FormatCommandLineString in
browser_win.cc used naive quoting which could break when paths or
arguments contained backslashes, spaces, or embedded quotes.

Fix by extracting the CommandLineToArgvW-compatible quoting logic from
relauncher_win.cc into a shared utility and use it in both browser_win.cc
and relauncher_win.cc to properly quote the exe path and each argument
individually.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-04 13:37:50 -06:00
trop[bot]
d19eb6b07f fix: better shortcut registration and app icon matching on Wayland (#50051)
* fix: set default desktop name that matches exec name on linux

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* chromium patches for global shortcuts

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* use app name for shortcut description

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* chore: fixup .patches after trop

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-04 16:43:44 +01:00
trop[bot]
83ef7e68c9 chore: remove applescript from trash (#50066)
Previously, when trashItemAtURL: failed (e.g. on network shares or
under app translocation), the code fell back to constructing an
AppleScript that interpolated the bundle path directly into a string
literal via %@ with no escaping. This was fragile and unnecessary —
trashItemAtURL: has been the standard API since 10.8 and covers the
relevant cases. The fix simply removes the AppleScript fallback
entirely, so Trash() now returns the result of trashItemAtURL: directly.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-04 16:14:12 +01:00
trop[bot]
1ec6624b0a fix: uaf in non-client hittest during view teardown (#50055)
* fix: uaf in non-client hittest during view teardown

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: update crash spec

Co-authored-by: deepak1556 <hop2deep@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-03-03 14:15:36 -05:00
trop[bot]
d6e02c53ad fix(styles): add missing dot prefix to .hero-icon.loop-3 CSS selector (#50033)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Jaya Krishna <jayakrishnagundupu@gmail.com>
2026-03-03 09:29:47 -05:00
trop[bot]
429309b7c7 fix: validate USB device selection against filtered device list (#50049)
Previously, UsbChooserController::OnDeviceChosen looked up the chosen
device_id via chooser_context_->GetDeviceInfo(), which searches all
known USB devices on the system rather than the filtered list shown to
the select-usb-device handler. This meant a device excluded by the
renderer's filters or exclusion_filters could still be granted
permission if the handler returned its GUID.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-03 09:27:30 -05:00
trop[bot]
632113662c fix: use destination context when wrapping VideoFrame in contextBridge (#50023)
Enter the destination context scope before creating the VideoFrame V8
wrapper, matching the sibling Element and Blob branches. Without this,
ScriptState::ForCurrentRealm resolved to the calling context instead of
the target context, producing an incorrect wrapper.

Also switch to ScriptState::From with an explicit context argument to
make the intent clearer.

Adds spec coverage for VideoFrame crossing the bridge in both
directions and adds VideoFrame to the existing prototype checks.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-03 09:15:37 -05:00
trop[bot]
95e0fc7f28 chore: remove unused commandLineSwitches flag (#50015)
chore: remove unused commandLineSwitches flag

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-03 10:45:18 +01:00
trop[bot]
c605b21af6 fix: use setter's creation context when proxying setter in OverrideGlobalPropertyFromIsolatedWorld (#50020)
The setter branch was deriving source_context from getter-> instead of
setter->. Currently latent since the only call site passes both from
the same preload context, but this would crash or mis-resolve if a
future call site passed a setter without a getter or from a different
context.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-03 10:43:06 +01:00
trop[bot]
fcaf525050 fix: prevent use-after-free in permission request callbacks (#50034)
EnterFullscreenModeForTab, RequestPointerLock, and RequestKeyboardLock
bind callbacks with base::Unretained(this); fullscreen also captures a
raw RenderFrameHost*. These callbacks may be invoked by the app's JS
permission handler after the WebContents or RenderFrameHost is destroyed.

Use GetWeakPtr() in all three call sites, and capture a
GlobalRenderFrameHostToken instead of the raw RenderFrameHost* for
fullscreen so the pointer is resolved and null-checked only when the
callback fires. Cancel in-flight permission requests from ~WebContents()
via a new ElectronPermissionManager::CancelPendingRequests()` so stale
callbacks are never handed back to JS.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-02 20:45:46 -08:00
trop[bot]
2fcd22e542 build: authenticate curl requests to googlesource in lint workflow (#50028)
fix: authenticate curl requests to googlesource in lint workflow

The "Download GN Binary" and "Download clang-format Binary" steps
fetch files from chromium.googlesource.com without passing
authentication cookies. When googlesource rate-limits or returns a
transient error (502), the HTML error page is piped into `base64 -d`,
causing `base64: invalid input`.

The `set-chromium-cookie` action already configures `~/.gitcookies`
in a prior step. Pass `-b ~/.gitcookies` to both `curl` calls so
they authenticate, matching what the cookie verification step itself
does.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-02 18:38:05 -05:00
trop[bot]
0da6944cb6 fix: potential UAF in OnDownloadPathGenerated (#50010)
fix: potential UAF in OnDownloadPathGenerated

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-02 18:36:12 -05:00
trop[bot]
1a760a18e5 fix: deliver Universal Links when NSUserActivity.userInfo is nil (#50006)
* fix(mac): deliver Universal Links when NSUserActivity.userInfo is nil

Co-authored-by: Dante Issaias <dante@issaias.com>

* chore: format

Co-authored-by: Dante Issaias <dante@issaias.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Dante Issaias <dante@issaias.com>
2026-03-02 13:12:20 -05:00
Keeley Hammond
db665a0b05 fix: revert "build: roll Mantle and remove patch" (#49978)
Revert "build: roll Mantle and remove patch (#38437)"

This reverts commit 11d174344a.
2026-03-02 11:31:58 -05:00
trop[bot]
8a2b0b9c40 fix: menu bar hiding on two setFullscreen(false) (#49996)
* test: add failing test for `setFullscreen(false)`

`setFullscreen(false)` should do nothing
when not already in fullscreen, but it hides the menu bar
on Linux.

Co-authored-by: WofWca <wofwca@protonmail.com>

* fix: menu bar hiding on two setFullScreen(false)

This fixes the following bug on Linux (and maybe macOS):
1. Create a window with a menu bar.
2. Call `win.setFullScreen(false)`.

The menu bar will hide.

See the original bug in our project:
https://github.com/deltachat/deltachat-desktop/issues/4752.

Co-authored-by: WofWca <wofwca@protonmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: WofWca <wofwca@protonmail.com>
2026-03-02 10:31:59 -05:00
electron-roller[bot]
8996fe7701 chore: bump node to v24.14.0 (41-x-y) (#49940)
* chore: bump node in DEPS to v24.14.0

* lib: prefer call() over apply() if argument list is not array

https://github.com/nodejs/node/pull/60796

* build,deps: replace cjs-module-lexer with merve

https://github.com/nodejs/node/pull/61456

* chore: fixup patch indices

* test: use fixture directories for sea tests

https://github.com/nodejs/node/pull/61167

* src: throw RangeError on failed ArrayBuffer BackingStore allocation

* chore: fixup crypto patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-02 14:37:27 +01:00
trop[bot]
e4040abb94 fix: update label/sublabel/icon in MenuItems on open (#49972)
fix: update label/sublabel/icon in macOS item on open

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-02 12:50:39 +01:00
trop[bot]
520d3175b2 fix: correct window sizing on Linux when constraints on resizability are enforced (#49971)
fix: correct window sizing on Linux when constraints on resizability are enforced (#49903)

* fix window sizing on linux when constraints are applied

* added tests

* apply window style directly when changing resizability

* Revert "apply window style directly when changing resizability"

This reverts commit 949e2ee2ab.

* set size constraints for resizability on window and linux

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2026-03-02 10:13:57 +01:00
electron-roller[bot]
b08e234098 chore: bump chromium to 146.0.7680.31 (41-x-y) (#49957)
* chore: bump chromium in DEPS to 146.0.7680.31

* chore: update patches

* fix(patch-conflict): adapt MacWebContentsOcclusion for version check removal

Upstream removed the manualOcclusionDetectionSupportedForCurrentMacOSVersion
check, now always initializing occlusion detection. Adapted patch to keep
the feature flag gate around the simplified initialization code.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7602735

* fix(patch-update): patch out GLIC Summarize in pdf_extension_util

Upstream added a Glic summarize button feature in pdf_extension_util.cc.
The new ShouldShowGlicSummarizeButton() function uses Profile::FromBrowserContext
and glic::GlicEnabling which are not available in Electron builds.
Wrapped the ENABLE_GLIC code block in #if 0 to disable it.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7596305

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-27 16:12:34 -05:00
trop[bot]
a77bf5307e fix: menu close event missing after opening a submenu (#49964)
* fix: menu close event missing after opening a submenu

Co-authored-by: Jarek Radosz <jarek@cvx.dev>

* add a unit-like test

Co-authored-by: Jarek Radosz <jarek@cvx.dev>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Jarek Radosz <jarek@cvx.dev>
2026-02-26 16:55:19 -05:00
trop[bot]
b91d3d33fa fix: potential std::stoi crash in Windows Toasts (#49953)
fix: potential std::stoi crash in Windows Toasts

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-25 22:58:28 -08:00
trop[bot]
de2ebae944 build: exit upload with error code if github upload fails (#49942)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-25 14:32:00 -05:00
trop[bot]
6dcbf464f4 feat: add support for --experimental-transform-types (#49882)
* feat: add support for `--experimental-transform-types`

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: add tests

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: add `--experimental-transform-types` to docs

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-02-25 12:56:35 -05:00
trop[bot]
3a2b7d3720 feat: Shadows and CSD for frameless windows on Wayland (#49885)
feat: Shadows and CSD for frameless windows on Wayland (#49295)

* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* layout helper

* CSD shadows for frameless windows on Linux

* simplify min/max size calculation

* use base window size for min/max

* respect HasShadow option

* moved windows min/max size overrides

* add newline at end of file

* fix setting background color for frameless csd windows

* fix wco positioning nad sizing to match prod

* safety improvements

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2026-02-25 12:53:49 -05:00
trop[bot]
f86822163f fix: crash after win.showAllTabs() new tab (#49933)
fix: crash after win.showAllTabs new tab

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-25 11:54:26 -05:00
trop[bot]
e600ad9dac docs: mark "Show hidden files" file dialog setting as deprecated on Linux (#49948)
* fix: don't overwrite "Show hidden files" setting on Linux/GTK

Co-authored-by: zonescape <44441590+zonescape@users.noreply.github.com>

* docs: deprecate showHiddenFiles property in dialogs on Linux

Co-authored-by: zonescape <44441590+zonescape@users.noreply.github.com>

* docs: mark Electron 42 as the removal date for this feature

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: zonescape <44441590+zonescape@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-25 11:40:50 -05:00
trop[bot]
f3f3e113ab build: fix Chromium roll linting merge base determination in CI (#49946)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-25 11:40:06 -05:00
trop[bot]
cadea1da52 fix: prevent crash on Windows when closing child windows (#49929)
* guard against window destruction in min/max size checks

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* use weakptr to prevent hit test crash on teardown

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* revove web contents views during teardown

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* fix test failure

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

* fix other tests

Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2026-02-24 17:18:21 -05:00
trop[bot]
ed26c173b1 docs: fix some string enum typings (#49930)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-24 11:20:01 -05:00
trop[bot]
261f2fcc5e build: fix roller branch detection in CI (#49926)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-23 22:54:18 -08:00
trop[bot]
19a421a3fc ci: fix checking latest release for website docs update (#49922)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-23 18:09:48 -08:00
trop[bot]
c34188ffe9 fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49916)
fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)

Updated Alt detection to explicitly exclude AltGraph/AltGr

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shashwat Raj <65155843+darthvader58@users.noreply.github.com>
2026-02-23 15:27:21 -08:00
trop[bot]
e50f03eceb fix: apply zoomFactor from setWindowOpenHandler to window.open() windows (#49911)
fix: apply zoomFactor from setWindowOpenHandler to window.open() windows

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-23 15:41:25 +01:00
trop[bot]
a9c8647508 fix: fullscreen restoration on Windows (#49891)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-21 09:45:13 +01:00
trop[bot]
b5c7b6fddd fix: prevent GBytes leak in GdkPixbufFromSkBitmap on Linux/GTK (#49895)
Inside gtk_util::GdkPixbufFromSkBitmap, g_bytes_new() was called
inline as an argument to gdk_pixbuf_new_from_bytes(), which per
GTK docs does not take ownership of the GBytes - it adds its own
internal reference. The caller's GBytes* was never stored or
unreffed, leaking 4 x width x height bytes of pixel data on every
call.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: redeemer <marcin.probola@gmail.com>
2026-02-20 14:58:05 -08:00
trop[bot]
df3d652e82 fix: refresh menu item state on key equivalent dispatch (#49890)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-20 14:58:21 -05:00
electron-roller[bot]
7eaca97133 chore: bump chromium to 146.0.7680.16 (41-x-y) (#49838)
* chore: bump chromium in DEPS to 146.0.7680.0

* fix(patch): constant moved to header

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>
(cherry picked from commit 6b348354f6)

* chore: update patches

* 7535923: Rename ozone buildflags

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>
(cherry picked from commit 96e2a174fd)

* 7528398: [LNA] Rename PNA-named files to LNA-named files

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528398

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>
(cherry picked from commit a4f879ce52)

* 7534194: Convert some functions in ui::Clipboard to async

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>
(cherry picked from commit 30bbb9456f)

* 7544580: [DevTools] Add command to restart Chrome to DevTools UI bindings

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7544580

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>
(cherry picked from commit 6737a36cda)

* fix(patch): V1 Keychain removal

Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted

keychain_password_mac.mm to use KeychainV2 APIs.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>
(cherry picked from commit 02d423c1bb)

* chore: update patches

* fixup 7534194: Convert some functions in ui::Clipboard to async

* chore: bump chromium in DEPS to 146.0.7680.16

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-20 14:30:11 -05:00
trop[bot]
3e0b9e7ae6 fix: update DBus signal signature for XDG GlobalShortcuts portal (#49871)
* fix: update DBus signal signature for XDG GlobalShortcuts portal

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fixup! fix: update DBus signal signature for XDG GlobalShortcuts portal

fix .patches file

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-19 16:22:54 -06:00
trop[bot]
0696edf73c ci: log mocha retries in spec runner (#49878)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Nilay Arya <84241885+nilayarya@users.noreply.github.com>
2026-02-19 16:10:03 -05:00
trop[bot]
27594e03d7 fix: rgbaf16 shared texture remove keyed mutex. (#49876)
* fix: rgbaf16 shared texture remove keyed mutex.

Co-authored-by: reito <reito@chromium.org>

* fix: rgbaf16 patch.

Co-authored-by: reito <reito@chromium.org>

* 更新 shared-texture-handle.md

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

Co-authored-by: reito <reito@chromium.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-19 20:22:10 +01:00
Shelley Vohr
e6a25dc66d feat: allow defaulting to printer default page size (#49812)
Co-authored-by: Edvan de Matos <edvan.santos@querodelivery.com>
2026-02-19 14:24:30 +01:00
trop[bot]
5666e2308e chore: use relative links from docs/ to files outside of docs/ (#49866)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-19 14:23:37 +01:00
trop[bot]
1055ddc72b refactor: initialize libgdk stubs before use in platform_util:Beep (#49865)
* refactor: initialize libgdk stubs before use in `platform_util:Beep`

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* feat: add upstream function to get libgdk handle

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* fix: add missing include for libgdk support

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: adjust comment wording and make linter happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: make linter actually happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-02-19 12:47:16 +01:00
Sam Maddock
42242bc069 fix: frameless window resize in MAS builds (#49857)
backport: fix: frameless window resize in MAS builds
2026-02-19 09:54:24 +01:00
trop[bot]
4dee7b4f29 ci: fixup build stats upload on Windows (#49850)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-19 09:54:12 +01:00
trop[bot]
eb68705a0f build: lint commits on Chromium roller branches (#49862)
* build: lint commits on Chromium roller branches

Assisted-By: Claude Opus 4.5

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: add ability to skip linting CLs by adding #nolint

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: only exit with non-zero exit code in CI

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-19 09:53:51 +01:00
trop[bot]
62a60064a0 docs: note required windows in 'new-window-for-tab' event (#49859)
docs: note required windows in new-window-for-tab

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-18 20:36:46 -08:00
trop[bot]
63dca6b31c docs: clarify ASAR integrity is supported in MAS builds (#49854)
* docs: clarify ASAR integrity is supported in MAS builds

Add a note to the ASAR integrity documentation explicitly stating
that this feature is fully supported and recommended in Mac App
Store builds. While MAS-installed apps have system-level protections,
ASAR integrity provides an additional security layer and is important
for MAS builds distributed outside the Mac App Store.

Slack thread: https://electronhq.slack.com/archives/CB6CG54DB/p1771449093872419?thread_ts=1771446183.473289&cid=CB6CG54DB

https://claude.ai/code/session_01A97nfiqHUVxLNaQyHVXS7j

Co-authored-by: Claude <noreply@anthropic.com>

* docs: clarify ASAR integrity support for MAS builds

Updates the ASAR integrity documentation to explicitly mention that
it is supported and recommended in Mac App Store builds. Clarifies
that while MAS-installed apps have system-level protections (Resources
folder owned by root), ASAR integrity is especially important when
distributing MAS builds through other channels like direct download,
since those installations won't have the read-only protections.

https://claude.ai/code/session_012mBNZQW34h91NRcdFaLxNh

Co-authored-by: Claude <noreply@anthropic.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Claude <noreply@anthropic.com>
2026-02-18 22:26:13 +00:00
trop[bot]
667d9eb074 fix: accurate window sizing and support for content sizing on Linux/Wayland with CSD (#49835)
fix: accurate window sizing and support for content sizing on Linux/Wayland with CSD (#49209)

* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* simplify min/max size calculation

* use base window size for min/max

* moved windows min/max size overrides

* remove unnecessary checks for client frame

* cleanup

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Mitchell Cohen <mitch.cohen@me.com>
2026-02-18 16:22:51 -05:00
trop[bot]
c6a9972d45 feat: add support for long-animation-frame script attribution (#49773)
* feat: add support for `long-animation-frame` script attribution

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: document `AlwaysLogLOAFURL`

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: add test

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: adjust docs as per PR comment

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: test failures

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: simplify test

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* fix: tests on Windows and Linux

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-18 15:00:07 -05:00
trop[bot]
a64ec2c877 fix: draggable region position with docked DevTools (#49848)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-18 14:22:59 -05:00
trop[bot]
0853587510 feat: improve Windows Toast actions support (#49787)
* feat: improve Windows Toast actions support

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: ensure MSIX compatibility

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* test: add bad clsid format test

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-18 13:23:53 -05:00
trop[bot]
ccfe23b6cc feat: enable WASM trap handlers in all Node.js processes (#49839)
fix: enable WASM trap handlers in all Node.js processes

```
Original reason for revert:

Some apps started throwing exception on startup
https://github.com/electron/electron/issues/48956
```

We now move the trap handler registeration before
any user script execution. Add a fuse to support
disabling the feature is application needs to run
in memory constrained environments.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-02-18 13:22:36 -05:00
trop[bot]
b6ed33908c test: MAS for private API usage (#49836)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
2026-02-18 14:01:18 +01:00
trop[bot]
3a1c2454bc build: use spawn instead of spawnSync for build (#49827)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 16:59:34 -05:00
electron-roller[bot]
4b1d393fb6 chore: bump chromium to 146.0.7666.0 (41-x-y) (#49543)
* chore: bump chromium in DEPS to 146.0.7653.0

* chore: bump chromium in DEPS to 146.0.7653.1

* chore: bump chromium in DEPS to 146.0.7655.0

* chore: bump chromium in DEPS to 146.0.7657.1

* chore: bump chromium in DEPS to 146.0.7659.0

* chore: bump chromium in DEPS to 146.0.7661.0

* chore: bump chromium in DEPS to 146.0.7663.1

* chore: bump chromium in DEPS to 146.0.7665.1

* chore: bump chromium in DEPS to 146.0.7667.1

* chore: bump chromium in DEPS to 146.0.7668.2

* chore: bump chromium in DEPS to 146.0.7670.0

* chore: bump chromium in DEPS to 146.0.7672.1

* chore: bump chromium in DEPS to 146.0.7674.1

* chore: bump chromium in DEPS to 146.0.7676.1

* chore: bump chromium in DEPS to 146.0.7678.1

* chore: bump chromium in DEPS to 146.0.7680.1

* chore: bump chromium in DEPS to 146.0.7680.4

* chore: bump chromium in DEPS to 146.0.7680.0

* chore: bump chromium to 146.0.7666.0 (main) (#49528)

* chore: bump chromium in DEPS to 146.0.7652.0

* fix(patch-conflict): update mas_avoid_private_macos_api_usage context for constrainFrameRect method

The upstream CL added a new constrainFrameRect:toScreen: method override to
NativeWidgetMacNSWindow as part of headless mode window zoom implementation.
The MAS patch's #endif for frameViewClassForStyleMask now correctly appears
after that method, since constrainFrameRect is a public API override that
doesn't need to be guarded.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7487666

* fix(patch-conflict): update printing.patch for base::DictValue rename

Updated printing.patch to use the new base::DictValue type name instead of
base::Value::Dict following Chromium's type renaming change. This affects
CompleteUpdatePrintSettings() signature and related code.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* fix(patch-conflict): update accessibility_ui patch for base::DictValue/ListValue rename

Updated adjust_accessibility_ui_for_electron.patch to use the new
base::DictValue and base::ListValue type names instead of base::Value::Dict
and base::Value::List following Chromium's type renaming change.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* chore: update patches

* 6625736: Rename DURABLE_STORAGE to PERSISTENT_STORAGE for consistency | https://chromium-review.googlesource.com/c/chromium/src/+/6625736

* chore: bump chromium in DEPS to 146.0.7653.0

* chore: update patches

* 7000847: add type tag to v8::External for gin_helper function templates

The upstream gin function templates now use v8::ExternalPointerTypeTag
for type safety when using v8::External. Updated Electron's forked
gin_helper function template to use the same kGinInternalCallbackHolderBaseTag
that Chromium's gin uses.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* fix(patch-update): extend V8 Object API deprecation patch for Node.js

Extended the existing patch to cover additional files that use
GetAlignedPointerFromInternalField and SetAlignedPointerInInternalField:
- src/stream_base-inl.h
- src/udp_wrap.cc
- src/js_udp_wrap.cc
- src/node_process_methods.cc
- src/node_snapshotable.cc
- src/base_object.cc

These APIs now require an EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* 7000847: add type tag to v8::External calls in shared_texture

Updated v8::External::New and v8::External::Value calls to use the
kExternalPointerTypeTagDefault tag as required by the V8 API change
that deprecates the tagless versions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* 7508687: use ChildProcessId for file permission APIs

The ChildProcessSecurityPolicy::CanReadFile and GrantReadFile APIs
now require ChildProcessId instead of int. Updated to use GetID()
instead of GetDeprecatedID() for these specific calls.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7508687

* 7000847: add type tag to v8::External calls in callback and osr_converter

The v8::External API now requires an EmbedderPointerTypeTag parameter
for both New() and Value() methods to improve V8 sandbox type safety.

Updated calls in:
- callback.cc: TranslatorHolder constructor and CallTranslator
- osr_converter.cc: OffscreenSharedTextureValue converter

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7000847

* fixup! 7087956: [api] Promote deprecation of v8::Context and v8::Object API methods

Extended the Node.js patch to cover histogram.cc which also uses
SetAlignedPointerInInternalField and GetAlignedPointerFromInternalField
APIs that now require the EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* chore: bump chromium in DEPS to 146.0.7655.0

* chore: update patches

* 7509043: update WebSpellingMarker type for API change

The upstream Chromium API changed - WebSpellingMarker was moved from a
nested type within WebTextCheckClient to a standalone type in the blink
namespace.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509043

* 7498491: update process_id to use OriginatingProcess type

The upstream Chromium API changed - URLLoaderFactoryParams::process_id
was changed from an integer to a union type network::OriginatingProcess
that distinguishes between browser and renderer processes.

- For browser process requests, use OriginatingProcess::browser()
- For renderer process lookups, check !is_browser() and use
  renderer_process().value() to get the child_id

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7498491

* 5710330: Add crash keys to debug NativeWidgetMacNSWindowBorderlessFrame exception | https://chromium-review.googlesource.com/c/chromium/src/+/5710330

5710330 added a new NSNextStepFrame interface extension and
implementations for NativeWidgetMacNSWindowTitledFrame and
NativeWidgetMacNSWindowBorderlessFrame. These use private macOS APIs
that are not available in Mac App Store builds.

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7661.0

* chore: bump chromium in DEPS to 146.0.7663.0

* fix(patch-conflict): update accessibility_ui for string_view API change

Upstream removed redundant std::string(default_api_type) conversion as part
of a string_view optimization cleanup. Updated patch context to match.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7514107

* fix(patch-conflict): update service process launch options for sandbox API refactor

Upstream removed content/common/sandbox_init_win.cc and
content/public/common/sandbox_init_win.h, moving the functionality directly
into ChildProcessLauncherHelper. Updated patch to call
sandbox::policy::SandboxWin::StartSandboxedProcess directly with the
LaunchOptions pointer instead of going through the removed helper.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528253

* fix(patch-conflict): update MAS safestorage for keychain API refactor

Upstream refactored KeychainPassword::GetPassword() to use a new
GetPasswordImpl() helper function with improved error tracking via
base::expected<std::string, OSStatus>. Adapted patch to use the new
GetPasswordImpl with the suffixed account name and handle migration
from legacy accounts through the new API.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7516438

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7663.0

* fix: base::Value::Dict -> base::DictValue
https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: include new cookie exclusion reason
https://chromium-review.googlesource.com/c/chromium/src/+/7486527

* fix: enable libc++ ABI flag for trivially copyable std::vector<bool>

Required for changes introduced in the following CL
https://chromium-review.googlesource.com/c/chromium/src/+/7513653

* fixup! fix: base::Value::Dict -> base::DictValue https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: spellcheck not working in tests
https://chromium-review.googlesource.com/c/chromium/src/+/7452579

* fix: cookie test failing due to multiple rejection reasons
https://chromium-review.googlesource.com/c/chromium/src/+/7506629

* fix: macos sizing unmaximized window incorrectly
https://chromium-review.googlesource.com/c/chromium/src/+/7487666

Changes to headless mode caused the unmaximized window to subtract
the height of the menubar.

* fix: skip tests for incompatible BoringSSL ML-DSA crypto
https://boringssl-review.googlesource.com/c/boringssl/+/84929

* test: fix pseudonymization registration in utility process on Linux

Ref: 7486913: Pass pseudonymization salt via shared memory at process launch | https://chromium-review.googlesource.com/c/chromium/src/+/7486913

* fix: restore MAS patch-outs

Restores some `#if !IS_MAS_BUILD()` gates dropped in 773054ad59

* fixup! 7508687: use ChildProcessId for file permission APIs

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

* chore: add note about parallel upstream change

* fixup! Merge remote-tracking branch 'origin/main' into roller/chromium/main

* Revert "fixup! 7508687: use ChildProcessId for file permission APIs"

This reverts commit 05c43e4e5d.

The _impl version has the signature, but not the public interface. :oof:

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
(cherry picked from commit a65cfed500)

* chore: update patches after rebase

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 16:19:16 -05:00
trop[bot]
fbab56b196 docs: fix typos across tutorial documentation (#49833)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: ron <ronald_eddy@yahoo.com>
2026-02-17 15:05:34 -05:00
trop[bot]
5a504daae8 chore: add Copilot CLI instructions (#49821)
chore: add copilot-instructions

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-17 13:25:48 -05:00
trop[bot]
5b9699885c chore: add PR Notes section requirement to CLAUDE.md (#49818)
docs: add PR Notes section requirement to CLAUDE.md

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-02-17 11:17:35 +00:00
trop[bot]
c5890eb77b fix: excise abort_report_np usage in MAS (#49811)
* fix: excise abort_report_np usage in MAS

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fix it harder

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-17 10:10:23 +01:00
trop[bot]
c99a47c98b fix: missing shared texture docs (#49809)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-16 22:18:27 -08:00
electron-roller[bot]
49437d48a2 chore: bump node to v24.13.1 (41-x-y) (#49743)
* chore: bump node in DEPS to v24.13.1

* chore: fixup patches

refs:
* https://github.com/nodejs/node/pull/60425
* https://github.com/nodejs/node/pull/61270
* https://github.com/nodejs/node/pull/61044

* fix: generate_config_gypi needs to generate valid JSON

https://github.com/nodejs/node/pull/60794

* doc: align Buffer.concat documentation with behavior

https://github.com/nodejs/node/pull/60405

* src: fix off-thread cert loading in bundled cert mode

https://github.com/nodejs/node/pull/60764

* chore: fixup patch indices

* build: fix extraneous includes

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-13 13:37:27 +01:00
Keeley Hammond
af5975046b chore: cherry-pick e045399a1ecb from chromium (#49789)
* chore: cherry-pick e045399a1ecb from chromium

* chore: update patch
2026-02-12 18:35:31 -08:00
trop[bot]
c131a4613c build(dev-deps): update micromark-core-commonmark to 2.0.3 (#49759)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-12 15:05:58 +01:00
trop[bot]
933308863e feat: add support for disclaiming utility processes (#49693)
* feat: add support for disclaiming utility processes

Co-authored-by: Samuel Attard <sattard@anthropic.com>

* chore: update patches

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-02-11 13:52:14 -08:00
trop[bot]
a28ca7e03a build: generate artifact attestions for released assets (#49768)
* build: generate artifact attestions for released assets

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* chore: address review feedback

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* build: fixup attestation for release assets (#49732)

* build: fixup attestation for release assets

* Generate artifact attestation for generated artifacts

* set id-token for attestation

* Add artifact-metadata permission for attestation

* add permissions for testing attestations

* Revert "add permissions for testing attestations"

This reverts commit 0284bed175.

* Revert "set id-token for attestation"

This reverts commit 69a1b13a18.

* Revert "Generate artifact attestation for generated artifacts"

This reverts commit ee0536eceb.

* chore: update publish workflow

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2026-02-11 15:32:26 -05:00
trop[bot]
de8008a6af fix: revoke Read access after removing file via FileSystemAccess API (#49745)
Refs https://chromium-review.googlesource.com/6677249

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-11 14:28:55 -05:00
trop[bot]
510c9e12dd ci: add markdownlint problem matcher (#49763)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-11 13:57:10 -05:00
trop[bot]
e3f6f96a25 docs: fix typos across documentation (#49757)
Fix 40 typos across 25 documentation files including misspellings,
missing words, doubled words, wrong words, and grammatical errors.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: ron <ronald_eddy@yahoo.com>
2026-02-11 16:50:06 +01:00
trop[bot]
78c7dc3d84 fix: address upstream Chromium shift to enable CoreAudio Tap API for audio capture used in electron's desktopCapturer (🍏 macOS). (#49739)
* fix: Enable CoreAudio Tap API for Audio Capture (🍏 macOS)

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

* fix: addressed markdown issue which caused pre-commit hook failure

🧑‍🔧 : Ref : https://github.com/electron/electron/pull/49717#issuecomment-3874660013

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

* fix: updated docs to cover `desktopCapturer` nuances with macOS

📝 : PR https://github.com/electron/electron/pull/49717

Co-authored-by: Bug-Reaper <llama@soundsafari.io>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Bug-Reaper <llama@soundsafari.io>
2026-02-11 12:50:08 +01:00
trop[bot]
e22252c689 docs: fix framerate limit when osr with shared texture (#49728)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: reito <reito@chromium.org>
2026-02-09 15:36:55 +01:00
trop[bot]
9c29c7c00e ci: fix patches changes detected in apply patches workflow (#49708)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-06 21:30:14 -08:00
trop[bot]
d7d5db8631 fix: restore macos 12 support in Node 24 (#49703)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-02-06 13:38:33 -08:00
trop[bot]
e6f231925f refactor: use ComPtr pattern for MSIX to avoid exception handling (#49686)
* Revert "fix: fix Windows MSIX release build errors (#49613)"

This reverts commit 4b5d5f9dd5.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* refactor: use WRL ComPtr pattern for MSIX to avoid exception handling

The MSIX auto-updater code was using C++/WinRT (winrt::* namespace), which requires exception handling (/EHsc). Mixing exception and non-exception handling code in the same binary is problematic at runtime. This commit refactors electron_api_msix_updater.cc to use an upstream Chromium pattern and eliminates the need for special exception handling build flags

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: import correct packages

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* build: consolidate IPackage declarations

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* refactor: use IPackageManager/IPackageManager5/IPackageManager9 and IPackage/IPackage2/IPackage4/IPackage6 interfaces as needed for different API methods.

Also consolidates duplicate completion handler logic, fixes a bug in
RegisterRestartOnUpdate where the command line string could go out of
scope, and removes unused includes.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-02-05 13:09:20 -08:00
trop[bot]
f1517f53e0 refactor: don't log error just for unsigned code (#49676)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-02-05 13:13:13 -05:00
trop[bot]
7863318e51 fix: default accelerator for role-based menu items (#49668)
fix: apply default accelerator for role-based menu items

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-05 10:58:19 -05:00
trop[bot]
b07765b8c2 ci: use squash merge for apply patches workflow (#49673)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-04 18:49:44 -08:00
trop[bot]
2dbdf223b7 feat: add focusOnNavigation flag to WebPreferences (#49511)
* feat: add focusOnNavigation webPreference

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* WebContentsView tests

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* fix

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

* fix

Co-authored-by: Kyle Cutler <kycutler@microsoft.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kyle Cutler <kycutler@microsoft.com>
2026-02-04 15:44:03 -05:00
trop[bot]
0abdb91b78 fix: alt-space should route through 'system-context-menu' (#49642)
fix: alt-space should route through system-context-menu

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-04 18:53:55 +01:00
trop[bot]
64ef870e34 fix: remove menu observer before destroying menu_controller_ (#49658)
* fix: remove menu observer before destroying menu_controller_

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: resolves private inheritance conflict

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-02-04 18:53:41 +01:00
trop[bot]
f295327047 ci: handle PRs with no checks in rerun apply patches (#49664)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-02-04 09:46:37 -08:00
trop[bot]
efc8595b25 docs: add Wayland note to win.getPosition() and win.getBounds() (#49659)
docs: add Wayland note to win.getPosition()

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-04 11:51:11 -05:00
trop[bot]
f874dba057 fix(squirrel.mac): clean up old staged updates before downloading new update (#49639)
fix: clean up old staged updates before downloading new update

When checkForUpdates() is called while an update is already staged,
Squirrel creates a new temporary directory for the download without
cleaning up the old one. This can lead to disk usage growth when
new versions are released while the app hasn't restarted.

This adds a force parameter to pruneUpdateDirectories that bypasses
the AwaitingRelaunch state check. This is called before creating a
new temp directory, ensuring old staged updates are cleaned up.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Andy Locascio <loc@anthropic.com>
2026-02-03 21:43:55 +01:00
trop[bot]
47990a354f build: remove Core Graphics private macOS APIs on MAS (#49643)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 14:49:04 -05:00
trop[bot]
3d5986e29a fix: wrong cause and removed flag in cookie change listener (#49631)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: mrchaofan <lcfme@icloud.com>
2026-02-03 14:00:30 -05:00
trop[bot]
b4563125d9 fix: menu state in macOS dock menus (#49625)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 12:06:48 -05:00
trop[bot]
a86261ad08 fix: possible crash in FileSystem API (#49636)
Refs https://chromium-review.googlesource.com/6880247

Fixes a crash that can arise in the File System Access API in the
following scenario:

1. Create fileHandle1 at path1.
2. Call fileHandle1.remove() or user manually delete the file.
3. Create fileHandle2 at path2.
4. fileHandle2.move(path1).

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-03 11:32:23 -05:00
trop[bot]
58f4af4636 fix: issues with xdg activation on Linux (#49594)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-02 14:32:46 -05:00
trop[bot]
594b38fb7d fix: handle out of order recording errors in skia graphite (#49621)
* fix: Handle out of order recording errors in skia graphite

Refs https://issues.chromium.org/issues/458722690

Co-authored-by: deepak1556 <hop2deep@gmail.com>

* chore: fix .patches file

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-02-02 14:31:17 -05:00
trop[bot]
26079bd762 feat: msix auto-updater (#49586) 2026-02-02 14:21:40 +01:00
trop[bot]
d7bdf92817 fix: duplicate fullscreen macOS menu item (#49598) 2026-02-02 14:20:37 +01:00
trop[bot]
ee3afeb27b docs: app.getGPUInfo() may reject (#49618)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2026-02-02 11:18:13 +01:00
trop[bot]
abe2fd8c2c refactor: address PathProvider TODO (#49599)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-02 09:38:46 +01:00
trop[bot]
9198ecf95a docs: add jsign instructions for Azure Trusted Signing on Linux/macOS (#49603)
* docs: add jsign instructions for Azure Trusted Signing on Linux/macOS

Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>

* docs: add clickable jsign link for Azure Trusted Signing

Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Prachi Maskar <prachimaskar184@gmail.com>
2026-02-02 09:38:25 +01:00
trop[bot]
d76da9ac83 build(dev-deps): bump @electron/lint-roller to 3.2.0 (#49576)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-30 13:25:29 -05:00
David Sanders
1aa08a4de4 ci: rework reapply patches (#49581)
ci: rework reapply patches (#49552)
2026-01-30 13:21:59 -05:00
trop[bot]
32281a6d08 fix: macOS menu item accelerators when item disabled (#49591)
fix: macOS menu item acceerators when item disabled

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-30 13:16:11 -05:00
trop[bot]
158c5e8366 ci: trigger website docs update on release published (#49568)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 20:57:04 -08:00
trop[bot]
702a17d6bf test: remove split dependency (#49554)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-28 15:44:18 -08:00
trop[bot]
ad5c8483c7 fix: chrome://accessibility drift (#49561)
https://chromium-review.googlesource.com/c/chromium/src/+/6870052

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-28 15:37:16 +01:00
trop[bot]
5e36ae10d9 ci: reapply patches if PR base branch updates them (#49534)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-27 16:16:45 +01:00
trop[bot]
c3f6a15467 docs: correct type for process.noDeprecation (#49546)
* docs: correct type for process.noDeprecation

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* docs: mark `noDeprecation` as optional instead

Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-27 11:34:36 +01:00
trop[bot]
2041abcaf2 chore: bump chromium to 146.0.7650.0 (41-x-y) (#49529)
chore: bump chromium to 146.0.7650.0 41-x-y

* chore: bump chromium in DEPS to 146.0.7650.0

* 7496671: WaaP: Control hung delay for Initial WebUI

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7496671

* 7494302: [//media] Rename renderable_gpu_memory_buffer_video_frame_pool*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7494302

* chore: update patches

* 7502996: [DevTools] Add ability to toggle Chromium feature flags from DevTools

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7502996

* 7456200: Vectorize StringImpl::CopyChars and EqualIgnoringASCIICase using Highway.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200

* 7236627: spellcheck: supply full spelling marker info, incld. marker type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7236627

* chore: rm dependency on wtf::string from blink public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200
added a public dependency on //third_party/highway for
//third_party/blink/renderer/platform/wtf:wtf which will not be
inherited by //content/renderer since wtf is internal dependency of
blink leading to the following compilation error

```
In file included from ../../content/public/renderer/window_features_converter.cc:5:
In file included from ../../content/public/renderer/window_features_converter.h:10:
In file included from ../../third_party/blink/public/web/web_window_features.h:38:
In file included from ../../third_party/blink/renderer/platform/wtf/text/wtf_string.h:40:
../../third_party/blink/renderer/platform/wtf/text/string_impl.h:27:10: fatal error: 'hwy/highway.h' file not found
   27 | #include <hwy/highway.h>
      |          ^~~~~~~~~~~~~~~
1 error generated.
```

Use `gn desc out/Testing content/renderer:renderer_sources --blame`
to verify the inherited config and dependency list.

* 7493995: Restore directive part of wasm-eval error message

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7493995

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-01-27 11:02:16 +01:00
trop[bot]
1b16b6a315 docs: add type reference links in Menu and MenuItem API documentation (#49526)
* docs: add type reference links in Menu and MenuItem API documentation

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

* docs: revert type links in Menu return types to fix parser

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sourav Bera <sbera987654321@gmail.com>
2026-01-26 14:27:53 +01:00
trop[bot]
86196dc588 chore: bump chromium to 146.0.7645.0 (41-x-y) (#49497)
* chore: bump chromium in DEPS to 146.0.7643.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 146.0.7645.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7402162: Refactor app shims to call ContentMain

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7402162

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7454282: Add master key management for HTTP Cache Encryption

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7454282

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7490440: Reland "Delete unused base::Contains()"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7490440

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: update patches

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7414864: Pass CSSParserLocalContext down to CSSMathExpressionNodeParser

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7414864

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7460969: Move child_process_id.h to common

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7460969

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7474608: [api] Remove deprecated v8::PropertyCallbackInfo<T>::This()

Refs https://chromium-review.googlesource.com/c/v8/v8/+/7474608

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7461067: [Viz] Rename kPreferGpuMemoryBuffer

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7461067

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7487174: Remove GLHelper

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7487174

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* 7457538: Set timeout from multi source page context fetcher

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7457538

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-26 11:58:09 +01:00
trop[bot]
a77a2ad64f fix: second argument to shell.writeShortcutLink is optional (#49503)
fix: second argument to shell.writeShortcutLink is optional

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-26 11:57:56 +01:00
trop[bot]
d582f1fbaa fix: avoid startup crash when V8 sandbox is disabled (#49504)
* fix: avoid startup crash when V8 sandbox is disabled

Co-authored-by: David Franco <davidfrsan@gmail.com>

* chore: update patch

Co-authored-by: David Franco <david@metrica-sports.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Franco <davidfrsan@gmail.com>
Co-authored-by: David Franco <david@metrica-sports.com>
2026-01-23 14:30:00 -05:00
trop[bot]
173d0d16dc fix: return early from platform_util::Beep() on Linux if there is no default GDK display (#49483)
fix: return early from beep on linux if there is no default gdk display

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-01-22 15:00:38 -05:00
trop[bot]
b244963d63 fix: potential devtools crash on empty (#49488)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-22 09:46:08 +01:00
trop[bot]
95417f9e46 docs: document that shell.trashItem requires backslashes (#49481)
docs: Update shell.md: Document that shell.trashItem requires backslashes

In Windows many functions relating to files (e.g. shell.openItem, the Node fs functions, as well as native Win32 APIs) will accept either type of slash / or \ as a folder separator.

shell.trashItem does not work with / as folder separator in Windows. This documentation change explains that.

See also:
https://github.com/electron/electron/issues/28831

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: sam marshall <s.marshall@open.ac.uk>
2026-01-21 14:51:12 -05:00
trop[bot]
5976fa394b docs: add a few API history fragments (#49478)
* docs: add a few API history fragments

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* manual fixes

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-01-21 13:12:06 -05:00
trop[bot]
5ed82c16e8 revert: use deprecated setAllowedFileTypes in macOS dialogs (#49470)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: remove stray import

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-21 17:57:39 +01:00
electron-roller[bot]
486a9a61d2 chore: bump chromium to 146.0.7635.0 (main) (#49408)
* chore: bump chromium in DEPS to 146.0.7635.0

* chore: update patch hunk headers

* 7078551: [wasm] Refactor caching API

https://chromium-review.googlesource.com/c/v8/v8/+/7078551

* 7141498: [api] Remove unused context parameter from FixedArray::Get

https://chromium-review.googlesource.com/c/v8/v8/+/7141498

* 7454865: Add timeouts to content API for CopyFromSurface

https://chromium-review.googlesource.com/c/chromium/src/+/7454865

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 15:37:02 +01:00
Niklas Wenzel
7851a34c2d docs: fix webContents.hostWebContents types (#49424) 2026-01-19 10:45:23 +01:00
Shelley Vohr
faa21a748f fix: MAS rejection for private APIs (#49391) 2026-01-18 10:34:16 +01:00
Shelley Vohr
5bd2938f6a fix: try clearing InspectableWebContents delegate earlier (#49406)
fix: try clearing InspectableWebContents delegate earlier
2026-01-16 21:36:34 +01:00
electron-roller[bot]
f149efe32e chore: bump node to v24.13.0 (main) (#49189)
* chore: bump node in DEPS to v24.12.0

* src: use CP_UTF8 for wide file names on win32

https://github.com/nodejs/node/pull/60575

* test,crypto: handle a few more BoringSSL tests

https://github.com/nodejs/node/pull/59030

* chore: fixup patch indices

* chore: re-add accidentally removed sslv23 test

* chore: fixup crypto patch rebase

* test: make buffer sizes 32bit-aware in test-internal-util-construct-sab

https://github.com/nodejs/node/pull/61026

* src: add internal binding for constructing SharedArrayBuffers

https://github.com/nodejs/node/pull/60497

* chore: bump node in DEPS to v24.13.0

* chore: fixup patch indices

* chore: fixup sandboxed pointers patch

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-16 11:08:38 -05:00
Daniel Gräfe
5dd509d2f4 fix: restore AXDocument accessibility attribute for representedFilename on macOS (#49346)
Starting from Chromium 134.0.6989.0 (Electron 35.0.0-beta.5), the
NativeWidgetMacNSWindow class overrides accessibilityDocument to return
the web content URL from the accessibility tree, but doesn't fall back
to NSWindow's default behavior when that URL is empty.

This broke Electron's setRepresentedFilename() API - the file path was
still set on the NSWindow, but no longer exposed via the AXDocument
accessibility attribute that screen readers use.

This fix adds an accessibilityDocument override in ElectronNSWindow that
checks representedFilename first, falling back to Chromium's behavior
for web content URLs.

Fixes: https://github.com/electron/electron/issues/XXXXX

Co-authored-by: Claude Opus 4.5 <noreply@anthropic.com>
2026-01-16 10:27:29 +01:00
Alex Schwartz
bdd7730a24 fix: make toplevel icon Wayland protocol work (#49290) 2026-01-16 09:55:52 +01:00
dependabot[bot]
060e76f1b6 build(deps): bump actions/upload-artifact from 5.0.0 to 6.0.0 (#49220)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](330a01c490...b7c566a772)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-16 09:55:38 +01:00
David Sanders
2fbf1f5c72 ci: detect patch needs update error with problem matcher (#49405) 2026-01-15 19:18:50 -08:00
Charles Kerr
c769361af2 fix: warning: default arguments on virtual or override methods (#49398)
fix: warning: default arguments on virtual or override methods are prohibited [google-default-arguments]

we never override these, so just make them nonvirtual
2026-01-15 16:09:43 -08:00
electron-roller[bot]
6ea7d6d5a4 chore: bump chromium to 146.0.7633.0 (main) (#49390)
* chore: bump chromium in DEPS to 146.0.7633.0

* chore: fixup patch indices

* chore: fix unsafe buffer usage in browser_linux.cc

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-15 10:52:42 -05:00
Charles Kerr
27b3a32307 chore: update patches (#49399) 2026-01-14 22:33:23 -08:00
Charles Kerr
ddeb970f18 refactor: make ReplyChannel inherit from gin::Wrappable (#49339)
* refactor: make ReplyChannel inherit from gin::Wrappable

* chore: add kElectronReplyChannel to chore_add_electron_objects_to_wrappablepointertag.patch

* fix: use gin::PerIsolateData::DisposeObserver

* fix: lifetime issues

* chore: rm perisolatedata hook in favor of prefinalizer

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-14 18:35:01 -06:00
electron-roller[bot]
5d80264944 chore: bump chromium to 145.0.7628.0 (main) (#49331)
* chore: bump chromium in DEPS to 145.0.7620.0

* chore: bump chromium in DEPS to 145.0.7622.0

* chore: bump chromium in DEPS to 145.0.7624.0

* chore: bump chromium in DEPS to 145.0.7626.0

* chore: bump chromium in DEPS to 145.0.7628.0

* 7362759: Migrate various base::Contains() to contains() in ui | https://chromium-review.googlesource.com/c/chromium/src/+/7362759

* chore: update patches

* 7411324: url: Mark deprecated functions as UNSAFE_BUFFER_USAGE

https://chromium-review.googlesource.com/c/chromium/src/+/7411324

* 7366867: Store property info in CSSParserLocalContext for random()

https://chromium-review.googlesource.com/c/chromium/src/+/7366867

* 7277406: Exclude PiP from getDisplayMedia picker thumbnails

https://chromium-review.googlesource.com/c/chromium/src/+/7277406

* 7253489: activity_reporter: Create stub module owned by browser_process

https://chromium-review.googlesource.com/c/chromium/src/+/7253489

* 7404514: Create device parental controls delegate

https://chromium-review.googlesource.com/c/chromium/src/+/7404514

* 7269504: Update histograms to use the updated MediaStreamRequestResult enum

https://chromium-review.googlesource.com/c/chromium/src/+/7269504

* fixup! 7253489: activity_reporter: Create stub module owned by browser_process

* 7368549: Reland "Use native rollup"

https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7368549

* 4803165: Enable suppressing input event dispatch while paint-holding.

https://chromium-review.googlesource.com/c/chromium/src/+/4803165

* chore: make device_parental_controls lazy

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-14 15:34:24 +01:00
Erick Zhao
dae76c2885 docs: remove stale example and standardize DevTools capitalization (#49321)
* docs: remove stale example and standardize `DevTools` capitalization

* Update docs/api/web-contents.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

---------

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>
2026-01-14 10:35:53 +01:00
Erick Zhao
a368c5da0c docs: improve build-tools instructions (#49294)
* docs: improve build-tools instructions

* address comments

* update directory structure

* update

* nits

* node -> electron_node

* update macos build version

* Update docs/development/build-instructions-gn.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-14 09:51:55 +01:00
Keeley Hammond
1b2679b315 fix: revert os_crypt async cookie provider implementation (#49382)
* Revert "fix: provide explicit cookie encryption provider for cookie encryption (#49348)"

This reverts commit 95f097a392.

* Revert "fix: fix cookie encryption provider loading on Windows and Linux (#49371)"

This reverts commit 0e4ee9f03a.

* revert: 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-14 09:34:00 +01:00
Shelley Vohr
15acf70760 build: roll build-image to a82b87d (#49377)
build: roll build-image to a82b87d
2026-01-13 12:13:14 +01:00
dependabot[bot]
324eb0eb1c build(deps): bump github/codeql-action from 4.31.7 to 4.31.10 (#49376)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.7 to 4.31.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cf1bb45a27...cdefb33c0f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-13 10:25:10 +01:00
Keeley Hammond
0e4ee9f03a fix: fix cookie encryption provider loading on Windows and Linux (#49371)
* fix: support cookie encryption provider cross-platform

* fix: add async macos key provider
2026-01-12 19:39:29 -08:00
Charles Kerr
ae94cefdba refactor: add static ReplyChannel::SendError() helper (#49338)
* refactor: add static void ReplyChannel::SendError()

* refactor: use static SendError() instead of instantiating a temporary

* refactor: remove non-static version of SendError()

* refactor: remove redundant callback-is-non-null checks
2026-01-12 17:02:58 -06:00
Shelley Vohr
409c29b12b build: roll build-tools SHA to 4430e4a (#49362)
build: roll build-tools SHA to 4430e4a
2026-01-12 12:22:30 -05:00
Shelley Vohr
b0e012f14e build: update on-create-command for siso (#49357) 2026-01-12 14:30:48 +01:00
Calvin
9a5ffd920c feat: suppress devtools console logging (#49292)
* feat: suppress devtools console logging

* Emit messages as-is in testing builds

* Promote `DCHECK_IS_ON()` to preprocessor check
2026-01-12 11:31:33 +01:00
Charles Kerr
cf2e283332 fix: clang-tidy warnings, pt. 1 (#49083)
* fix: google-readability-casting warning about the uint32_t cast

* fix: modernize-use-equals-default warnings

* fix: readability-redundant-member-init warning

* fix: modernize-make-unique warnings

* fix: modernize-use-emplace

warning: use emplace_back instead of push_back

* refactor: address code review feedback
2026-01-09 22:57:38 -08:00
Niklas Wenzel
d6a6312fc8 build: update NMV to 145 (#49349) 2026-01-09 18:14:18 -08:00
Keeley Hammond
95f097a392 fix: provide explicit cookie encryption provider for cookie encryption (#49348)
fix: provide explicit cookie encryption provider

Fixes 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-09 11:53:58 -08:00
Niklas Wenzel
b380755514 chore: remove stakeholders mention from PR template (#49317) 2026-01-09 00:36:40 -08:00
David Sanders
3985daa81c chore: improvements to script/run-clang-tidy.ts (#49335)
* chore: disable color output for clang-tidy in CI

* chore: small QoL improvements to run-clang-tidy.ts

* chore: add --fix option to script/run-clang-tidy.ts
2026-01-08 22:05:44 -08:00
Erick Zhao
5901d8a6d8 docs: document ELECTRON_SKIP_BINARY_DOWNLOAD (#49320) 2026-01-07 14:54:22 -08:00
electron-roller[bot]
eee60f202c chore: bump chromium to 145.0.7618.0 (main) (#49314)
* chore: bump chromium in DEPS to 145.0.7618.0

* 7399531: [GTK] Don't preselect file dialog accept buttons | https://chromium-review.googlesource.com/c/chromium/src/+/7399531

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-07 15:01:56 -05:00
Charles Kerr
b5a7d81c7d refactor: have GetXdgAppId() return a std::optional<std::string> (#49318)
* refactor: GetXdgAppId() now returns std::optional<std::string>

* refactor: slightly simplify app.setDesktopName() ts calls

* refactor: add better documentation for dekstop-entry in XDG notifications
2026-01-07 14:30:09 -05:00
dependabot[bot]
a89b2cd9bc build(deps): bump actions/download-artifact from 6.0.0 to 7.0.0 (#49221)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](018cc2cf5b...37930b1c2a)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-06 15:48:38 -05:00
Niklas Wenzel
44fa30695f docs: update roundedCorners documentation (#49195) 2026-01-05 16:27:46 -05:00
Niklas Wenzel
2ab56adbbd test: remove outdated disabled test (#49196) 2026-01-05 16:27:01 -05:00
electron-roller[bot]
a1f0ef80d4 chore: bump chromium to 145.0.7616.0 (main) (#49279)
* chore: bump chromium in DEPS to 145.0.7605.0

* chore: bump chromium in DEPS to 145.0.7606.0

* chore: bump chromium in DEPS to 145.0.7608.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7610.0

* chore: update patches

* [InputVizard] Fix missing touch cancel in InputTransferHandlerAndroid
using InputEventSource

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7302368

* chore: bump chromium in DEPS to 145.0.7611.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7614.0

* chore: bump chromium in DEPS to 145.0.7615.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7616.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-05 13:34:36 -05:00
dependabot[bot]
c1a031be83 build(deps): bump actions-cool/issues-helper from 3.7.3 to 3.7.5 (#49282)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.3 to 3.7.5.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](3809910bc1...e2ff99831a)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-05 12:26:03 -05:00
John Kleinschmidt
c8bb700509 build: fixup release notes generation (#49302) 2026-01-05 11:11:40 -05:00
Calvin
46922de638 fix: drag regions in child windows (#49231)
* fix: drag regions in child windows

* Update comments
2026-01-05 10:34:01 -05:00
Niklas Wenzel
75ea93a279 chore: remove quiet period mention from PR template (#49298) 2026-01-05 10:12:07 -05:00
John Kleinschmidt
ace0beaa3f build: add logging to notes generator (#49300) 2026-01-05 09:49:51 -05:00
electron-roller[bot]
9eb43f3286 chore: bump chromium to 145.0.7604.0 (main) (#49265)
* chore: bump chromium in DEPS to 145.0.7599.0

* chore: bump chromium in DEPS to 145.0.7600.0

* chore: bump chromium in DEPS to 145.0.7602.0

* chore: bump chromium in DEPS to 145.0.7604.0

* chore: update patches (trivial only)

* [bytesize] Migrate network data in Task Manager to ByteSize.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/7266090

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-28 20:40:50 -08:00
electron-roller[bot]
809ab09b6f chore: bump chromium to 145.0.7596.0 (main) (#49224)
* chore: bump chromium in DEPS to 145.0.7588.0

* fix(patch-conflict): update scroll_bounce_flag for split overscroll methods

Chromium split IsElasticOverscrollEnabled() into two methods:
IsElasticOverscrollEnabledOnRoot() and IsElasticOverscrollSupported().
Updated patch to apply the scroll-bounce command-line switch to both
methods.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7233733

* fix(patch-conflict): update exclusive_access patch context

Upstream refactored the profile variable declaration. Updated patch to
match new surrounding context with brace-style if statement.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239252

* fix(patch-conflict): update screen capture kit non-shareable filter

Upstream refactored PiP window exclusion to use GetWindowsToExclude()
helper function. Updated patch to combine non-shareable window filtering
with the new helper's output.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7274596

* fix(patch-conflict): update corner smoothing CSS property id position

Upstream added new internal overscroll CSS properties. Updated patch to
add kElectronCornerSmoothing after the new entries.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234051

* fix(patch-conflict): update permission patches for new permission types

Upstream added new permission types: LOCAL_NETWORK, LOOPBACK_NETWORK,
and GEOLOCATION_APPROXIMATE. Updated Electron permission patches to
include these new types and renumber Electron-specific permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7231952

* fix(patch-conflict): update memory query fallback for new function signature

Upstream added AmountOfTotalPhysicalMemory() with PCHECK. Updated patch
to maintain fallback logic with correct ByteSize return type.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254886

* chore: update patch hunk headers

* fix(patch): update reclient-configs patch to use new file mode

The fix_add_python_remote_wrapper patch was using 'copy from' mode
which caused inconsistent behavior between local and CI git versions.
Changed to 'new file' mode for consistent patch application.

* fix(patch-conflict): remove duplicate GEOLOCATION_APPROXIMATE case

Upstream moved GEOLOCATION_APPROXIMATE earlier in the switch statement
in GetPermissionString(). The 3-way merge kept both the old and new
positions, causing a duplicate case error.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6397637

* chore: update libcxx filenames for new headers

* chore: bump chromium in DEPS to 145.0.7590.0

* chore: update patch hunk headers

* fix(patch): update memory fallback return type to ByteSize

Upstream changed the return type from ByteCount to ByteSize.

* fix: suppress nodiscard warning in node_file.cc

libc++ added [[nodiscard]] to std::filesystem::copy_options operator|=
which causes build failures with -Werror.

* 7229082: update CopyFromSurface to use CopyFromSurfaceResult

Upstream changed CopyFromSurface callback to return
base::expected<viz::CopyOutputBitmapWithMetadata, std::string>
instead of SkBitmap, enabling better error handling.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7229082

* 7254070: add ip_address_space param to OnLocalNetworkAccessPermissionRequired

Upstream added IPAddressSpace parameter to check address space for
proper permission handling in Local Network Access.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254070

* 7136679: add spelling_markers param to RequestCheckingOfText

Upstream added spelling_markers parameter to report misspelling
ranges from Blink to Spellcheck to IME.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7136679

* 7240487: remove second param from RegisterWebSafeIsolatedScheme

Upstream removed the schemes_okay_to_appear_as_origin_headers_ parameter.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7240487

* 7254577: use explicit WebElement constructor

WebElement default constructor now requires explicit construction
rather than brace initialization.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254577

* 7256335: remove override from CreateGlobalFeaturesForTesting

Upstream removed BrowserProcess::CreateGlobalFeaturesForTesting virtual
method so the override specifier is no longer valid.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7256335

* chore: add missing SingleThreadTaskRunner include

A transitive include of SingleThreadTaskRunner was removed upstream,
requiring an explicit include.

Ref: Unable to locate specific CL (transitive include change)

* 7260483: add LOCAL_NETWORK, LOOPBACK_NETWORK permission type cases

Upstream added new permission types for Local Network Access split
permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7260483

* chore: update patch hunk headers

* 7264893: update postMessage tests for file: origin serialization change

Chromium now serializes file: origins as 'null' in MessageEvent per spec.
This is a security improvement aligning with the HTML spec behavior.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893

* fix: add paths to custom scheme URLs in protocol tests

Custom scheme URLs without paths (e.g. test-scheme://foo) cause a
DCHECK crash in ASAN builds when CorsURLLoader tries to log the
request via GenerateRequestLine -> PathForRequest, which asserts
that the path is non-empty.

Adding trailing slashes ensures URLs have valid paths.

* chore: bump chromium in DEPS to 145.0.7592.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 145.0.7594.0

* chore: bump chromium in DEPS to 145.0.7596.0

* chore: update accelerator.patch

no manual changes; patch applied with fuzz 2 (offset 1 line)

* chore: update patches (trivial only)

* chore: node ./script/gen-libc++-filenames.js

---------

Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-25 17:15:53 -06:00
Samuel Attard
3df3a6a736 fix: webRequest.onBeforeSendHeaders not being able to modify reserved headers (#49226)
* fix: `webRequest.onBeforeSendHeaders` not being able to modify reserved headers

* chore: add unit test for reserved header
2025-12-19 23:08:40 +13:00
Samuel Attard
7433c14af5 chore: add CLAUDE.md and Chromium Upgrade claude skill (#49229)
* chore: add CLAUDE.md and Chromium Upgrade claude skill

* Update script/lint.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-12-19 13:07:58 +13:00
electron-roller[bot]
a90ccc753b chore: bump chromium to 145.0.7577.0 (main) (#49175)
* chore: bump chromium in DEPS to 145.0.7572.0

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Polished the edits and formatted the result. No real changes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7232079 "7232079: Use WindowsToExclude to exclude PiP window in macOS screencapture device"

* chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7214586 "7214586: Refactor SelectFileDialogLinuxPortal to request XDG portal on demand"
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910 "7237910: Remove g_gtk_ui global"

* 7228586: Migrate SystemMemoryInfo from ByteCount to ByteSize

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7228586

* 7207583: GlobalRenderFrameHostId to ChildProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7207583

* 7205548: Remove uses of BodyAsStringCallbackDeprecated (extensions/)

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7205548

* chore: bump chromium in DEPS to 145.0.7574.0

* chore: update libc++ filenames

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7246150 "7246150: Fix crash in ScreenCaptureKitDeviceMac due to null PIPScreenCaptureCoordinator"

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* fixup! chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

* 7239572: [OOPIF PDF] Enable OOPIF PDF by default on Windows/macOS/Linux

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239572

* chore: bump chromium in DEPS to 145.0.7576.0

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* chore: update patches (trivial only)

* chore: add note to keep patch that was upstreamed but reverted

fix_restore_original_resize_performance_on_macos.patch was organically upstreamed but that change got reverted just after the current roll's cutoff.

I've added a note in the patch contents so the patch sticks around and so we can keep it after the revert is included.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* chore: bump chromium in DEPS to 145.0.7577.0

* chore: update patches (trivial only)

* chore(patch-conflict): keep patch after revert

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* 7237910: Remove g_gtk_ui global

I tried to find a way to avoid the patch, but other approaches seemed complex and involved.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910

* 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7251900

* 7170174: [LNA] Retry requests for cached local resources

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7170174

* fix: PDFs use OOPIF (behavior change)

* fixup! 7237910: Remove g_gtk_ui global

* fixup! 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-16 12:32:38 -05:00
John Kleinschmidt
e181fd040f build: drop dugite as a dependency (#49194) 2025-12-12 13:43:12 -05:00
David Sanders
a486185e10 ci: disallow non-maintainer changes to Yarn files (#49186) 2025-12-11 09:25:29 -05:00
John Kleinschmidt
8cefc8425c build: upgrade yarn to 4.12.0 (#49176) 2025-12-10 14:04:14 -05:00
electron-roller[bot]
fe477ce3aa chore: bump chromium to 145.0.7568.0 (main) (#49145)
* chore: bump chromium in DEPS to 145.0.7562.0

* fix(patch-conflict): update code cache patch for PersistentCache refactor

Upstream refactored code cache to use PersistentCache with new class-based
implementation (NoopCodeCacheHost, LocalCodeCacheHost, CodeCacheWithPersistentCacheHost).
Updated patch to integrate custom scheme support into the new structure while
preserving ProcessLockURLIsCodeCacheScheme checks for embedder-registered schemes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7044986

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update dialog patch for RequestXdgDesktopPortal API

Upstream changed from SetSystemdScopeUnitNameForXdgPortal to RequestXdgDesktopPortal
API pattern. Updated OnServiceStarted signature and kept OnSystemdUnitStarted callback
that calls Electron's file_dialog::StartPortalAvailabilityTestInBackground().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7204285

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): remove reference to deleted AbortByPlaceholderLayout flag

Upstream removed the AbortByPlaceholderLayout runtime flag from
runtime_enabled_features.json5. Updated patch to only add ElectronCSSCornerSmoothing
without the removed flag reference.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7226494

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): guard media_file_system_registry for ChromeOS only

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7100719
moved media_file_system_registry to be ChromeOS-only since Media
Galleries is a Chrome Apps API and Chrome Apps are only available
on Chrome OS now.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): update VideoPixelFormat API for SharedImageFormat

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7207153
removed VideoPixelFormatToGfxBufferFormat as part of migration to
SharedImageFormat. Update to use VideoPixelFormatToSharedImageFormat
which directly returns the SharedImageFormat.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): extend profile methods patch for ShouldEnableXfaForms

The ShouldEnableXfaForms function uses Profile::FromBrowserContext()
which is not available in Electron. Wrap the profile-dependent code
in #if 0 to fall through to the feature flag default.

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: bump chromium in DEPS to 145.0.7563.0

* chore: bump chromium in DEPS to 145.0.7565.0

* chore: bump chromium in DEPS to 145.0.7567.0

* chore: bump chromium in DEPS to 145.0.7568.0

* fix(patch-conflict): update content_main_delegate.h context for IsInitFeatureListEarly

Upstream added a new IsInitFeatureListEarly() virtual method to ContentMainDelegate
just before where our GetBrowserV8SnapshotFilename() method is added. Updated patch
context to account for this new method.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-update): include v8-cppgc.h for CppHeap complete type

The std::unique_ptr<v8::CppHeap> default argument in node.h requires
the complete CppHeap type definition for the destructor. Added the
v8-cppgc.h include to provide the full type definition.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): move NativeAppWindowFrameViewMacClient before constructor

The std::unique_ptr<NativeAppWindowFrameViewMacClient> member requires
the complete type definition to be visible at the point of the constructor
because the unique_ptr destructor may be instantiated during exception
handling. Moved the class definition before the NativeWindowMac constructor.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update create_browser_v8_snapshot_file_name_fuse context for IsInitFeatureListEarly

The upstream added IsInitFeatureListEarly() virtual method declaration to
ContentMainDelegate class. Updated the patch context to account for this
new function being present before the GetBrowserV8SnapshotFilename()
declaration we add.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-update): remove reverted IsInitFeatureListEarly from v8 snapshot patch

The upstream added IsInitFeatureListEarly() was reverted, so the patch should
not include this declaration. Only GetBrowserV8SnapshotFilename() should be
added by the create_browser_v8_snapshot_file_name_fuse patch.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7230430

Co-Authored-By: Claude <noreply@anthropic.com>

* 6171655: include single_thread_task_runner.h for complete type

Added include for base/task/single_thread_task_runner.h in osr_converter.cc
to resolve incomplete type error when using
base::SingleThreadTaskRunner::GetCurrentDefault().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6171655

Co-Authored-By: Claude <noreply@anthropic.com>

* 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

Upstream removed GetChromiumGitRevision() function from embedder_support.
Updated to use CHROMIUM_GIT_REVISION macro directly via
build/util/chromium_git_revision.h as recommended in the Chromium CL.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7224136

Co-Authored-By: Claude <noreply@anthropic.com>

* fixup! 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

* fix(build): add missing include

`components/dbus/xdg/systemd.h` for `void OnSystemdUnitStarted(dbus_xdg::SystemdUnitStatus)` in the same patch.

* fix(build): adapt to string-view-ification change in windows jump_list.cc

7186922: Fix unsafe buffer usage in base/win/win_util.cc
https://chromium-review.googlesource.com/c/chromium/src/+/7186922

* chore: update libc++ filenames

* fixup! fix(build): add missing include

* fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

* fixup! fix(build): guard media_file_system_registry for ChromeOS only

* fixup! fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-10 10:28:31 -05:00
John Kleinschmidt
bab6bd3dae build: use @electron-ci/dev-root for package.json default (#49154) 2025-12-09 14:49:12 -05:00
dependabot[bot]
33f6942565 build(deps): bump actions/stale from 10.1.0 to 10.1.1 (#49159)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.0 to 10.1.1.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5f858e3efb...997185467f)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:50 -05:00
dependabot[bot]
a1b2e82778 build(deps): bump actions-cool/issues-helper from 3.7.2 to 3.7.3 (#49157)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.2 to 3.7.3.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](9861779a69...3809910bc1)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:13 -05:00
dependabot[bot]
1e06b74cd2 build(deps): bump github/codeql-action from 4.31.6 to 4.31.7 (#49155)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.6 to 4.31.7.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fe4161a26a...cf1bb45a27)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.7
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:15:08 -05:00
dependabot[bot]
fe0caa0e0d build(deps): bump actions/checkout from 6.0.0 to 6.0.1 (#49158)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.0 to 6.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](1af3b93b68...8e8c483db8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:14:41 -05:00
dependabot[bot]
cd48083be8 build(deps): bump actions/setup-node from 6.0.0 to 6.1.0 (#49156)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.0.0 to 6.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](2028fbc5c2...395ad32622)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:13:56 -05:00
John Kleinschmidt
8d5b104c17 build: upgrade github-app-auth to 3.2.0 (#49152) 2025-12-09 09:49:37 -05:00
John Kleinschmidt
6e134a8ad9 build: use powershell for Electron build step (#49144) 2025-12-08 16:03:40 -05:00
electron-roller[bot]
95e87e46ab chore: bump chromium to 144.0.7547.0 (main) (#49058)
* chore: bump chromium in DEPS to 144.0.7543.0

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

* chore: update patches

* chore: update filenames.libcxx.gni

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

* chore: bump chromium in DEPS to 144.0.7545.0

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7547.0

* chore: update patches

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

* fixup Add support for UnownedUserData in GlobalFeatures

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

* fixup BUILD.gn for lint

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

* chore: skip setting LPAC ACLs

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <70381+ckerr@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Samuel Attard <MarshallOfSound@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-12-04 16:40:04 -08:00
Jan Hannemann
90e338df50 fix: run toast creation on background thread (#49106)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

* fix: comments
2025-12-02 15:27:22 -08:00
dependabot[bot]
1b3fc9c174 build(deps): bump actions/checkout from 4.2.2 to 6.0.0 (#49125)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.2.2...1af3b93b6815bc44a9784bd300feb67ff0d1eeb3)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:02:06 -05:00
dependabot[bot]
c51018281f build(deps): bump github/codeql-action from 4.31.5 to 4.31.6 (#49124)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.5 to 4.31.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fdbfb4d275...fe4161a26a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:01:21 -05:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
Keeley Hammond
c7aa0b537d chore: cherry-pick ec6c18478382 from v8 (#48335)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches
2025-09-16 19:08:15 -07:00
Robo
048d620701 fix: remove unneeded handlescope from JS callbacks (#48318)
fix: remove handlescope from JS callbacks
2025-09-16 06:56:38 +09:00
Charles Kerr
15cdae1cf0 refactor: make api::NetLog inherit from gin::Wrappable (#48308)
* refactor: remove unused v8::Isolate* arg from NetLog ctor

* refactor: allocate api::NetLog on cpp heap

* refactor: make electron::api::Session::net_log_ a cppgc::Member<api::NetLog>

* refactor: remove unnecessary EscapableHandleScope

* chore: code style consistency
2025-09-16 06:29:46 +09:00
Shelley Vohr
bac383c219 feat: add fileSystem to ses.setPermissionCheckHandler (#48170)
feat: add fileSystem to ses.setPermissionCheckHandler
2025-09-15 17:00:58 -04:00
John Kleinschmidt
49eb165ef9 ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48319)
cleanup
2025-09-15 16:31:49 -04:00
Charles Kerr
a468ed7f10 refactor: narrow or remove gin arguments (#48300)
* refactor: narrow App:SetJumpList() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow WebContents::AddWorkSpace() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowMessageBox() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowOpenDialog() arg from gin::Arguments* to v8::Isolate*

* refactor: remove unused gin::Arguments* arg from OverrideGlobalPropertyFromIsolatedWorld()

* refactor: narrow WebContents::StartDrag() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow NetLog::StopLogging() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow Protocol::IsProtocolHandled() arg from gin::Arguments* to v8::Isolate*
2025-09-13 08:19:07 +09:00
Calvin
5444738721 fix: set ozone platform for wayland (#48301)
* fix: set ozone platform for wayland

* whoops, includes. thx charles
2025-09-13 08:17:06 +09:00
Charles Kerr
a6959ca97b refactor: allocate api::Debugger on cpp heap (#48266)
* refactor: remove unused isolate arg from Debugger ctor

* refactor: make Debugger ctor, dtor public

needed for cppgc::MakeGarbageCollected()

This is what upstream does, e.g. https://chromium-review.googlesource.com/c/chromium/src/+/6722236

* fixup! refactor: remove unused isolate arg from Debugger ctor

mark Debugger ctor as explicit

* refactor: in EventEmitterMixin, handle both old and new WrapperInfo types

* refactor: make electron::api::Debugger inherit from gin::Wrappable

* refactor: add api::Debugger::GetTypeName()

* refactor: add api::Debugger::GetClassName()
2025-09-11 16:03:17 -04:00
dependabot[bot]
45353ae38c build(deps): bump actions/setup-node from 4.4.0 to 5.0.0 (#48282)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.4.0 to 5.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](49933ea528...a0853c2454)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 21:35:54 -05:00
Charles Kerr
f702327dce refactor: avoid unused inheritance in ServiceWorkerMain (#48279)
ServiceWorkerMain does not need to inherit from EventEmitterMixin
2025-09-10 11:16:35 -05:00
dependabot[bot]
fda3a3d493 build(deps): bump github/codeql-action from 3.29.11 to 3.30.1 (#48283)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.11 to 3.30.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3c3833e0f8...f1f6e5f6af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 09:47:34 -05:00
Michaela Laurencin
dae5dad167 docs: update release timeline for unsupported v35 (#48285) 2025-09-09 15:03:48 -07:00
John Kleinschmidt
940ebb6c7a chore: update patches (#48278) 2025-09-08 15:44:47 -04:00
electron-roller[bot]
793565e4be chore: bump chromium to 141.0.7390.7 (main) (#48212)
* chore: bump chromium in DEPS to 141.0.7381.3

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7382.0

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7384.0

* chore: bump chromium in DEPS to 141.0.7386.0

* [Extensions] Move devtools_page and chrome_url_overrides handlers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6862700

* Reland "[api] Advance deprecation of GetIsolate"

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6875273

* Move "system integrated UI" concept out of NativeTheme.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6867375

* chore: update patches

* Reland "[PermissionOptions] Return PermissionResult in callback for requests"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6851838

* Reland "[exit-time-destructors] Enable by default"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update patches

* [FSA] Revoke Read access after removing file via FileSystemAccess API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6677249

* chore: IWYU

* [DevToolsUIBindings] Accept an object for `dispatchHttpRequest` params

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6877528

* chore: IWYU

* Pass navigation UI parameters on EnterFullscreen in EAM

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6874923

* chore: rm band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch

* Remove unused PreHandleMouseEvent

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6880411

* 6878583: siso: update to version 1.4.1

https://chromium-review.googlesource.com/c/chromium/src/+/6878583

* Fold native_theme_browser into native_theme.

https://chromium-review.googlesource.com/c/chromium/src/+/6882627

* fixup: Reland "[exit-time-destructors] Enable by default

https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update filenames.libcxx.gni

* chore: IWYU

* fixup: chore: IWYU

* fixup: Reland "[exit-time-destructors] Enable by default

* fixup: Reland "[exit-time-destructors] Enable by default

* Remove common_theme.*; place its method in NativeTheme instead.

https://chromium-review.googlesource.com/c/chromium/src/+/6886029

* fixup: Reland "[exit-time-destructors] Enable by default

* Better track when WebPreferences need updates for color-related changes.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6886797

* chore: bump chromium in DEPS to 141.0.7390.7

* 6904664: Reland "Make BrowserContext::GetPath() const"

https://chromium-review.googlesource.com/c/chromium/src/+/6904664

* Restore read access after certain file modification operations

https://chromium-review.googlesource.com/c/chromium/src/+/6861041

* fixup: Move "system integrated UI" concept out of NativeTheme.

* fixup: Reland "[exit-time-destructors] Enable by default

* chore: update patches

* 6906096: Remove GetSysSkColor().

https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* Inline implementation of SysColorChangeListener into the lone user.

https://chromium-review.googlesource.com/c/chromium/src/+/6905083

Also 6906096: Remove GetSysSkColor(). | https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* fixup: 6906096: Remove GetSysSkColor()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-08 12:57:15 +02:00
electron-roller[bot]
1f322ebce3 chore: bump node to v22.19.0 (main) (#48222)
* chore: bump node in DEPS to v22.19.0

* chore: fixup patch indices

* crypto: add tls.setDefaultCACertificates()

https://github.com/nodejs/node/pull/58822

* esm: js-string Wasm builtins in ESM Integration

https://github.com/nodejs/node/pull/59179

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-05 17:16:45 -04:00
Samuel Attard
f009e077f2 build: update spec deps for clean audit (#48238) 2025-09-03 15:05:49 -04:00
910 changed files with 45234 additions and 22029 deletions

1
.claude/.gitignore vendored Normal file
View File

@@ -0,0 +1 @@
settings.local.json

24
.claude/settings.json Normal file
View File

@@ -0,0 +1,24 @@
{
"permissions": {
"allow": [
"Bash(e sync)",
"Bash(e patches --list-targets:*)",
"Bash(git add:*)",
"Bash(git am:*)",
"Bash(git commit:*)",
"Bash(git log:*)",
"Bash(git show:*)",
"Bash(e patches:*)",
"Bash(e sync:*)",
"Skill(electron-chromium-upgrade)",
"Read(*)",
"Bash(echo:*)",
"Bash(e build:*)",
"Bash(tee:*)",
"Bash(git diff:*)",
"Bash(git rev-parse:*)"
],
"deny": [],
"ask": []
}
}

View File

@@ -0,0 +1,199 @@
---
name: electron-chromium-upgrade
description: Guide for performing Chromium version upgrades in the Electron project. Use when working on the roller/chromium/main branch to fix patch conflicts during `e sync --3`. Covers the patch application workflow, conflict resolution, analyzing upstream Chromium changes, and proper commit formatting for patch fixes.
---
# Electron Chromium Upgrade: Phase One
## Summary
Run `e sync --3` repeatedly, fixing patch conflicts as they arise, until it succeeds. Then run `e patches all` and commit changes atomically.
## Success Criteria
Phase One is complete when:
- `e sync --3` exits with code 0 (no patch failures)
- `e patches all` has been run to export all changes
- All changes are committed per the commit guidelines below
Do not stop until these criteria are met.
**CRITICAL** Do not delete or skip patches unless 100% certain the patch is no longer needed. Complicated conflicts or hard to resolve issues should be presented to the user after you have exhausted all other options. Do not delete the patch just because you can't solve it.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (where most patches apply)
- `patches/`: Patch files organized by target
- `docs/development/patches.md`: Patch system documentation
## Workflow
1. Delete the `.git/rr-cache` in both the `electron` and `..` folder to ensure no accidental rerere replays occur from before this upgrade phase attempt started
2. Run `e sync --3` (the `--3` flag enables 3-way merge, always required)
3. If succeeds → skip to step 6
4. If patch fails:
- Identify target repo and patch from error output
- Analyze failure (see references/patch-analysis.md)
- Fix conflict in target repo's working directory
- Run `git am --continue` in affected repo
- Repeat until all patches for that repo apply
- IMPORTANT: Once `git am --continue` succeeds you MUST run `e patches {target}` to export fixes
- Return to step 1
5. When `e sync --3` succeeds, run `e patches all`
6. **Read `references/phase-one-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
Before committing any Phase One changes, you MUST read `references/phase-one-commit-guidelines.md` and follow its instructions exactly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e sync --3` | Clone deps and apply patches with 3-way merge |
| `git am --continue` | Continue after resolving conflict (run in target repo) |
| `e patches {target}` | Export commits from target repo to patch files |
| `e patches all` | Export all patches from all targets |
| `e patches --list-targets` | List targets and config paths |
## Patch System Mental Model
```
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
## When to Edit Patches
| Situation | Action |
|-----------|--------|
| During active `git am` conflict | Fix in target repo, then `git am --continue` |
| Modifying patch outside conflict | Edit `.patch` file directly |
| Creating new patch (rare, avoid) | Commit in target repo, then `e patches {target}` |
Fix existing patches 99% of the time rather than creating new ones.
## Patch Fixing Rules
1. **Preserve authorship**: Keep original author in TODO comments (from patch `From:` field)
2. **Never change TODO assignees**: `TODO(name)` must retain original name
3. **Update descriptions**: If upstream changed (e.g., `DCHECK``CHECK_IS_TEST`), update patch commit message to reflect current state
## Final Deliverable
After Phase One, write a summary of every change: what was fixed, why, reasoning, and Chromium CL links.
# Electron Chromium Upgrade: Phase Two
## Summary
Run `e build -k 999` repeatedly, fixing build issues as they arise, until it succeeds. Then run `e start --version` to validate Electron launches and commit changes atomically.
Run Phase Two immediately after Phase One is complete.
## Success Criteria
Phase Two is complete when:
- `e build -k 999` exits with code 0 (no build failures)
- `e start --version` has been run to check Electron launches
- All changes are committed per the commit guidelines below
Do not stop until these criteria are met. Do not delete code or features, never comment out code in order to take short cut. Make all existing code, logic and intention work.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions. Chromium APIs frequently are renamed or refactored. In every case the code in Electron must be updated to account for the change in Chromium, strongly avoid making changes to the code in chromium to fix Electrons build.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (do not touch this code to fix build issues, just read it to obtain context)
## Workflow
1. Run `e build -k 999` (the `-k 999` flag is a flag to ninja to say "do not stop until you find that many errors" it is an attempt to get as much error
context as possible for each time we run build)
2. If succeeds → skip to step 6
3. If build fails:
- Identify underlying file in "electron" from the compilation error message
- Analyze failure
- Fix build issue by adapting Electron's code for the change in Chromium
- Run `e build -t {target_that_failed}.o` to build just the failed target we were specifically fixing
- You can identify the target_that_failed from the failure line in the build log. E.g. `FAILED: 2e506007-8d5d-4f38-bdd1-b5cd77999a77 "./obj/electron/chromium_src/chrome/process_singleton_posix.o" CXX obj/electron/chromium_src/chrome/process_singleton_posix.o` the target name is `obj/electron/chromium_src/chrome/process_singleton_posix.o`
- **Read `references/phase-two-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
- Return to step 1
4. **CRITICAL**: After ANY commit (especially patch commits), immediately run `git status` in the electron repo
- Look for other modified `.patch` files that only have index/hunk header changes
- These are dependent patches affected by your fix
- Commit them immediately with: `git commit -am "chore: update patch hunk headers"`
- This prevents losing track of necessary updates
5. Return to step 1
6. When `e build` succeeds, run `e start --version`
7. Check if you have any pending changes in the Chromium repo by running `git status`
- If you have changes follow the instructions below in "A. Patch Fixes" to correctly commit those modifications into the appropriate patch file
Before committing any Phase Two changes, you MUST read `references/phase-two-commit-guidelines.md` and follow its instructions exactly.
## Build Error Detection
When monitoring `e build -k 999` output, filter for errors using this regex pattern:
error:|FAILED:|fatal:|subcommand failed|build finished
The build output is extremely verbose. Filtering is essential to catch errors quickly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e build -k 999` | Builds Electron and won't stop until either all targets attempted or 999 errors found |
| `e build -t {target}.o` | Build just one specific target to verify a fix |
| `e start --version` | Validate Electron launches after successful build |
## Two Types of Build Fixes
### A. Patch Fixes (for files in chromium_src or patched Chromium files)
When the error is in a file that Electron patches (check with `grep -l "filename" patches/chromium/*.patch`):
1. Edit the file in the Chromium source tree (e.g., `/src/chrome/browser/...`)
2. Create a fixup commit targeting the original patch commit:
```bash
cd .. # to chromium repo
git add <modified-file>
git commit --fixup=<original-patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
3. Export the updated patch: e patches chromium
4. Commit the updated patch file in the electron repo following the `references/phase-one-commit-guidelines.md`, then commit changes following those instructions exactly. **READ THESE GUIDELINES BEFORE COMMITTING THESE CHANGES**
To find the original patch commit to fixup: `git log --oneline | grep -i "keyword from patch name"`
The base commit for rebase is the Chromium commit before patches were applied. Find it by checking the `refs/patches/upstream-head` ref.
B. Electron Code Fixes (for files in shell/, electron/, etc.)
When the error is in Electron's own source code:
1. Edit files directly in the electron repo
2. Commit directly (no patch export needed)
Dependent Patch Updates
IMPORTANT: When you modify a patch, other patches that apply to the same file may have their hunk headers invalidated. After committing a patch fix:
1. Run git status in the electron repo
2. Look for other modified .patch files with just index/hunk header changes
3. Commit these with: git commit -m "chore: update patch hunk headers"
# Critical: Read Before Committing
- Before ANY Phase One commits: Read `references/phase-one-commit-guidelines.md`
- Before ANY Phase Two commits: Read `references/phase-two-commit-guidelines.md`
# Skill Directory Structure
This skill has additional reference files in `references/`:
- patch-analysis.md - How to analyze patch failures
- phase-one-commit-guidelines.md - Commit format for Phase One
- phase-two-commit-guidelines.md - Commit format for Phase Two
Read these when referenced in the workflow steps.

View File

@@ -0,0 +1,69 @@
# Analyzing Patch Failures
## Investigation Steps
1. **Read the patch file** at `patches/{target}/{patch_name}.patch`
2. **Examine current state** of the file in Chromium at mentioned line numbers
3. **Check recent upstream changes:**
```bash
cd .. # or relevant target repo
git log --oneline -10 -- {file}
```
4. **Find Chromium CL** in commit messages:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/{CL_NUMBER}
```
## Common Failure Patterns
| Pattern | Cause | Solution |
|---------|-------|----------|
| Context lines don't match | Surrounding code changed | Update context in patch |
| File not found | File renamed/moved | Update patch target path |
| Function not found | Refactored upstream | Find new function name |
| `DCHECK` → `CHECK_IS_TEST` | Macro change | Update to new macro |
| Deleted code | Feature removed | Verify patch still needed |
## Using Git Blame
To find the CL that changed specific lines:
```bash
cd ..
git blame -L {start},{end} -- {file}
git log -1 {commit_sha} # Look for Reviewed-on: line
```
## Verifying Patch Necessity
Before deleting a patch, verify:
1. The patched functionality was intentionally removed upstream
2. Electron doesn't need the patch for other reasons
3. No other code depends on the patched behavior
When in doubt, keep the patch and adapt it.
## Phase Two: Build-Time Patch Issues
Sometimes patches that applied successfully in Phase One cause build errors in Phase Two. This can happen when:
1. **Incomplete types**: A patch disables a header include, but new upstream code uses the type
2. **Missing members**: A patch modifies a class, but upstream added new code referencing the original
### Finding Which Patch Affects a File
```bash
grep -l "filename.cc" patches/chromium/*.patch
```
Matching Existing Patch Patterns
When fixing build errors in patched files, examine the existing patch to understand its style:
- Does it use #if 0 / #endif guards?
- Does it use #if BUILDFLAG(...) conditionals?
- What's the pattern for disabled functionality?
Apply fixes consistent with the existing patch style.

View File

@@ -0,0 +1,52 @@
# Phase One Commit Guidelines
Only follow these instructions if there are uncommitted changes to `patches/` after Phase One succeeds.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Atomic Commits
For each fix made to a patch, create a separate commit:
```
fix(patch-conflict): {concise title}
{Brief explanation, 1-2 paragraphs max}
Ref: {Chromium CL link}
```
IMPORTANT: Ensure that any changes made to patch content as a result of a change in Chromium is committed individually. Each change should have it's own commit message and it's own REF.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
## Finding CL References
Use `git log` or `git blame` on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Final Cleanup
After all fix commits, stage remaining changes:
```bash
git add patches
git commit -m "chore: update patch hunk headers"
```
## Example Commit
```
fix(patch-conflict): update web_contents_impl.cc context for navigation refactor
The upstream navigation code was refactored to use NavigationRequest directly
instead of going through NavigationController. Updated surrounding context
to match new code structure.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/1234567
```

View File

@@ -0,0 +1,82 @@
# Phase Two Commit Guidelines
Only follow these instructions if there are uncommitted changes in the Electron repo after any fixes are made during Phase Two that result a target that was failing, successfully building.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Two Commit Types
### For Electron Source Changes (shell/, electron/, etc.)
```
{CL-Number}: {concise description of API change}
{Brief explanation of what upstream changed and how Electron was adapted}
Ref: {Chromium CL link}
```
IMPORTANT: Ensure that any change made to electron as a result of a change in Chromium is committed individually. Each change should have it's own commit message and it's own REF. Logically grouped into commits that make sense rather than one giant commit.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
You may include multiple "Ref" links if required.
For a CL link in the format `https://chromium-review.googlesource.com/c/chromium/src/+/2958369` the "CL-Number" is `2958369`
### For Patch Updates (patches/chromium/*.patch)
Use the same fixup workflow as Phase One:
1. Fix in Chromium source tree
2. Fixup commit + rebase
3. Export with `e patches chromium`
4. Commit the patch file:
```
fix(patch-update): {concise description}
{Brief explanation}
Ref: {Chromium CL link}
```
## Dependent Patch Header Updates
After any patch modification, check for other affected patches:
```bash
git status
# If other .patch files show as modified with only hunk header changes:
git add patches/
git commit -m "chore: update patch hunk headers"
```
## Finding CL References
Use git log or git blame on Chromium source files. Look for:
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
If no CL found after searching: Ref: Unable to locate CL
## Example Commits
### Electron Source Fix
fix: update GetPlugins to GetPluginsAsync for API change
The upstream Chromium API changed:
- Old: GetPlugins(callback) - took a callback
- New: GetPluginsAsync(callback) - async version takes a callback
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/1234567
### Patch Fix
fix(patch-conflict): update picture-in-picture for gesture handling refactor
Upstream added new gesture handling code that accesses live caption dialog.
The live caption functionality is disabled in Electron's patch, so wrapped
the new code in #if 0 guards to match existing pattern.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7654321

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -48,7 +48,8 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
\"gen\": {
\"args\": [
\"import(\\\"//electron/build/args/testing.gn\\\")\",
\"use_remoteexec = true\"
\"use_remoteexec = true\",
\"use_siso=true\"
],
\"out\": \"Testing\"
},
@@ -58,7 +59,7 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
},
\"\$schema\": \"file:///home/builduser/.electron_build_tools/evm-config.schema.json\",
\"configValidationLevel\": \"strict\",
\"remoteBuild\": \"reclient\",
\"remoteBuild\": \"siso\",
\"preserveSDK\": 5
}
" >$buildtools/configs/evm.testing.json

View File

@@ -10,7 +10,7 @@ Contributors guide: https://github.com/electron/electron/blob/main/CONTRIBUTING.
#### Checklist
<!-- Remove items that do not apply. For completed items, change [ ] to [x]. -->
- [ ] PR description included and stakeholders cc'd
- [ ] PR description included
- [ ] `npm test` passes
- [ ] tests are [changed or added](https://github.com/electron/electron/blob/main/docs/development/testing.md)
- [ ] relevant API documentation, tutorials, and examples are updated and follow the [documentation style guide](https://github.com/electron/electron/blob/main/docs/development/style-guide.md)

View File

@@ -45,6 +45,7 @@ runs:
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Build Electron ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
rm -rf "src/out/Default/Electron Framework.framework"
@@ -60,14 +61,51 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Build Electron (Windows) ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
cd src\electron
git pack-refs
cd ..
$env:NINJA_SUMMARIZE_BUILD = 1
if ("${{ inputs.is-release }}" -eq "true") {
e build --target electron:release_build
} else {
e build --target electron:testing_build
}
Copy-Item out\Default\.ninja_log out\electron_ninja_log
node electron\script\check-symlinks.js
# Upload build stats to Datadog
if ($env:DD_API_KEY) {
try {
npx node electron\script\build-stats.mjs out\Default\siso.exe.INFO --upload-stats ; $LASTEXITCODE = 0
} catch {
Write-Host "Build stats upload failed, continuing..."
}
} else {
Write-Host "Skipping build-stats.mjs upload because DD_API_KEY is not set"
}
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -75,11 +113,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -89,7 +126,6 @@ runs:
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
e build --target electron:electron_mksnapshot_zip
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -123,7 +159,6 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver
e build --target electron:electron_chromedriver_zip
if [ "${{ inputs.is-asan }}" != "true" ]; then
@@ -133,11 +168,6 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -157,17 +187,11 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -180,18 +204,6 @@ runs:
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip
e build --target electron:libcxxabi_headers_zip
e build --target electron:libcxx_objects_zip
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
@@ -200,10 +212,11 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -214,6 +227,11 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash

View File

@@ -43,7 +43,7 @@ runs:
curl --unix-socket /var/run/sas/sas.sock --fail "http://foo/$CACHE_FILE?platform=${{ inputs.target-platform }}&getAccountName=true" > sas-token
- name: Save SAS Key
if: ${{ inputs.generate-sas-token == 'true' }}
uses: actions/cache/save@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
uses: actions/cache/save@cdf6c1fa76f9f475f3d7449005a359c84ca0f306 # v5.0.3
with:
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-${{ github.run_attempt }}
@@ -143,16 +143,17 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matcher
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
npx node src/electron/script/patches-stats.mjs --upload-stats || true
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD
@@ -172,7 +173,6 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src

View File

@@ -37,6 +37,22 @@ runs:
installation-dir: third_party/esbuild
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/esbuild/${platform}
- name: Fix rollup
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
dependency: rollup_libs
deps-file: src/third_party/devtools-frontend/src/DEPS
installation-dir: third_party/rollup_libs
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/rollup_libs/${platform}
- name: Sync native rollup libs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/devtools-frontend/src
python3 scripts/deps/sync_rollup_libs.py
- name: Fix rustc
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
@@ -109,7 +125,7 @@ runs:
deps-file: src/DEPS
installation-dir: src/third_party/siso/cipd
target-platform: ${{ inputs.target-platform }}
package: infra/build/siso/${platform}
package: build/siso/${platform}
- name: Fixup angle git
if: ${{ inputs.target-platform != 'linux' }}
shell: bash

View File

@@ -17,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -60,18 +62,28 @@ runs:
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Xcode_16.4.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=fb34fbad068586d9a6e2bb4e4950bdcf9aaee862
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -6,8 +6,8 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@cdf6c1fa76f9f475f3d7449005a359c84ca0f306 # v5.0.3
id: yarn-cache
with:
path: ${{ steps.yarn-cache-dir-path.outputs.dir }}
@@ -18,4 +18,14 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

122
.github/copilot-instructions.md vendored Normal file
View File

@@ -0,0 +1,122 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

View File

@@ -0,0 +1,16 @@
{
"problemMatcher": [
{
"owner": "markdownlint",
"pattern": [
{
"regexp": "^(.+):(\\d+):(\\d+)\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"message": 4
}
]
}
]
}

View File

@@ -19,6 +19,16 @@
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

81
.github/workflows/apply-patches.yml vendored Normal file
View File

@@ -0,0 +1,81 @@
name: Apply Patches
on:
pull_request:
permissions: {}
concurrency:
group: apply-patches-${{ github.ref }}
cancel-in-progress: true
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
has-patches: ${{ steps.filter.outputs.patches }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
persist-credentials: false
ref: ${{ github.event.pull_request.head.sha }}
# Use dorny/paths-filter instead of the path filter under the on: pull_request: block
# so that the output can be used to conditionally run the apply-patches job, which lets
# the job be marked as a required status check (conditional skip counts as a success).
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
id: filter
with:
filters: |
patches:
- DEPS
- 'patches/**'
apply-patches:
needs: setup
if: ${{ needs.setup.outputs.has-patches == 'true' }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
persist-credentials: false
ref: ${{ github.event.pull_request.base.ref }}
- name: Merge PR HEAD
working-directory: src/electron
env:
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
git config user.email "electron@github.com"
git config user.name "Electron Bot"
git fetch origin refs/pull/${PR_NUMBER}/head
git merge --squash FETCH_HEAD
git commit -n -m "Squashed commits"
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux
- name: Upload Patch Conflict Fix
if: ${{ failure() }}
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f # v7.0.0
with:
name: update-patches
path: patches/update-patches.patch
if-no-files-found: ignore
archive: false

View File

@@ -3,19 +3,23 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 20.19.x
node-version: 24.12.x
- name: Setting Up Dig Site
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
@@ -41,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f #v6.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -16,15 +16,25 @@ jobs:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020 # v4.4.0
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f # v6.1.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
- name: Sparse checkout repository
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
@@ -73,6 +83,8 @@ jobs:
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -75,7 +75,7 @@ jobs:
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
with:
script: |

View File

@@ -6,11 +6,15 @@ on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -19,7 +23,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -30,8 +34,10 @@ jobs:
build-git-cache-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -41,7 +47,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -52,10 +58,12 @@ jobs:
build-git-cache-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -64,7 +72,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
skip-macos:
type: boolean
@@ -43,10 +43,13 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -54,7 +57,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -63,13 +66,17 @@ jobs:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -80,6 +87,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
@@ -89,6 +98,8 @@ jobs:
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
@@ -98,6 +109,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -111,7 +124,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -126,6 +139,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -141,7 +156,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -155,6 +170,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -171,7 +188,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -185,16 +202,20 @@ jobs:
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
@@ -207,6 +228,8 @@ jobs:
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
@@ -225,7 +248,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
@@ -244,7 +267,7 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
@@ -310,7 +333,7 @@ jobs:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -400,6 +423,8 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
steps:

View File

@@ -1,16 +1,20 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -31,6 +32,8 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -72,7 +75,7 @@ jobs:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@e2ff99831a4f13625d35064e2b3dfe65c07a0396 # v3.7.5
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,6 +11,7 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -28,6 +29,7 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
@@ -35,18 +37,29 @@ jobs:
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -77,7 +90,6 @@ jobs:
labelExists = true;
} catch {}
const { ElectronVersions } = await import('${{ github.workspace }}/node_modules/@electron/fiddle-core/dist/index.js');
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
@@ -134,7 +146,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@e2ff99831a4f13625d35064e2b3dfe65c07a0396 # v3.7.5
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -10,6 +10,7 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,9 +17,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -31,7 +35,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,12 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -54,7 +63,12 @@ jobs:
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -69,7 +83,12 @@ jobs:
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release

104
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,104 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -32,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -43,11 +47,16 @@ jobs:
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -58,11 +67,16 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -73,11 +87,16 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -88,11 +107,16 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -7,6 +7,8 @@ on:
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -64,14 +64,13 @@ concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -86,6 +85,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
@@ -19,11 +21,13 @@ jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -50,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -19,11 +21,13 @@ jobs:
lint:
name: Lint
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -42,7 +46,7 @@ jobs:
shell: bash
run: |
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
gn_version="$(curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
gn_version="$(curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
cipd ensure -ensure-file - -root . <<-CIPD
\$ServiceURL https://chrome-infra-packages.appspot.com/
@@ -58,12 +62,14 @@ jobs:
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
mkdir -p src/buildtools
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add ESLint problem matcher
- name: Add problem matchers
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
run: |
echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
echo "::add-matcher::src/electron/.github/problem-matchers/markdownlint.json"
- name: Run Lint
shell: bash
run: |
@@ -74,11 +80,15 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -59,6 +59,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -66,6 +68,7 @@ concurrency:
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
@@ -80,16 +83,19 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -113,9 +119,9 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 20.19.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
@@ -157,7 +163,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0

View File

@@ -0,0 +1,237 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -35,10 +35,7 @@ concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -53,6 +50,10 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
@@ -68,11 +69,12 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@395ad3262231945c25e8478fd5baf05154b1d79f
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
@@ -110,11 +112,6 @@ jobs:
configure_sys_tccdb "$values"
fi
done
# Ref: https://github.com/getsentry/sentry-cocoa/blob/main/scripts/ci-enable-permissions.sh
if [ "$OSTYPE" = "darwin24" ]; then
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
fi
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
@@ -122,11 +119,17 @@ jobs:
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
@@ -165,45 +168,48 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
Expand-Archive -Force chromedriver.zip -DestinationPath ./
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
#- name: Import & Trust Self-Signed Codesigning Cert on MacOS
# if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
# run: |
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
./script/codesign/generate-identity.sh
# Only sign on x64 — arm64 builds are already ad-hoc signed, and re-signing
# with an untrusted cert breaks macOS system integrations (e.g. dock bounce).
# Autoupdater tests sign their own fixture copies via signApp().
- name: Sign Electron.app for macOS tests
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
run: |
identity=$(src/electron/script/codesign/get-trusted-identity.sh)
if [ -n "$identity" ]; then
codesign -s "$identity" --deep --force src/out/Default/Electron.app
fi
- name: Run Electron Tests
shell: bash
timeout-minutes: 40
env:
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: mocha-junit-reporter, tap
@@ -227,7 +233,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -244,11 +250,29 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
- name: Take screenshot on timeout or cancellation
if: ${{ inputs.target-platform != 'linux' && (cancelled() || failure()) }}
shell: bash
run: |
screenshot_dir="src/electron/spec/artifacts"
mkdir -p "$screenshot_dir"
screenshot_file="$screenshot_dir/screenshot-timeout-$(date +%Y%m%d%H%M%S).png"
if [ "${{ inputs.target-platform }}" = "macos" ]; then
screencapture -x "$screenshot_file" || true
elif [ "${{ inputs.target-platform }}" = "win" ]; then
powershell -command "Add-Type -AssemblyName System.Windows.Forms; \$screen = [System.Windows.Forms.Screen]::PrimaryScreen.Bounds; \$bitmap = New-Object System.Drawing.Bitmap(\$screen.Width, \$screen.Height); \$graphics = [System.Drawing.Graphics]::FromImage(\$bitmap); \$graphics.CopyFromScreen(\$screen.Location, [System.Drawing.Point]::Empty, \$screen.Size); \$bitmap.Save('$screenshot_file')" || true
fi
- name: Upload Test results to Datadog
env:
DD_ENV: ci
@@ -258,13 +282,14 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
if: always()
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -39,6 +41,8 @@ jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +97,8 @@ jobs:
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +138,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

View File

@@ -11,6 +11,7 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
@@ -19,12 +20,16 @@ jobs:
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -0,0 +1,71 @@
name: Rerun PR Apply Patches
on:
push:
branches:
- main
- '[1-9][0-9]-x-y'
paths:
- 'DEPS'
- 'patches/**'
permissions: {}
jobs:
rerun-apply-patches:
runs-on: ubuntu-latest
permissions:
actions: write
checks: read
contents: read
pull-requests: read
steps:
- name: Find PRs and Rerun Apply Patches
env:
GH_REPO: ${{ github.repository }}
GH_TOKEN: ${{ github.token }}
run: |
BRANCH="${GITHUB_REF#refs/heads/}"
# Find all open PRs targeting this branch
PRS=$(gh pr list --base "$BRANCH" --state open --limit 250 --json number)
echo "$PRS" | jq -c '.[]' | while read -r pr; do
PR_NUMBER=$(echo "$pr" | jq -r '.number')
echo "Processing PR #${PR_NUMBER}"
# Find the Apply Patches workflow check for this PR
CHECK=$(gh pr view "$PR_NUMBER" --json statusCheckRollup --jq '[.statusCheckRollup[] | select(.workflowName == "Apply Patches" and .name == "apply-patches")] | first')
if [ -z "$CHECK" ] || [ "$CHECK" = "null" ]; then
echo " No Apply Patches workflow found for PR #${PR_NUMBER}"
continue
fi
CONCLUSION=$(echo "$CHECK" | jq -r '.conclusion')
if [ "$CONCLUSION" = "SKIPPED" ]; then
echo " apply-patches job was skipped for PR #${PR_NUMBER} (no patches)"
continue
fi
LINK=$(echo "$CHECK" | jq -r '.detailsUrl')
# Extract the run ID from the link (format: .../runs/RUN_ID/job/JOB_ID)
RUN_ID=$(echo "$LINK" | grep -oE 'runs/[0-9]+' | cut -d'/' -f2)
if [ -z "$RUN_ID" ]; then
echo " Could not extract run ID from link: ${LINK}"
continue
fi
# Check if the workflow is currently in progress
RUN_STATUS=$(gh run view "$RUN_ID" --json status --jq '.status')
if [ "$RUN_STATUS" = "in_progress" ] || [ "$RUN_STATUS" = "queued" ] || [ "$RUN_STATUS" = "waiting" ]; then
echo " Workflow run ${RUN_ID} is ${RUN_STATUS}, cancelling..."
gh run cancel "$RUN_ID" --force
gh run watch "$RUN_ID"
fi
gh run rerun "$RUN_ID"
done

View File

@@ -22,13 +22,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8 # v6.0.1
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@05b42c624433fc40578a4040d5cf5e36ddca8cde # v2.4.2
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +42,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f # v6.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +50,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@3c3833e0f8c1c83d449a7478aa59c036a9165498 # v3.29.5
uses: github/codeql-action/upload-sarif@cdefb33c0f6224e58673d9004f47f7cb3e328b89 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:

View File

@@ -11,6 +11,7 @@ jobs:
check-stable-prep-items:
name: Check Stable Prep Items
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1

View File

@@ -10,13 +10,14 @@ permissions: {}
jobs:
stale:
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@997185467fa4f803885201cee163a9f38240193d # tag: v10.1.1
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,10 +28,11 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
permissions: {}
if: ${{ always() }}
needs: stale
steps:
@@ -39,7 +41,7 @@ jobs:
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@997185467fa4f803885201cee163a9f38240193d # tag: v10.1.1
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -0,0 +1,39 @@
name: Update Website Docs
on:
release:
types: [published]
permissions: {}
jobs:
update-website-docs:
name: Update Website Docs
runs-on: ubuntu-latest
environment: website-docs-updater
permissions:
contents: read
id-token: write # needed for secret-service-action
steps:
- name: Get GitHub App token
id: secret-service
uses: electron/secret-service-action@3476425e8b30555aac15b1b7096938e254b0e155 # v1.0.0
- name: Check if this release is the latest
id: check-if-latest-release
env:
GH_REPO: electron/electron
GH_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
LATEST_RELEASE_TAG="$(gh release view --json tagName --jq '.tagName')"
if [ "$LATEST_RELEASE_TAG" = "${GITHUB_REF#refs/tags/}" ]; then
echo "isLatestRelease=true" >> $GITHUB_OUTPUT
else
echo "isLatestRelease=false" >> $GITHUB_OUTPUT
fi
- name: Trigger website docs update
if: ${{ steps.check-if-latest-release.outputs.isLatestRelease == 'true' }}
env:
GH_REPO: electron/website
GH_TOKEN: ${{ fromJSON(steps.secret-service.outputs.secrets).WEBSITE_DOCS_UPDATER_APP_TOKEN }}
run: |
gh workflow run update-docs.yml -f sha=$GITHUB_SHA

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,13 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -36,7 +40,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@8e8c483db84b4bee98b60c0593521ed34d9990e8
with:
path: src/electron
fetch-depth: 0
@@ -47,7 +51,12 @@ jobs:
target-platform: win
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -61,7 +70,12 @@ jobs:
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -75,7 +89,12 @@ jobs:
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release

2
.gitignore vendored
View File

@@ -53,3 +53,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

2
.nvmrc
View File

@@ -1 +1 @@
20
22

942
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

16
.yarnrc.yml Normal file
View File

@@ -0,0 +1,16 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
httpProxy: "${HTTP_PROXY:-}"
httpsProxy: "${HTTPS_PROXY:-}"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

View File

@@ -446,6 +446,7 @@ source_set("electron_lib") {
"shell/services/node/public/mojom",
"//base:base_static",
"//base/allocator:buildflags",
"//build/util:chromium_git_revision",
"//chrome:strings",
"//chrome/app:command_ids",
"//chrome/app/resources:platform_locale_settings",
@@ -480,6 +481,7 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
@@ -500,6 +502,7 @@ source_set("electron_lib") {
"//third_party/blink/public/platform/media",
"//third_party/boringssl",
"//third_party/electron_node:libnode",
"//third_party/highway:libhwy",
"//third_party/inspector_protocol:crdtp",
"//third_party/leveldatabase",
"//third_party/libyuv",
@@ -527,6 +530,7 @@ source_set("electron_lib") {
"//base",
"//base:i18n",
"//content/public/app",
"//ui/base/unowned_user_data",
]
include_dirs = [
@@ -586,7 +590,13 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -655,6 +665,7 @@ source_set("electron_lib") {
"//ui/events/devices/x11",
"//ui/events/platform/x11",
"//ui/gtk:gtk_config",
"//ui/linux:display_server_utils",
"//ui/linux:linux_ui",
"//ui/linux:linux_ui_factory",
"//ui/wm",
@@ -688,7 +699,6 @@ source_set("electron_lib") {
"//components/app_launch_prefetch",
"//components/crash/core/app:crash_export_thunks",
"//third_party/libxml:xml_writer",
"//ui/native_theme:native_theme_browser",
"//ui/wm",
"//ui/wm/public",
]
@@ -755,11 +765,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]
@@ -1619,6 +1631,29 @@ group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"

246
CLAUDE.md Normal file
View File

@@ -0,0 +1,246 @@
# Electron Development Guide
## Project Overview
Electron is a framework for building cross-platform desktop applications using web technologies. It embeds Chromium for rendering and Node.js for backend functionality.
## Directory Structure
```text
electron/ # This repo (run `e` commands here)
├── shell/ # Core C++ application code
│ ├── browser/ # Main process implementation (107+ API modules)
│ ├── renderer/ # Renderer process code
│ ├── common/ # Shared code between processes
│ ├── app/ # Application entry points
│ └── services/ # Node.js service integration
├── lib/ # TypeScript/JavaScript library code
│ ├── browser/ # Main process JS (47 API implementations)
│ ├── renderer/ # Renderer process JS
│ └── common/ # Shared JS modules
├── patches/ # Patches for upstream dependencies
│ ├── chromium/ # ~159 patches to Chromium
│ ├── node/ # ~48 patches to Node.js
│ └── ... # Other targets (v8, boringssl, etc.)
├── spec/ # Test suite (1189+ TypeScript test files)
├── docs/ # API documentation and guides
├── build/ # Build configuration
├── script/ # Build and automation scripts
└── chromium_src/ # Chromium source overrides
../ # Parent directory is Chromium source
```
## Build Tools Setup
Electron uses `@electron/build-tools` for development. The `e` command is the primary CLI.
**Installation:**
```bash
npm i -g @electron/build-tools
```
**Configuration location:** `~/.electron_build_tools/configs/`
## Essential Commands
### Configuration Management
| Command | Purpose |
|---------|---------|
| `e init <name> --root=<path> --bootstrap testing` | Create new build config and sync |
| `e use <name>` | Switch to a different build configuration |
| `e show current` | Display active configuration name |
| `e show configs` | List all available configurations |
### Build & Development Loop
| Command | Purpose |
|---------|---------|
| `e sync` | Fetch/update all source code and apply patches |
| `e sync --3` | Sync with 3-way merge (required for Chromium upgrades) |
| `e build` | Build Electron (runs GN + Ninja) |
| `e build -k 999` | Build and continue on errors (up to 999) |
| `e build -t <target>` | Build specific target (e.g., `electron:node_headers`) |
| `e start` | Run the built Electron executable |
| `e start --version` | Verify Electron launches and print version |
| `e test` | Run the test suite |
| `e debug` | Run Electron in debugger (lldb on macOS, gdb on Linux) |
### Patch Management
| Command | Purpose |
|---------|---------|
| `e patches <target>` | Export patches for a target (chromium, node, v8, etc.) |
| `e patches all` | Export all patches from all targets |
| `e patches --list-targets` | List available patch targets |
## Typical Development Workflow
```bash
# 1. Ensure you're on the right config
e show current
# 2. Sync to get latest code
e sync
# 3. Make your changes in shell/ or lib/ or ../
# 4. Build
e build
# 5. Test your changes (Leave the user to do this, don't run these commands unless asked)
e start
e test
# 6. If you modified patched files in Chromium:
cd .. # Go to Chromium repo
git add <files>
git commit -m "description of change"
cd electron
e patches chromium # Export the patch
```
## Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) to add features or modify behavior.
**How patches work:**
```text
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
**Patch configuration:** `patches/config.json` maps patch directories to target repos.
**Key rules:**
- Fix existing patches 99% of the time rather than creating new ones
- Preserve original authorship in TODO comments
- Never change TODO assignees (`TODO(name)` must retain original name)
- Each patch file includes commit message explaining its purpose
**Creating/modifying patches:**
1. Make changes in the target repo (e.g., `../` for Chromium)
2. Create a git commit
3. Run `e patches <target>` to export
**Fixing patch conflicts on an existing PR:**
If asked to fix a patch conflict on a branch that already has an open PR, check the PR's failed **Apply Patches** CI run for an `update-patches` artifact before running `e sync` locally. CI has already performed the 3-way merge and exported the resolved patch diff — applying it is much faster than a full local sync.
```bash
# Find the failed Apply Patches run for the PR and download the artifact
gh run list --repo electron/electron --branch <pr-branch> --workflow "Apply Patches" --limit 1
gh run download <run-id> --repo electron/electron --name update-patches
# Apply the CI-generated fix, then push
git am update-patches.patch
git push
```
If no artifact exists (e.g. the 3-way merge itself failed), fall back to `e sync --3` and resolve manually.
## Testing
**Test location:** `spec/` directory
**Running tests:**
```bash
e test # Run full test suite
```
**Test frameworks:** Mocha, Chai, Sinon
## Build Configuration
**GN build arguments:** Located in `build/args/`:
- `testing.gn` - Debug/testing builds
- `release.gn` - Release builds
- `all.gn` - Common arguments for all builds
**Main build file:** `BUILD.gn`
**Feature flags:** `buildflags/buildflags.gni`
## Chromium Upgrade Workflow
When working on the `roller/chromium/main` branch to upgrade Chromium activate the "Electron Chromium Upgrade" skill.
## Pull Requests
PR bodies must always include a `Notes:` section as the **last line** of the body. This is a consumer-facing release note for Electron app developers — describe the user-visible fix or change, not internal implementation details. Use `Notes: none` if there is no user-facing change.
## Code Style
**C++:** Follows Chromium style, enforced by clang-format
**TypeScript/JavaScript:** ESLint configuration in `.eslintrc.json`
**Linting:**
```bash
npm run lint # Run all linters
npm run lint:clang-format # C++ formatting
```
## Key Files
| File | Purpose |
|------|---------|
| `BUILD.gn` | Main GN build configuration |
| `DEPS` | Dependency versions and checkout paths |
| `patches/config.json` | Patch target configuration |
| `filenames.gni` | Source file lists by platform |
| `package.json` | Node.js dependencies and scripts |
## Environment Variables
| Variable | Purpose |
|----------|---------|
| `GN_EXTRA_ARGS` | Additional GN arguments (useful in CI) |
| `ELECTRON_RUN_AS_NODE=1` | Run Electron as Node.js |
## Useful Git Commands for Chromium
```bash
# Find CL that changed a file
cd ..
git log --oneline -10 -- {file}
git blame -L {start},{end} -- {file}
# Look for Chromium CL reference in commit
git log -1 {commit_sha} # Find "Reviewed-on:" line
# Find which patch affects a file
grep -l "filename.cc" patches/chromium/*.patch
```
## CI/CD
GitHub Actions workflows in `.github/workflows/`:
- `build.yml` - Main build workflow
- `pipeline-electron-lint.yml` - Linting
- `pipeline-segment-electron-test.yml` - Testing
## Common Issues
**Patch conflict during sync:**
- Use `e sync --3` for 3-way merge
- Check if file was renamed/moved upstream
- Verify patch is still needed
**Build error in patched file:**
- Find the patch: `grep -l "filename" patches/chromium/*.patch`
- Match existing patch style (#if 0 guards, BUILDFLAG conditionals, etc.)
**Remote build issues:**
- Try `e build --no-remote` to build locally
- Check reclient/siso configuration in your build config

11
DEPS
View File

@@ -2,11 +2,11 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'141.0.7361.0',
'146.0.7680.153',
'node_version':
'v22.18.0',
'v24.14.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.22.22',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -155,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -37,9 +37,9 @@ For more installation options and troubleshooting tips, see
Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* macOS (Monterey and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 140
node_module_version = 145
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"
@@ -19,15 +19,15 @@ proprietary_codecs = true
enable_printing = true
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6986517
# CI is using MacOS 15.5 which doesn't have the required modulemaps.
use_clang_modules = false
# Removes DLLs from the build, which are only meant to be used for Chromium development.
# See https://github.com/electron/electron/pull/17985
angle_enable_vulkan_validation_layers = false
dawn_enable_vulkan_validation_layers = false
# Removes dxc dll's that are only used experimentally.
# See https://bugs.chromium.org/p/chromium/issues/detail?id=1474897
dawn_use_built_dxc = false
# These are disabled because they cause the zip manifest to differ between
# testing and release builds.
# See https://chromium-review.googlesource.com/c/chromium/src/+/2774898.
@@ -72,3 +72,6 @@ enterprise_cloud_content_analysis = false
# We don't use anything from here, and it causes target collisions
enable_linux_installer = false
# Disable "Save to Drive" feature in PDF viewer
enable_pdf_save_to_drive = false

View File

@@ -12,7 +12,7 @@ TEMPLATE_H = """
namespace electron::snapshot_checksum {
const std::string kChecksum = "{checksum}";
inline constexpr std::string_view kChecksum = "{checksum}";
} // namespace electron::snapshot_checksum

View File

@@ -9,5 +9,6 @@
"embedded_asar_integrity_validation": "0",
"only_load_app_from_asar": "0",
"load_browser_process_specific_v8_snapshot": "0",
"grant_file_protocol_extra_privileges": "1"
"grant_file_protocol_extra_privileges": "1",
"wasm_trap_handlers": "1"
}

View File

@@ -23,6 +23,8 @@ static_library("chrome") {
"//chrome/browser/browser_process.h",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.cc",
"//chrome/browser/devtools/devtools_contents_resizing_strategy.h",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.cc",
"//chrome/browser/devtools/devtools_dispatch_http_request_params.h",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.cc",
"//chrome/browser/devtools/devtools_embedder_message_dispatcher.h",
"//chrome/browser/devtools/devtools_eye_dropper.cc",
@@ -243,6 +245,10 @@ static_library("chrome") {
"//chrome/browser/ui/views/dark_mode_manager_linux.cc",
"//chrome/browser/ui/views/dark_mode_manager_linux.h",
]
sources += [
"//chrome/browser/ui/views/frame/browser_frame_view_paint_utils_linux.cc",
"//chrome/browser/ui/views/frame/browser_frame_view_paint_utils_linux.h",
]
public_deps += [ "//components/dbus" ]
}
@@ -381,6 +387,8 @@ static_library("chrome") {
"//chrome/browser/pdf/chrome_pdf_stream_delegate.h",
"//chrome/browser/pdf/pdf_extension_util.cc",
"//chrome/browser/pdf/pdf_extension_util.h",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.cc",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.h",
"//chrome/browser/pdf/pdf_viewer_stream_manager.cc",
"//chrome/browser/pdf/pdf_viewer_stream_manager.h",
"//chrome/browser/plugins/pdf_iframe_navigation_throttle.cc",
@@ -389,6 +397,8 @@ static_library("chrome") {
deps += [
"//components/pdf/browser",
"//components/pdf/renderer",
"//ui/base/interaction",
"//ui/webui/resources/cr_components/help_bubble:mojo_bindings",
]
}
} else {

View File

@@ -110,11 +110,12 @@ async function loadApplicationPackage (packagePath: string) {
} else if (packageJson.name) {
app.name = packageJson.name;
}
if (packageJson.desktopName) {
app.setDesktopName(packageJson.desktopName);
} else {
app.setDesktopName(`${app.name}.desktop`);
}
// Set application's desktop name (Linux). These usually match the executable name,
// so use it as the default to ensure the app gets the correct icon in the taskbar and application switcher.
const desktopName = packageJson.desktopName || `${path.basename(process.execPath)}.desktop`;
app.setDesktopName(desktopName);
// Set v8 flags, deliberately lazy load so that apps that do not use this
// feature do not pay the price
if (packageJson.v8Flags) {
@@ -255,7 +256,7 @@ async function startRepl () {
if (option.file && !option.webdriver) {
const file = option.file;
// eslint-disable-next-line n/no-deprecated-api
const protocol = url.parse(file).protocol;
const protocol = URL.canParse(file) ? new URL(file).protocol : null;
const extension = path.extname(file);
if (protocol === 'http:' || protocol === 'https:' || protocol === 'file:' || protocol === 'chrome:') {
await loadApplicationByURL(file);

View File

@@ -41,7 +41,7 @@ h4 {
transform-origin: 50% 50%;
}
hero-icon.loop-3 {
.hero-icon.loop-3 {
transform: translate(79px, 21px);
opacity: 1;
}

View File

@@ -250,7 +250,9 @@ Returns:
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
### Event: 'browser-window-blur'
@@ -421,6 +423,7 @@ Returns:
* `oom` - Process ran out of memory
* `launch-failed` - Process never successfully launched
* `integrity-failure` - Windows code integrity checks failed
* `memory-eviction` - Process proactively terminated to prevent a future out-of-memory (OOM) situation
* `exitCode` number - The exit code for the process
(e.g. status from waitpid if on POSIX, from GetExitCodeProcess on Windows).
* `serviceName` string (optional) - The non-localized name of the process.
@@ -564,8 +567,9 @@ and subscribing to the `ready` event if the app is not ready yet.
* `steal` boolean _macOS_ - Make the receiver the active app even if another app is
currently active.
On Linux, focuses on the first visible window. On macOS, makes the application
the active app. On Windows, focuses on the application's first window.
On macOS, makes the application the active app. On Windows, focuses on the application's
first window. On Linux, either focuses on the first visible window (X11) or requests
focus but may instead show a notification or flash the app icon (Wayland).
You should seek to use the `steal` option as sparingly as possible.
@@ -610,7 +614,7 @@ Returns `string` - The current application directory.
may backup this directory to cloud storage.
* `sessionData` The directory for storing data generated by `Session`, such
as localStorage, cookies, disk cache, downloaded dictionaries, network
state, devtools files. By default this points to `userData`. Chromium may
state, DevTools files. By default this points to `userData`. Chromium may
write very large disk cache here, so if your app does not rely on browser
storage like localStorage or cookies to save user data, it is recommended
to set this directory to other locations to avoid polluting the `userData`
@@ -631,7 +635,7 @@ Returns `string` - The current application directory.
Returns `string` - A path to a special directory or file associated with `name`. On
failure, an `Error` is thrown.
If `app.getPath('logs')` is called without called `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
If `app.getPath('logs')` is called without calling `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
### `app.getFileIcon(path[, options])`
@@ -646,7 +650,7 @@ Returns `Promise<NativeImage>` - fulfilled with the app's icon, which is a [Nati
Fetches a path's associated icon.
On _Windows_, there a 2 kinds of icons:
On _Windows_, there are 2 kinds of icons:
* Icons associated with certain file extensions, like `.mp3`, `.png`, etc.
* Icons inside the file itself, like `.exe`, `.dll`, `.ico`.
@@ -762,7 +766,7 @@ app.getPreferredSystemLanguages() // ['fr-CA', 'en-US', 'zh-Hans-FI', 'es-419']
Both the available languages and regions and the possible return values differ between the two operating systems.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region,and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region, and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
### `app.addRecentDocument(path)` _macOS_ _Windows_
@@ -1120,6 +1124,19 @@ Updates the current activity if its type matches `type`, merging the entries fro
Changes the [Application User Model ID][app-user-model-id] to `id`.
### `app.setToastActivatorCLSID(id)` _Windows_
* `id` string
Changes the [Toast Activator CLSID][toast-activator-clsid] to `id`. If one is not set via this method, it will be randomly generated for the app.
* The value must be a valid GUID/CLSID in one of the following forms:
* Canonical brace-wrapped: `{XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX}` (preferred)
* Canonical without braces: `XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX` (braces will be added automatically)
* Hex digits are case-insensitive.
This method should be called early (before showing notifications) so the value is baked into the registration/shortcut. Supplying an empty string or an unparsable value throws and leaves the existing (or generated) CLSID unchanged. If this method is never called, a random CLSID is generated once per run and exposed via `app.toastActivatorCLSID`.
### `app.setActivationPolicy(policy)` _macOS_
* `policy` string - Can be 'regular', 'accessory', or 'prohibited'.
@@ -1214,10 +1231,17 @@ Disables hardware acceleration for current app.
This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently enabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.
### `app.disableDomainBlockingFor3DAPIs()`
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
domain basis if the GPU processes crashes too frequently. This function
domain basis if the GPU process crashes too frequently. This function
disables that behavior.
This method can only be called before app is ready.
@@ -1276,6 +1300,8 @@ For `infoType` equal to `basic`:
Using `basic` should be preferred if only basic information like `vendorId` or `deviceId` is needed.
Promise is rejected if the GPU is completely disabled, i.e. no hardware and software implementations are available.
### `app.setBadgeCount([count])` _Linux_ _macOS_
* `count` Integer (optional) - If a value is provided, set the badge to the provided value otherwise, on macOS, display a plain white dot (e.g. unknown number of notifications). On Linux, if a value is not provided the badge will not display.
@@ -1306,7 +1332,7 @@ Returns `boolean` - Whether the current desktop environment is Unity launcher.
### `app.getLoginItemSettings([options])` _macOS_ _Windows_
* `options` Object (optional)
* `type` string (optional) _macOS_ - Can be one of `mainAppService`, `agentService`, `daemonService`, or `loginItemService`. Defaults to `mainAppService`. Only available on macOS 13 and up. See [app.setLoginItemSettings](app.md#appsetloginitemsettingssettings-macos-windows) for more information about each type.
* `type` string (optional) _macOS_ - Can be `mainAppService`, `agentService`, `daemonService`, or `loginItemService`. Defaults to `mainAppService`. Only available on macOS 13 and up. See [app.setLoginItemSettings](app.md#appsetloginitemsettingssettings-macos-windows) for more information about each type.
* `serviceName` string (optional) _macOS_ - The name of the service. Required if `type` is non-default. Only available on macOS 13 and up.
* `path` string (optional) _Windows_ - The executable path to compare against. Defaults to `process.execPath`.
* `args` string[] (optional) _Windows_ - The command-line arguments to compare against. Defaults to an empty array.
@@ -1321,13 +1347,13 @@ Returns `Object`:
* `wasOpenedAtLogin` boolean _macOS_ - `true` if the app was opened at login automatically.
* `wasOpenedAsHidden` boolean _macOS_ _Deprecated_ - `true` if the app was opened as a hidden login item. This indicates that the app should not open any windows at startup. This setting is not available on [MAS builds][mas-builds] or on macOS 13 and up.
* `restoreState` boolean _macOS_ _Deprecated_ - `true` if the app was opened as a login item that should restore the state from the previous session. This indicates that the app should restore the windows that were open the last time the app was closed. This setting is not available on [MAS builds][mas-builds] or on macOS 13 and up.
* `status` string _macOS_ - can be one of `not-registered`, `enabled`, `requires-approval`, or `not-found`.
* `status` string _macOS_ - can be `not-registered`, `enabled`, `requires-approval`, or `not-found`.
* `executableWillLaunchAtLogin` boolean _Windows_ - `true` if app is set to open at login and its run key is not deactivated. This differs from `openAtLogin` as it ignores the `args` option, this property will be true if the given executable would be launched at login with **any** arguments.
* `launchItems` Object[] _Windows_
* `name` string _Windows_ - name value of a registry entry.
* `path` string _Windows_ - The executable to an app that corresponds to a registry entry.
* `args` string[] _Windows_ - the command-line arguments to pass to the executable.
* `scope` string _Windows_ - one of `user` or `machine`. Indicates whether the registry entry is under `HKEY_CURRENT USER` or `HKEY_LOCAL_MACHINE`.
* `scope` string _Windows_ - can be `user` or `machine`. Indicates whether the registry entry is under `HKEY_CURRENT USER` or `HKEY_LOCAL_MACHINE`.
* `enabled` boolean _Windows_ - `true` if the app registry key is startup approved and therefore shows as `enabled` in Task Manager and Windows settings.
### `app.setLoginItemSettings(settings)` _macOS_ _Windows_
@@ -1397,7 +1423,75 @@ details. Disabled by default.
This API must be called after the `ready` event is emitted.
> [!NOTE]
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
Notes:
* The array may be empty if no accessibility modes are active.
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
prefer this method for granular diagnostics or telemetry.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
// Change some app UI to better work with Screen Readers.
}
})
```
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
* `features` string[] - An array of the accessibility features to enable.
Possible values are:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
To disable all supported features, pass an empty array `[]`.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
// Enable a subset of features:
app.setAccessibilitySupportFeatures([
'screenReader',
'pdfPrinting',
'webContents'
])
// Other logic
// Some time later, disable all features:
app.setAccessibilitySupportFeatures([])
})
```
### `app.showAboutPanel()`
@@ -1625,8 +1719,13 @@ platforms) that allows you to perform actions on your app icon in the user's doc
A `boolean` property that returns `true` if the app is packaged, `false` otherwise. For many apps, this property can be used to distinguish development and production environments.
### `app.toastActivatorCLSID` _Windows_ _Readonly_
A `string` property that returns the app's [Toast Activator CLSID][toast-activator-clsid].
[tasks]:https://learn.microsoft.com/en-us/windows/win32/shell/taskbar-extensions#tasks
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[toast-activator-clsid]: https://learn.microsoft.com/en-us/windows/win32/properties/props-system-appusermodel-toastactivatorclsid
[electron-forge]: https://www.electronforge.io/
[electron-packager]: https://github.com/electron/packager
[CFBundleURLTypes]: https://developer.apple.com/library/ios/documentation/General/Reference/InfoPlistKeyReference/Articles/CoreFoundationKeys.html#//apple_ref/doc/uid/TP40009249-102207-TPXREF115

View File

@@ -32,9 +32,19 @@ update process. Apps that need to disable ATS can add the
### Windows
On Windows, you have to install your app into a user's machine before you can
use the `autoUpdater`, so it is recommended that you use
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib] to generate a Windows installer.
On Windows, the `autoUpdater` module automatically selects the appropriate update mechanism
based on how your app is packaged:
* **MSIX packages**: If your app is running as an MSIX package (created with [electron-windows-msix][msix-lib] and detected via [`process.windowsStore`](process.md#processwindowsstore-readonly)),
the module uses the MSIX updater, which supports direct MSIX file links and JSON update feeds.
* **Squirrel.Windows**: For apps installed via traditional installers (created with
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib]),
the module uses Squirrel.Windows for updates.
You don't need to configure which updater to use; Electron automatically detects the packaging
format and uses the appropriate one.
#### Squirrel.Windows
Apps built with Squirrel.Windows will trigger [custom launch events](https://github.com/Squirrel/Squirrel.Windows/blob/51f5e2cb01add79280a53d51e8d0cfa20f8c9f9f/docs/using/custom-squirrel-events-non-cs.md#application-startup-commands)
that must be handled by your Electron application to ensure proper setup and teardown.
@@ -55,6 +65,14 @@ The installer generated with Squirrel.Windows will create a shortcut icon with a
same ID for your app with `app.setAppUserModelId` API, otherwise Windows will
not be able to pin your app properly in task bar.
#### MSIX Packages
When your app is packaged as an MSIX, the `autoUpdater` module provides additional
functionality:
* Use the `allowAnyVersion` option in `setFeedURL()` to allow updates to older versions (downgrades)
* Support for direct MSIX file links or JSON update feeds (similar to Squirrel.Mac format)
## Events
The `autoUpdater` object emits the following events:
@@ -92,7 +110,7 @@ Returns:
Emitted when an update has been downloaded.
On Windows only `releaseName` is available.
With Squirrel.Windows only `releaseName` is available.
> [!NOTE]
> It is not strictly necessary to handle this event. A successfully
@@ -100,6 +118,13 @@ On Windows only `releaseName` is available.
### Event: 'before-quit-for-update'
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/12619
```
-->
This event is emitted after a user calls `quitAndInstall()`.
When this API is called, the `before-quit` event is not emitted before all windows are closed. As a result you should listen to this event if you wish to perform actions before the windows are closed while a process is quitting, as well as listening to `before-quit`.
@@ -110,11 +135,23 @@ The `autoUpdater` object has the following methods:
### `autoUpdater.setFeedURL(options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/5879
description: "Added `headers` as a second parameter."
- pr-url: https://github.com/electron/electron/pull/11925
description: "Changed API to accept a single `options` argument (contains `url`, `headers`, and `serverType` properties)."
```
-->
* `options` Object
* `url` string
* `url` string - The update server URL. For _Windows_ MSIX, this can be either a direct link to an MSIX file (e.g., `https://example.com/update.msix`) or a JSON endpoint that returns update information (see the [Squirrel.Mac][squirrel-mac] README for more information).
* `headers` Record\<string, string\> (optional) _macOS_ - HTTP request headers.
* `serverType` string (optional) _macOS_ - Can be `json` or `default`, see the [Squirrel.Mac][squirrel-mac]
README for more information.
* `allowAnyVersion` boolean (optional) _Windows_ - If `true`, allows downgrades to older versions for MSIX packages.
Defaults to `false`.
Sets the `url` and initialize the auto updater.
@@ -151,3 +188,4 @@ closed.
[electron-forge-lib]: https://www.electronforge.io/config/makers/squirrel.windows
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[event-emitter]: https://nodejs.org/api/events.html#events_class_eventemitter
[msix-lib]: https://github.com/electron-userland/electron-windows-msix

View File

@@ -351,7 +351,11 @@ Emitted when the window has closed a sheet.
#### Event: 'new-window-for-tab' _macOS_
Emitted when the native new tab button is clicked.
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
#### Event: 'system-context-menu' _Windows_ _Linux_
@@ -756,6 +760,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -969,6 +976,9 @@ Moves window to `x` and `y`.
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1043,7 +1053,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1262,15 +1272,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1294,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -140,6 +140,10 @@ state is `hidden` in order to minimize power consumption.
move.
* On Linux the type of modal windows will be changed to `dialog`.
* On Linux many desktop environments do not support hiding a modal window.
* On Wayland (Linux) it is generally not possible to programmatically resize windows
after creation, or to position, move, focus, or blur windows without user input.
If your app needs these capabilities, run it in Xwayland by appending the flag
`--ozone-platform=x11`.
## Class: BrowserWindow extends `BaseWindow`
@@ -431,7 +435,11 @@ Emitted when the window has closed a sheet.
#### Event: 'new-window-for-tab' _macOS_
Emitted when the native new tab button is clicked.
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
#### Event: 'system-context-menu' _Windows_ _Linux_
@@ -656,10 +664,15 @@ the [close event](#event-close).
Focuses on the window.
On Wayland (Linux), the desktop environment may show a notification or flash
the app icon if the window or app is not already focused.
#### `win.blur()`
Removes focus from the window.
Not supported on Wayland (Linux).
#### `win.isFocused()`
Returns `boolean` - Whether the window is focused.
@@ -676,6 +689,8 @@ Shows and gives focus to the window.
Shows the window but doesn't focus on it.
Not supported on Wayland (Linux).
#### `win.hide()`
Hides the window.
@@ -824,6 +839,8 @@ Closes the currently open [Quick Look][quick-look] panel.
Resizes and moves the window to the supplied bounds. Any properties that are not supplied will default to their current values.
On Wayland (Linux), has the same limitations as `setSize` and `setPosition`.
```js
const { BrowserWindow } = require('electron')
@@ -849,6 +866,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -866,6 +886,8 @@ See [Setting `backgroundColor`](#setting-the-backgroundcolor-property).
Resizes and moves the window's client area (e.g. the web page) to
the supplied bounds.
On Wayland (Linux), has the same limitations as `setContentSize` and `setPosition`.
#### `win.getContentBounds()`
Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window's client area as `Object`.
@@ -895,6 +917,8 @@ Returns `boolean` - whether the window is enabled.
Resizes the window to `width` and `height`. If `width` or `height` are below any set minimum size constraints the window will snap to its minimum size.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getSize()`
Returns `Integer[]` - Contains the window's width and height.
@@ -907,6 +931,8 @@ Returns `Integer[]` - Contains the window's width and height.
Resizes the window's client area (e.g. the web page) to `width` and `height`.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getContentSize()`
Returns `Integer[]` - Contains the window's client area's width and height.
@@ -1044,12 +1070,16 @@ this method throws an error.
#### `win.moveTop()`
Moves window to top(z-order) regardless of focus
Moves window to top(z-order) regardless of focus.
Not supported on Wayland (Linux).
#### `win.center()`
Moves window to the center of the screen.
Not supported on Wayland (Linux).
#### `win.setPosition(x, y[, animate])`
* `x` Integer
@@ -1058,10 +1088,15 @@ Moves window to the center of the screen.
Moves window to `x` and `y`.
Not supported on Wayland (Linux).
#### `win.getPosition()`
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1134,7 +1169,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1227,7 +1262,8 @@ Captures a snapshot of the page within `rect`. Omitting `rect` will capture the
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see [`did-fail-load`](web-contents.md#event-did-fail-load)).
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Same as [`webContents.loadURL(url[, options])`](web-contents.md#contentsloadurlurl-options).
@@ -1442,15 +1478,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1463,11 +1500,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_
@@ -1570,11 +1610,18 @@ events.
Prevents the window contents from being captured by other apps.
On macOS it sets the NSWindow's [`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc) to [`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
On Windows it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
On Windows, it calls [`SetWindowDisplayAffinity`](https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-setwindowdisplayaffinity) with `WDA_EXCLUDEFROMCAPTURE`.
For Windows 10 version 2004 and up the window will be removed from capture entirely,
older Windows versions behave as if `WDA_MONITOR` is applied capturing a black window.
On macOS, it sets the `NSWindow`'s
[`sharingType`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.property?language=objc)
to
[`NSWindowSharingNone`](https://developer.apple.com/documentation/appkit/nswindow/sharingtype-swift.enum/none?language=objc).
Unfortunately, due to an intentional change in macOS, newer Mac applications that use
`ScreenCaptureKit` will capture your window despite `win.setContentProtection(true)`.
See [here](https://github.com/electron/electron/issues/48258#issuecomment-3269893618).
#### `win.isContentProtected()` _macOS_ _Windows_
Returns `boolean` - whether or not content protection is currently enabled.

View File

@@ -25,6 +25,11 @@ following properties:
with which the request is associated. Defaults to the empty string. The
`session` option supersedes `partition`. Thus if a `session` is explicitly
specified, `partition` is ignored.
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
custom protocol handlers registered for the request's URL scheme will not be
called. This allows forwarding an intercepted request to the built-in
handler. [webRequest](web-request.md) handlers will still be triggered
when bypassing custom protocols. Defaults to `false`.
* `credentials` string (optional) - Can be `include`, `omit` or
`same-origin`. Whether to send
[credentials](https://fetch.spec.whatwg.org/#credentials) with this
@@ -259,7 +264,7 @@ will not be allowed. The `finish` event is emitted just after the end operation.
Cancels an ongoing HTTP transaction. If the request has already emitted the
`close` event, the abort operation will have no effect. Otherwise an ongoing
event will emit `abort` and `close` events. Additionally, if there is an ongoing
response object,it will emit the `aborted` event.
response object, it will emit the `aborted` event.
#### `request.followRedirect()`

View File

@@ -1,8 +1,26 @@
# clipboard
<!--
```YAML history
deprecated:
- pr-url: https://github.com/electron/electron/pull/48877
description: "Using the `clipboard` API directly in the renderer process is deprecated."
breaking-changes-header: deprecated-clipboard-api-access-from-renderer-processes
```
-->
> Perform copy and paste operations on the system clipboard.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) _Deprecated_ (non-sandboxed only)
> [!NOTE]
> Using the `clipboard` API from the renderer process is deprecated.
> [!IMPORTANT]
> If you want to call this API from a renderer process,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
On Linux, there is also a `selection` clipboard. To manipulate it
you need to pass `selection` to each method:

View File

@@ -49,6 +49,10 @@ Disables the disk cache for HTTP requests.
Disable HTTP/2 and SPDY/3.1 protocols.
### --disable-geolocation _macOS_
Disables the Geolocation API. Permission requests for geolocation will be denied internally regardless of the decision made by a handler set via `session.setPermissionRequestHandler`. This functionality is currently implemented only for macOS. Has no effect on other platforms.
### --disable-renderer-backgrounding
Prevents Chromium from lowering the priority of invisible pages' renderer
@@ -168,7 +172,7 @@ Enables net log events to be saved and writes them to `path`.
Sets the verbosity of logging when used together with `--enable-logging`.
`N` should be one of [Chrome's LogSeverities][severities].
Note that two complimentary logging mechanisms in Chromium -- `LOG()`
Note that two complementary logging mechanisms in Chromium -- `LOG()`
and `VLOG()` -- are controlled by different switches. `--log-level`
controls `LOG()` messages, while `--v` and `--vmodule` control `VLOG()`
messages. So you may want to use a combination of these three switches
@@ -193,6 +197,11 @@ Disables the Chromium [sandbox](https://www.chromium.org/developers/design-docum
Forces renderer process and Chromium helper processes to run un-sandboxed.
Should only be used for testing.
### --no-stdio-init
Disable stdio initialization during node initialization.
Used to avoid node initialization crash when the nul device is disabled on Windows platform.
### --proxy-bypass-list=`hosts`
Instructs Electron to bypass the proxy server for the given semi-colon-separated
@@ -308,7 +317,7 @@ By default inspector websocket url is available in stderr and under /json/list e
### `--experimental-network-inspection`
Enable support for devtools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
Enable support for DevTools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
### `--no-deprecation`
@@ -345,6 +354,11 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
Disable exposition of [Navigator API][] on the global scope from Node.js.
### `--experimental-transform-types`
Enables the [transformation](https://nodejs.org/api/typescript.html#type-stripping)
of TypeScript-only syntax into JavaScript code.
## Chromium Flags
There isn't a documented list of all Chromium switches, but there are a few ways to find them.
@@ -361,6 +375,13 @@ Keep in mind that standalone switches can sometimes be split into individual fea
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
### Chromium features relevant to Electron apps
* `AlwaysLogLOAFURL`: enables script attribution for
[`long-animation-frame`](https://developer.mozilla.org/en-US/docs/Web/API/Performance_API/Long_animation_frame_timing)
`PerformanceObserver` events for non-http(s), non-data, non-blob URLs (such as `file:` or custom
protocol URLs).
[app]: app.md
[append-switch]: command-line.md#commandlineappendswitchswitch-value
[debugging-main-process]: ../tutorial/debugging-main-process.md

View File

@@ -33,6 +33,15 @@ The `contentTracing` module has the following methods:
### `contentTracing.getCategories()`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/16583
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
Returns `Promise<string[]>` - resolves with an array of category groups once all child processes have acknowledged the `getCategories` request
Get a set of category groups. The category groups can change as new code paths
@@ -44,6 +53,17 @@ are reached. See also the
### `contentTracing.startRecording(options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/13914
description: "The `options` parameter now accepts `TraceConfig` in addition to `TraceCategoriesAndOptions`."
- pr-url: https://github.com/electron/electron/pull/16584
description: "This function now returns a callback`Promise<void>`."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
* `options` ([TraceConfig](structures/trace-config.md) | [TraceCategoriesAndOptions](structures/trace-categories-and-options.md))
Returns `Promise<void>` - resolved once all child processes have acknowledged the `startRecording` request.
@@ -58,6 +78,17 @@ only one trace operation can be in progress at a time.
### `contentTracing.stopRecording([resultFilePath])`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/16584
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
- pr-url: https://github.com/electron/electron/pull/18411
description: "The `resultFilePath` parameter is now optional."
```
-->
* `resultFilePath` string (optional)
Returns `Promise<string>` - resolves with a path to a file that contains the traced data once all child processes have acknowledged the `stopRecording` request
@@ -76,6 +107,15 @@ will be returned in the promise.
### `contentTracing.getTraceBufferUsage()`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/16600
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
Returns `Promise<Object>` - Resolves with an object containing the `value` and `percentage` of trace buffer maximum usage
* `value` number

View File

@@ -51,7 +51,12 @@ Returns:
* `event` Event
* `cookie` [Cookie](structures/cookie.md) - The cookie that was changed.
* `cause` string - The cause of the change with one of the following values:
* `explicit` - The cookie was changed directly by a consumer's action.
* `inserted` - The cookie was inserted.
* `inserted-no-change-overwrite` - The newly inserted cookie overwrote a cookie but
did not result in any change. For example, inserting an identical cookie will produce this cause.
* `inserted-no-value-change-overwrite` - The newly inserted cookie overwrote a cookie but
did not result in any value change, but it's web observable (e.g. updates the expiry).
* `explicit` - The cookie was deleted directly by a consumer's action.
* `overwrite` - The cookie was automatically removed due to an insert
operation that overwrote it.
* `expired` - The cookie was automatically removed as it expired.

View File

@@ -49,7 +49,7 @@ Use the `system-ui` keyword to match the smoothness to the OS design language.
| Value: | `60%` | `0%` |
| Example: | ![A rectangle with round corners whose smoothness matches macOS](../images/corner-smoothing-example-60.svg) | ![A rectangle with round corners whose smoothness matches Windows and Linux](../images/corner-smoothing-example-0.svg) |
### Controlling availibility
### Controlling availability
This CSS rule can be disabled using the Blink feature flag `ElectronCSSCornerSmoothing`.

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The following is an example of setting up Electron to automatically submit
crash reports to a remote server:
@@ -44,6 +50,22 @@ The `crashReporter` module has the following methods:
### `crashReporter.start(options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/23062
description: "Added `rateLimit` and `compress` options."
- pr-url: https://github.com/electron/electron/pull/23265
description: "Deprecated calling this method in the renderer process."
breaking-changes-header: deprecated-crashreporter-methods-in-the-renderer-process
- pr-url: https://github.com/electron/electron/pull/25288
description: "Default value of `compress` option changed from `false` to `true`."
breaking-changes-header: default-changed-crashreporterstart-compress-true-
- pr-url: https://github.com/electron/electron/pull/28105
description: "The `submitURL` parameter is now optional when `uploadToServer` is `false`."
```
-->
* `options` Object
* `submitURL` string (optional) - URL that crash reports will be sent to as
POST. Required unless `uploadToServer` is `false`.
@@ -105,6 +127,15 @@ by the crash reporter.
### `crashReporter.getLastCrashReport()`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/23265
description: "Deprecated calling this method in the renderer process."
breaking-changes-header: deprecated-crashreporter-methods-in-the-renderer-process
```
-->
Returns [`CrashReport | null`](structures/crash-report.md) - The date and ID of the
last crash report. Only crash reports that have been uploaded will be returned;
even if a crash report is present on disk it will not be returned until it is
@@ -115,6 +146,15 @@ uploaded. In the case that there are no uploaded reports, `null` is returned.
### `crashReporter.getUploadedReports()`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/23265
description: "Deprecated calling this method in the renderer process."
breaking-changes-header: deprecated-crashreporter-methods-in-the-renderer-process
```
-->
Returns [`CrashReport[]`](structures/crash-report.md):
Returns all uploaded crash reports. Each report contains the date and uploaded
@@ -125,6 +165,15 @@ ID.
### `crashReporter.getUploadToServer()`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/23265
description: "Deprecated calling this method in the renderer process."
breaking-changes-header: deprecated-crashreporter-methods-in-the-renderer-process
```
-->
Returns `boolean` - Whether reports should be submitted to the server. Set through
the `start` method or `setUploadToServer`.
@@ -133,6 +182,15 @@ the `start` method or `setUploadToServer`.
### `crashReporter.setUploadToServer(uploadToServer)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/23265
description: "Deprecated calling this method in the renderer process."
breaking-changes-header: deprecated-crashreporter-methods-in-the-renderer-process
```
-->
* `uploadToServer` boolean - Whether reports should be submitted to the server.
This would normally be controlled by user preferences. This has no effect if

View File

@@ -44,7 +44,7 @@ Returns:
* `reason` string - Reason for detaching debugger.
Emitted when the debugging session is terminated. This happens either when
`webContents` is closed or devtools is invoked for the attached `webContents`.
`webContents` is closed or DevTools is invoked for the attached `webContents`.
#### Event: 'message'

View File

@@ -80,6 +80,17 @@ The `desktopCapturer` module has the following methods:
### `desktopCapturer.getSources(options)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/2963
changes:
- pr-url: https://github.com/electron/electron/pull/16427
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
* `options` Object
* `types` string[] - An array of strings that lists the types of desktop sources
to be captured, available types can be `screen` and `window`.
@@ -94,14 +105,56 @@ The `desktopCapturer` module has the following methods:
Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`DesktopCapturerSource`](structures/desktop-capturer-source.md) objects, each `DesktopCapturerSource` represents a screen or an individual window that can be captured.
> [!NOTE]
> Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher,
> which can detected by [`systemPreferences.getMediaAccessStatus`][].
<!-- markdownlint-disable-next-line MD032 -->
> * Capturing audio requires `NSAudioCaptureUsageDescription` Info.plist key on macOS 14.2 Sonoma and higher - [read more](#macos-versions-142-or-higher).
> * Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher, which can detected by [`systemPreferences.getMediaAccessStatus`][].
[`navigator.mediaDevices.getUserMedia`]: https://developer.mozilla.org/en/docs/Web/API/MediaDevices/getUserMedia
[`systemPreferences.getMediaAccessStatus`]: system-preferences.md#systempreferencesgetmediaaccessstatusmediatype-windows-macos
## Caveats
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
### Linux
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
### macOS versions 14.2 or higher
`NSAudioCaptureUsageDescription` Info.plist key must be added in order for audio to be captured by
`desktopCapturer`. If instead you are running Electron from another program like a terminal or IDE
then that parent program must contain the Info.plist key.
This is in order to facillitate use of Apple's new [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps#Configure-the-sample-code-project) by Chromium.
> [!WARNING]
> Failure of `desktopCapturer` to start an audio stream due to `NSAudioCaptureUsageDescription`
> permission not present will still create a dead audio stream however no warnings or errors are
> displayed.
As of Electron `v39.0.0-beta.4`, Chromium [made Apple's new `CoreAudio Tap API` the default](https://source.chromium.org/chromium/chromium/src/+/ad17e8f8b93d5f34891b06085d373a668918255e)
for desktop audio capture. There is no fallback to the older `Screen & System Audio Recording`
permissions system even if [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps) stream creation fails.
If you need to continue using `Screen & System Audio Recording` permissions for `desktopCapturer`
on macOS versions 14.2 and later, you can apply a Chromium feature flag to force use of that older
permissions system:
```js
// main.js (right beneath your require/import statments)
app.commandLine.appendSwitch('disable-features', 'MacCatapLoopbackAudioForScreenShare')
```
### macOS versions 12.7.6 or lower
`navigator.mediaDevices.getUserMedia` does not work on macOS versions 12.7.6 and prior for audio
capture due to a fundamental limitation whereby apps that want to access the system's audio require
a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html).
Chromium, and by extension Electron, does not provide this. Only in macOS 13 and onwards does Apple
provide APIs to capture desktop audio without the need for a signed kernel extension.
It is possible to circumvent this limitation by capturing system audio with another macOS app like
[BlackHole](https://existential.audio/blackhole/) or [Soundflower](https://rogueamoeba.com/freebies/soundflower/)
and passing it through a virtual audio input device. This virtual device can then be queried
with `navigator.mediaDevices.getUserMedia`.

View File

@@ -18,6 +18,13 @@ The `dialog` module has the following methods:
### `dialog.showOpenDialogSync([window, ]options)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/16973
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `title` string (optional)
@@ -30,7 +37,7 @@ The `dialog` module has the following methods:
* `openFile` - Allow files to be selected.
* `openDirectory` - Allow directories to be selected.
* `multiSelections` - Allow multiple paths to be selected.
* `showHiddenFiles` - Show hidden files in dialog.
* `showHiddenFiles` _macOS_ _Windows_ _Deprecated_ - Show hidden files in dialog. Deprecated on Linux.
* `createDirectory` _macOS_ - Allow creating new directories from dialog.
* `promptToCreate` _Windows_ - Prompt for creation if the file path entered
in the dialog does not exist. This does not actually create the file at
@@ -90,6 +97,15 @@ dialog.showOpenDialogSync(mainWindow, {
### `dialog.showOpenDialog([window, ]options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/16973
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `title` string (optional)
@@ -102,7 +118,7 @@ dialog.showOpenDialogSync(mainWindow, {
* `openFile` - Allow files to be selected.
* `openDirectory` - Allow directories to be selected.
* `multiSelections` - Allow multiple paths to be selected.
* `showHiddenFiles` - Show hidden files in dialog.
* `showHiddenFiles` _macOS_ _Windows_ _Deprecated_ - Show hidden files in dialog. Deprecated on Linux.
* `createDirectory` _macOS_ - Allow creating new directories from dialog.
* `promptToCreate` _Windows_ - Prompt for creation if the file path entered
in the dialog does not exist. This does not actually create the file at
@@ -171,6 +187,13 @@ dialog.showOpenDialog(mainWindow, {
### `dialog.showSaveDialogSync([window, ]options)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/17054
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `title` string (optional) - The dialog title. Cannot be displayed on some _Linux_ desktop environments.
@@ -185,7 +208,7 @@ dialog.showOpenDialog(mainWindow, {
* `showsTagField` boolean (optional) _macOS_ - Show the tags input box,
defaults to `true`.
* `properties` string[]&#32;(optional)
* `showHiddenFiles` - Show hidden files in dialog.
* `showHiddenFiles` _macOS_ _Windows_ _Deprecated_ - Show hidden files in dialog. Deprecated on Linux.
* `createDirectory` _macOS_ - Allow creating new directories from dialog.
* `treatPackageAsDirectory` _macOS_ - Treat packages, such as `.app` folders,
as a directory instead of a file.
@@ -202,6 +225,15 @@ The `filters` specifies an array of file types that can be displayed, see
### `dialog.showSaveDialog([window, ]options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/17054
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `title` string (optional) - The dialog title. Cannot be displayed on some _Linux_ desktop environments.
@@ -215,7 +247,7 @@ The `filters` specifies an array of file types that can be displayed, see
displayed in front of the filename text field.
* `showsTagField` boolean (optional) _macOS_ - Show the tags input box, defaults to `true`.
* `properties` string[]&#32;(optional)
* `showHiddenFiles` - Show hidden files in dialog.
* `showHiddenFiles` _macOS_ _Windows_ _Deprecated_ - Show hidden files in dialog. Deprecated on Linux.
* `createDirectory` _macOS_ - Allow creating new directories from dialog.
* `treatPackageAsDirectory` _macOS_ - Treat packages, such as `.app` folders,
as a directory instead of a file.
@@ -240,6 +272,13 @@ The `filters` specifies an array of file types that can be displayed, see
### `dialog.showMessageBoxSync([window, ]options)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/17298
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `message` string - Content of the message box.
@@ -283,6 +322,19 @@ If `window` is not shown dialog will not be attached to it. In such case it will
### `dialog.showMessageBox([window, ]options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/17298
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
- pr-url: https://github.com/electron/electron/pull/26102
description: "Added the `signal` option."
- pr-url: https://github.com/electron/electron/pull/30474
description: "Added the `textWidth` option."
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `message` string - Content of the message box.
@@ -344,11 +396,22 @@ Displays a modal dialog that shows an error message.
This API can be called safely before the `ready` event the `app` module emits,
it is usually used to report errors in early stage of startup. If called
before the app `ready`event on Linux, the message will be emitted to stderr,
before the app `ready` event on Linux, the message will be emitted to stderr,
and no GUI dialog will appear.
### `dialog.showCertificateTrustDialog([window, ]options)` _macOS_ _Windows_
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/9099
changes:
- pr-url: https://github.com/electron/electron/pull/17181
description: "This method now returns a Promise instead of using a callback function."
breaking-changes-header: api-changed-callback-based-versions-of-promisified-apis
```
-->
* `window` [BaseWindow](base-window.md) (optional)
* `options` Object
* `certificate` [Certificate](structures/certificate.md) - The certificate to trust/import.

View File

@@ -159,6 +159,22 @@ Notification activated (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76
Notification replied to (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76-F88EC9D73D44)
```
### `ELECTRON_DEBUG_MSIX_UPDATER`
Adds extra logs to MSIX updater operations on Windows to aid in debugging. Extra logging will be displayed when MSIX update operations are initiated, including package updates, package registration, and restart registration. This helps diagnose issues with MSIX package updates and deployments.
Sample output:
```sh
UpdateMsix called with URI: https://example.com/app.msix
DoUpdateMsix: Starting
Calling AddPackageByUriAsync... URI: https://example.com/app.msix
Update options - deferRegistration: true, developerMode: false, forceShutdown: false, forceTargetShutdown: false, forceUpdateFromAnyVersion: false
Waiting for deployment...
Deployment finished.
MSIX Deployment completed.
```
### `ELECTRON_LOG_ASAR_READS`
When Electron reads from an ASAR file, log the read offset and file path to
@@ -187,13 +203,13 @@ the one downloaded by `npm install`. Usage:
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
## Set By Electron
### `ELECTRON_SKIP_BINARY_DOWNLOAD`
Electron sets some variables in your environment at runtime.
If you want to install your project's dependencies but don't need to use Electron functionality,
you can set the `ELECTRON_SKIP_BINARY_DOWNLOAD` environment variable to prevent the binary from being
downloaded. For instance, this feature can be useful in continuous integration environments when
running unit tests that mock out the `electron` module.
### `ORIGINAL_XDG_CURRENT_DESKTOP`
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
to affect other logic within Chromium so if you want access to the _original_ value
you should look up this environment variable instead.
```sh
ELECTRON_SKIP_BINARY_DOWNLOAD=1 npm install
```

View File

@@ -57,7 +57,7 @@ The following methods are available on instances of `Extensions`:
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -83,7 +83,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.extensions.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -34,7 +34,7 @@ Returns:
* `error` Error - Typically holds an error string identifying failure root cause.
Emitted when an error was encountered while streaming response data events. For
instance, if the server closes the underlying while the response is still
instance, if the server closes the underlying connection while the response is still
streaming, an `error` event will be emitted on the response object and a `close`
event will subsequently follow on the request object.

View File

@@ -20,6 +20,12 @@ changes:
Process: [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `ipcRenderer` module is an [EventEmitter][event-emitter]. It provides a few
methods so you can send synchronous and asynchronous messages from the render
process (web page) to the main process. You can also receive replies from the

View File

@@ -17,7 +17,7 @@ See [`Menu`](menu.md) for examples.
* `options` Object
* `click` Function (optional) - Will be called with
`click(menuItem, window, event)` when the menu item is clicked.
* `menuItem` MenuItem
* `menuItem` [MenuItem](menu-item.md)
* `window` [BaseWindow](base-window.md) | undefined - This will not be defined if no window is open.
* `event` [KeyboardEvent](structures/keyboard-event.md)
* `role` string (optional) - Can be `undo`, `redo`, `cut`, `copy`, `paste`, `pasteAndMatchStyle`, `delete`, `selectAll`, `reload`, `forceReload`, `toggleDevTools`, `resetZoom`, `zoomIn`, `zoomOut`, `toggleSpellChecker`, `togglefullscreen`, `window`, `minimize`, `close`, `help`, `about`, `services`, `hide`, `hideOthers`, `unhide`, `quit`, `showSubstitutions`, `toggleSmartQuotes`, `toggleSmartDashes`, `toggleTextReplacement`, `startSpeaking`, `stopSpeaking`, `zoom`, `front`, `appMenu`, `fileMenu`, `editMenu`, `viewMenu`, `shareMenu`, `recentDocuments`, `toggleTabBar`, `selectNextTab`, `selectPreviousTab`, `showAllTabs`, `mergeAllWindows`, `clearRecentDocuments`, `moveTabToNewWindow` or `windowMenu` - Define the action of the menu item, when specified the
@@ -34,7 +34,8 @@ See [`Menu`](menu.md) for examples.
* `sublabel` string (optional) _macOS_ - Available in macOS >= 14.4
* `toolTip` string (optional) _macOS_ - Hover text for this menu item.
* `accelerator` string (optional) - An [Accelerator](../tutorial/keyboard-shortcuts.md#accelerators) string.
* `icon` ([NativeImage](native-image.md) | string) (optional)
* `icon` ([NativeImage](native-image.md) | string) (optional) - Can be a
[NativeImage](native-image.md) or the file path of an icon.
* `enabled` boolean (optional) - If false, the menu item will be greyed out and
unclickable.
* `acceleratorWorksWhenHidden` boolean (optional) _macOS_ - default is `true`, and when `false` will prevent the accelerator from triggering the item if the item is not visible.
@@ -72,13 +73,16 @@ The following properties are available on instances of `MenuItem`:
#### `menuItem.id`
A `string` indicating the item's unique id. This property can be
dynamically changed.
A `string` indicating the item's unique id.
This property can be dynamically changed.
#### `menuItem.label`
A `string` indicating the item's visible label.
This property can be dynamically changed.
#### `menuItem.click`
A `Function` that is fired when the MenuItem receives a click event.
@@ -90,7 +94,7 @@ It can be called with `menuItem.click(event, focusedWindow, focusedWebContents)`
#### `menuItem.submenu`
A `Menu` (optional) containing the menu
A [`Menu`](menu.md) (optional) containing the menu
item's submenu, if present.
#### `menuItem.type`
@@ -106,7 +110,7 @@ A `string` (optional) indicating the item's role, if set. Can be `undo`, `redo`,
#### `menuItem.accelerator`
An `Accelerator` (optional) indicating the item's accelerator, if set.
An `Accelerator | null` indicating the item's accelerator, if set.
#### `menuItem.userAccelerator` _Readonly_ _macOS_
@@ -117,31 +121,37 @@ An `Accelerator | null` indicating the item's [user-assigned accelerator](https:
#### `menuItem.icon`
A `NativeImage | string` (optional) indicating the
item's icon, if set.
A `NativeImage | string` (optional) indicating the item's icon, if set.
This property can be dynamically changed.
#### `menuItem.sublabel`
A `string` indicating the item's sublabel.
This property can be dynamically changed.
#### `menuItem.toolTip` _macOS_
A `string` indicating the item's hover text.
#### `menuItem.enabled`
A `boolean` indicating whether the item is enabled. This property can be
dynamically changed.
A `boolean` indicating whether the item is enabled.
This property can be dynamically changed.
#### `menuItem.visible`
A `boolean` indicating whether the item is visible. This property can be
dynamically changed.
A `boolean` indicating whether the item is visible.
This property can be dynamically changed.
#### `menuItem.checked`
A `boolean` indicating whether the item is checked. This property can be
dynamically changed.
A `boolean` indicating whether the item is checked.
This property can be dynamically changed.
A `checkbox` menu item will toggle the `checked` property on and off when
selected.
@@ -170,4 +180,4 @@ A `number` indicating an item's sequential unique id.
#### `menuItem.menu`
A `Menu` that the item is a part of.
A [`Menu`](menu.md) that the item is a part of.

View File

@@ -2,10 +2,15 @@
## Class: Menu
> Create native application menus and context menus.
> Create application menus and context menus.
Process: [Main](../glossary.md#main-process)
The presentation of menus varies depending on the operating system:
- Under Windows and Linux, menus are visually similar to Chromium.
- Under macOS, these will be native menus.
> [!TIP]
> See also: [A detailed guide about how to implement menus in your application](../tutorial/menus.md).
@@ -23,7 +28,7 @@ The `Menu` class has the following static methods:
#### `Menu.setApplicationMenu(menu)`
- `menu` Menu | null
- `menu` [Menu](menu.md) | null
Sets `menu` as the application menu on macOS. On Windows and Linux, the
`menu` will be set as each window's top menu.
@@ -34,7 +39,7 @@ indicate which letter should get a generated accelerator. For example, using
opens the associated menu. The indicated character in the button label then gets an
underline, and the `&` character is not displayed on the button label.
In order to escape the `&` character in an item name, add a proceeding `&`. For example, `&&File` would result in `&File` displayed on the button label.
In order to escape the `&` character in an item name, add a preceding `&`. For example, `&&File` would result in `&File` displayed on the button label.
Passing `null` will suppress the default menu. On Windows and Linux,
this has the additional effect of removing the menu bar from the window.
@@ -65,9 +70,9 @@ for more information on macOS' native actions.
#### `Menu.buildFromTemplate(template)`
- `template` (MenuItemConstructorOptions | MenuItem)[]
- `template` (MenuItemConstructorOptions | [MenuItem](menu-item.md))[]
Returns `Menu`
Returns [`Menu`](menu.md)
Generally, the `template` is an array of `options` for constructing a
[MenuItem](menu-item.md). The usage can be referenced above.

View File

@@ -4,6 +4,12 @@
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.
The `nativeImage` module provides a unified interface for manipulating
system images. These can be handy if you want to provide multiple scaled
versions of the same icon or take advantage of macOS [template images][template-image].
@@ -196,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
Returns `NativeImage`
Creates a new `NativeImage` instance from the `NSImage` that maps to the
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
documentation for a list of possible values.
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
The `hslShift` is applied to the image with the following rules:
@@ -225,6 +230,15 @@ echo -e '#import <Cocoa/Cocoa.h>\nint main() { NSLog(@"%@", SYSTEM_IMAGE_NAME);
where `SYSTEM_IMAGE_NAME` should be replaced with any value from [this list](https://developer.apple.com/documentation/appkit/nsimagename?language=objc).
For SF Symbols, usage looks as follows:
```js
const image = nativeImage.createFromNamedImage('square.and.pencil')
```
where `'square.and.pencil'` is the symbol name from the
[SF Symbols app](https://developer.apple.com/sf-symbols/).
## Class: NativeImage
> Natively wrap images such as tray, dock, and application icons.

View File

@@ -36,7 +36,7 @@ everything will be reset to the OS default. By default `themeSource` is `system
Settings this property to `dark` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `true` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the dark UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the dark UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the dark UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `dark` mode.
* The `updated` event will be emitted
@@ -44,7 +44,7 @@ Settings this property to `dark` will have the following effects:
Settings this property to `light` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `false` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the light UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the light UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the light UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `light` mode.
* The `updated` event will be emitted
@@ -83,4 +83,4 @@ Currently, Windows high contrast is the only system setting that triggers forced
### `nativeTheme.prefersReducedTransparency` _Readonly_
A `boolean` that indicates the whether the user has chosen via system accessibility settings to reduce transparency at the OS level.
A `boolean` that indicates whether the user has chosen via system accessibility settings to reduce transparency at the OS level.

View File

@@ -67,6 +67,22 @@ Emitted when the notification is shown to the user. Note that this event can be
multiple times as a notification can be shown multiple times through the
`show()` method.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('show', () => console.log('Notification shown!'))
n.show()
})
```
#### Event: 'click'
Returns:
@@ -75,11 +91,28 @@ Returns:
Emitted when the notification is clicked by the user.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('click', () => console.log('Notification clicked!'))
n.show()
})
```
#### Event: 'close'
Returns:
* `event` Event
* `details` Event\<\>
* `reason` _Windows_ string (optional) - The reason the notification was closed. This can be 'userCanceled', 'applicationHidden', or 'timedOut'.
Emitted when the notification is closed by manual intervention from the user.
@@ -88,21 +121,85 @@ is closed.
On Windows, the `close` event can be emitted in one of three ways: programmatic dismissal with `notification.close()`, by the user closing the notification, or via system timeout. If a notification is in the Action Center after the initial `close` event is emitted, a call to `notification.close()` will remove the notification from the action center but the `close` event will not be emitted again.
#### Event: 'reply' _macOS_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('close', () => console.log('Notification closed!'))
n.show()
})
```
#### Event: 'reply' _macOS_ _Windows_
Returns:
* `event` Event
* `reply` string - The string the user entered into the inline reply field.
* `details` Event\<\>
* `reply` string - The string the user entered into the inline reply field.
* `reply` string _Deprecated_
Emitted when the user clicks the "Reply" button on a notification with `hasReply: true`.
#### Event: 'action' _macOS_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Send a Message',
body: 'Body Text',
hasReply: true,
replyPlaceholder: 'Message text...'
})
n.on('reply', (e, reply) => console.log(`User replied: ${reply}`))
n.on('click', () => console.log('Notification clicked'))
n.show()
})
```
#### Event: 'action' _macOS_ _Windows_
Returns:
* `event` Event
* `index` number - The index of the action that was activated.
* `details` Event\<\>
* `actionIndex` number - The index of the action that was activated.
* `selectionIndex` number _Windows_ - The index of the selected item, if one was chosen. -1 if none was chosen.
* `actionIndex` number _Deprecated_
* `selectionIndex` number _Windows_ _Deprecated_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const items = ['One', 'Two', 'Three']
const n = new Notification({
title: 'Choose an Action!',
actions: [
{ type: 'button', text: 'Action 1' },
{ type: 'button', text: 'Action 2' },
{ type: 'selection', text: 'Apply', items }
]
})
n.on('click', () => console.log('Notification clicked'))
n.on('action', (e) => {
console.log(`User triggered action at index: ${e.actionIndex}`)
if (e.selectionIndex > -1) {
console.log(`User chose selection item '${items[e.selectionIndex]}'`)
}
})
n.show()
})
```
#### Event: 'failed' _Windows_
@@ -113,6 +210,22 @@ Returns:
Emitted when an error is encountered while creating and showing the native notification.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Bad Action'
})
n.on('failed', (e, err) => {
console.log('Notification failed: ', err)
})
n.show()
})
```
### Instance Methods
Objects created with the `new Notification()` constructor have the following instance methods:
@@ -126,12 +239,42 @@ call this method before the OS will display it.
If the notification has been shown before, this method will dismiss the previously
shown notification and create a new one with identical properties.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.show()
})
```
#### `notification.close()`
Dismisses the notification.
On Windows, calling `notification.close()` while the notification is visible on screen will dismiss the notification and remove it from the Action Center. If `notification.close()` is called after the notification is no longer visible on screen, calling `notification.close()` will try remove it from the Action Center.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.show()
setTimeout(() => n.close(), 5000)
})
```
### Instance Properties
#### `notification.title`

View File

@@ -71,7 +71,7 @@ will disable the support for `asar` archives in Node's built-in modules.
### `process.noDeprecation`
A `boolean` that controls whether or not deprecation warnings are printed to `stderr`.
A `boolean` (optional) that controls whether or not deprecation warnings are printed to `stderr`.
Setting this to `true` will silence deprecation warnings. This property is used
instead of the `--no-deprecation` command line flag.
@@ -99,13 +99,13 @@ property is used instead of the `--throw-deprecation` command line flag.
A `boolean` that controls whether or not deprecations printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for deprecations.
This property is instead of the `--trace-deprecation` command line flag.
This property is used instead of the `--trace-deprecation` command line flag.
### `process.traceProcessWarnings`
A `boolean` that controls whether or not process warnings printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for process warnings
(including deprecations). This property is instead of the `--trace-warnings` command
(including deprecations). This property is used instead of the `--trace-warnings` command
line flag.
### `process.type` _Readonly_
@@ -128,8 +128,8 @@ A `string` representing Electron's version string.
### `process.windowsStore` _Readonly_
A `boolean`. If the app is running as a Windows Store app (appx), this property is `true`,
for otherwise it is `undefined`.
A `boolean`. If the app is running as an MSIX package (including AppX for Windows Store),
this property is `true`, otherwise it is `undefined`.
### `process.contextId` _Readonly_

View File

@@ -110,6 +110,8 @@ Returns [`Point`](structures/point.md)
The current absolute position of the mouse pointer.
Not supported on Wayland (Linux).
> [!NOTE]
> The return value is a DIP point, not a screen physical point.

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session
@@ -939,14 +939,18 @@ session.fromPartition('some-partition').setPermissionRequestHandler((webContents
* `top-level-storage-access` - Allow top-level sites to request third-party cookie access on behalf of embedded content originating from another site in the same related website set using the [Storage Access API](https://developer.mozilla.org/en-US/docs/Web/API/Storage_Access_API).
* `usb` - Expose non-standard Universal Serial Bus (USB) compatible devices services to the web with the [WebUSB API](https://developer.mozilla.org/en-US/docs/Web/API/WebUSB_API).
* `deprecated-sync-clipboard-read` _Deprecated_ - Request access to run `document.execCommand("paste")`
* `fileSystem` - Access to read, write, and file management capabilities using the [File System API](https://developer.mozilla.org/en-US/docs/Web/API/File_System_API).
* `requestingOrigin` string - The origin URL of the permission check
* `details` Object - Some properties are only available on certain permission types.
* `embeddingOrigin` string (optional) - The origin of the frame embedding the frame that made the permission check. Only set for cross-origin sub frames making permission checks.
* `securityOrigin` string (optional) - The security origin of the `media` check.
* `mediaType` string (optional) - The type of media access being requested, can be `video`,
`audio` or `unknown`
`audio` or `unknown`.
* `requestingUrl` string (optional) - The last URL the requesting frame loaded. This is not provided for cross-origin sub frames making permission checks.
* `isMainFrame` boolean - Whether the frame making the request is the main frame
* `isMainFrame` boolean - Whether the frame making the request is the main frame.
* `filePath` string (optional) - The path of a `fileSystem` request.
* `isDirectory` boolean (optional) - Whether a `fileSystem` request is a directory.
* `fileAccessType` string (optional) - The access type of a `fileSystem` request. Can be `writable` or `readable`.
Sets the handler which can be used to respond to permission checks for the `session`.
Returning `true` will allow the permission and `false` will reject it. Please note that
@@ -968,6 +972,9 @@ session.fromPartition('some-partition').setPermissionCheckHandler((webContents,
})
```
> [!NOTE]
> `isMainFrame` will always be `false` for a `fileSystem` request as a result of Chromium limitations.
#### `ses.setDisplayMediaRequestHandler(handler[, opts])`
* `handler` Function | null
@@ -1209,7 +1216,7 @@ function createWindow () {
mainWindow.webContents.session.setBluetoothPairingHandler((details, callback) => {
bluetoothPinCallback = callback
// Send a IPC message to the renderer to prompt the user to confirm the pairing.
// Send an IPC message to the renderer to prompt the user to confirm the pairing.
// Note that this will require logic in the renderer to handle this message and
// display a prompt to the user.
mainWindow.webContents.send('bluetooth-pairing-request', details)
@@ -1257,7 +1264,7 @@ session.defaultSession.allowNTLMCredentialsForDomains('*')
Overrides the `userAgent` and `acceptLanguages` for this session.
The `acceptLanguages` must a comma separated ordered list of language codes, for
The `acceptLanguages` must be a comma separated ordered list of language codes, for
example `"en-US,fr,de,ko,zh-CN,ja"`.
This doesn't affect existing `WebContents`, and each `WebContents` can use
@@ -1505,7 +1512,7 @@ will not work on non-persistent (in-memory) sessions.
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -1531,7 +1538,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -9,6 +9,13 @@ For including the share menu as a submenu of other menus, please use the
## Class: ShareMenu
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25629
```
-->
> Create share menu on macOS.
Process: [Main](../glossary.md#main-process)

View File

@@ -0,0 +1,58 @@
# sharedTexture
> Import shared textures into Electron and converts platform specific handles into [`VideoFrame`](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame). Supports all Web rendering systems, and can be transferred across Electron processes. Read [here](../../shell/common/api/shared_texture/README.md) for more information.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
## Methods
The `sharedTexture` module has the following methods:
**Note:** Experimental APIs are marked as such and could be removed in the future.
### `sharedTexture.importSharedTexture(options)` _Experimental_
* `options` Object - Options for importing shared textures.
* `textureInfo` [SharedTextureImportTextureInfo](structures/shared-texture-import-texture-info.md) - The information of the shared texture to import.
* `allReferencesReleased` Function (optional) - Called when all references in all processes are released. You should keep the imported texture valid until this callback is called.
Imports the shared texture from the given options.
> [!NOTE]
> This method is only available in the main process.
Returns `SharedTextureImported` - The imported shared texture.
### `sharedTexture.sendSharedTexture(options, ...args)` _Experimental_
* `options` Object - Options for sending shared texture.
* `frame` [WebFrameMain](web-frame-main.md) - The target frame to transfer the shared texture to. For `WebContents`, you can pass `webContents.mainFrame`. If you provide a `webFrameMain` that is not a main frame, you'll need to enable `webPreferences.nodeIntegrationInSubFrames` for this, since this feature requires [IPC](https://www.electronjs.org/docs/latest/api/web-frame-main#frameipc-readonly) between main and the frame.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments to pass to the renderer process.
Send the imported shared texture to a renderer process. You must register a receiver at renderer process before calling this method. This method has a 1000ms timeout. Ensure the receiver is set and the renderer process is alive before calling this method.
> [!NOTE]
> This method is only available in the main process.
Returns `Promise<void>` - Resolves when the transfer is complete.
### `sharedTexture.setSharedTextureReceiver(callback)` _Experimental_
* `callback` Function\<Promise\<void\>\> - The function to receive the imported shared texture.
* `receivedSharedTextureData` Object - The data received from the main process.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments passed from the main process.
Set a callback to receive imported shared textures from the main process.
> [!NOTE]
> This method is only available in the renderer process.
## Properties
The `sharedTexture` module has the following properties:
### `sharedTexture.subtle` _Experimental_
A [`SharedTextureSubtle`](structures/shared-texture-subtle.md) property, provides subtle APIs for interacting with shared texture for advanced users.

View File

@@ -29,6 +29,14 @@ Show the given file in a file manager. If possible, select the file.
### `shell.openPath(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/20682
breaking-changes-header: api-changed-shellopenitem-is-now-shellopenpath
```
-->
* `path` string
Returns `Promise<string>` - Resolves with a string containing the error message corresponding to the failure if a failure occurred, otherwise "".
@@ -37,6 +45,18 @@ Open the given file in the desktop's default manner.
### `shell.openExternal(url[, options])`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/4508
description: "Added `activate` option."
- pr-url: https://github.com/electron/electron/pull/15065
description: "Added `workingDirectory` option."
- pr-url: https://github.com/electron/electron/pull/37139
description: "Added `logUsage` option."
```
-->
* `url` string - Max 2081 characters on Windows.
* `options` Object (optional)
* `activate` boolean (optional) _macOS_ - `true` to bring the opened application to the foreground. The default is `true`.
@@ -50,6 +70,14 @@ Open the given external protocol URL in the desktop's default manner. (For examp
### `shell.trashItem(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25114
breaking-changes-header: deprecated-shellmoveitemtotrash
```
-->
* `path` string - path to the item to be moved to the trash.
Returns `Promise<void>` - Resolves when the operation has been completed.
@@ -58,6 +86,10 @@ Rejects if there was an error while deleting the requested item.
This moves a path to the OS-specific trash location (Trash on macOS, Recycle
Bin on Windows, and a desktop-environment-specific location on Linux).
The path must use the default path separator for the platform (backslash on
Windows). Use `path.resolve()` from the `node:path` module to ensure correct
handling on all filesystems.
### `shell.beep()`
Play the beep sound.

View File

@@ -72,6 +72,9 @@
some GTK+3 desktop environments. Default is `false`.
* `transparent` boolean (optional) - Makes the window [transparent](../../tutorial/custom-window-styles.md#transparent-windows).
Default is `false`. On Windows, does not work unless the window is frameless.
When you add a [`View`](../view.md) to a `BaseWindow`, you'll need to call
[`view.setBackgroundColor`](../view.md#viewsetbackgroundcolorcolor) with a transparent
background color on that view to make its background transparent as well.
* `type` string (optional) - The type of window, default is normal window. See more about
this below.
* `visualEffectState` string (optional) _macOS_ - Specify how the material
@@ -99,12 +102,13 @@
* `trafficLightPosition` [Point](point.md) (optional) _macOS_ -
Set a custom position for the traffic light buttons in frameless windows.
* `roundedCorners` boolean (optional) _macOS_ _Windows_ - Whether frameless window
should have rounded corners. Default is `true`. Setting this property
to `false` will prevent the window from being fullscreenable on macOS.
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
* `thickFrame` boolean (optional) - Use `WS_THICKFRAME` style for frameless windows on
Windows, which adds standard window frame. Setting it to `false` will remove
window shadow and window animations. Default is `true`.
should have rounded corners. Default is `true`. On Windows versions older than
Windows 11 Build 22000 this property has no effect, and frameless windows will
not have rounded corners.
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
frameless windows on Windows, which adds the standard window frame. Setting it
to `false` will remove window shadow and window animations, and disable window
resizing via dragging the window edges. Default is `true`.
* `vibrancy` string (optional) _macOS_ - Add a type of vibrancy effect to
the window, only on macOS. Can be `appearance-based`, `titlebar`, `selection`,
`menu`, `popover`, `sidebar`, `header`, `sheet`, `window`, `hud`, `fullscreen-ui`,

View File

@@ -7,7 +7,7 @@
* `depthPerComponent` number - The number of bits per color component.
* `detected` boolean - `true` if the display is detected by the system.
* `displayFrequency` number - The display refresh rate.
* `id` number - Unique identifier associated with the display. A value of of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `id` number - Unique identifier associated with the display. A value of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `internal` boolean - `true` for an internal display and `false` for an external display.
* `label` string - User-friendly label, determined by the platform.
* `maximumCursorSize` [Size](size.md) - Maximum cursor size in native pixels.

View File

@@ -1,13 +1,15 @@
# NotificationAction Object
* `type` string - The type of action, can be `button`.
* `type` string - The type of action, can be `button` or `selection`. `selection` is only supported on Windows.
* `text` string (optional) - The label for the given action.
* `items` string[] (optional) _Windows_ - The list of items for the `selection` action `type`.
## Platform / Action Support
| Action Type | Platform Support | Usage of `text` | Default `text` | Limitations |
|-------------|------------------|-----------------|----------------|-------------|
| `button` | macOS | Used as the label for the button | "Show" (or a localized string by system default if first of such `button`, otherwise empty) | Only the first one is used. If multiple are provided, those beyond the first will be listed as additional actions (displayed when mouse active over the action button). Any such action also is incompatible with `hasReply` and will be ignored if `hasReply` is `true`. |
| `button` | macOS, Windows | Used as the label for the button | "Show" on macOS (localized) if first `button`, otherwise empty; Windows uses provided `text` | macOS: Only the first one is used as primary; others shown as additional actions (hover). Incompatible with `hasReply` (beyond first ignored). |
| `selection` | Windows | Used as the label for the submit button for the selection menu | "Select" | Requires an `items` array property specifying option labels. Emits the `action` event with `(index, selectedIndex)` where `selectedIndex` is the chosen option (>= 0). Ignored on platforms that do not support selection actions. |
### Button support on macOS
@@ -15,6 +17,37 @@ In order for extra notification buttons to work on macOS your app must meet the
following criteria.
* App is signed
* App has it's `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
* App has its `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
If either of these requirements are not met the button won't appear.
### Selection support on Windows
To add a selection (combo box) style action, include an action with `type: 'selection'`, a `text` label for the submit button, and an `items` array of strings:
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const items = ['One', 'Two', 'Three']
const n = new Notification({
title: 'Choose an option',
actions: [{
type: 'selection',
text: 'Apply',
items
}]
})
n.on('action', (e) => {
console.log(`User triggered action at index: ${e.actionIndex}`)
if (e.selectionIndex > 0) {
console.log(`User chose selection item '${items[e.selectionIndex]}'`)
}
})
n.show()
})
```
When the user activates the selection action, the notification's `action` event will be emitted with two parameters: `actionIndex` (the action's index in the `actions` array) and `selectedIndex` (the zero-based index of the chosen item, or `-1` if unavailable). On non-Windows platforms selection actions are ignored.

View File

@@ -2,7 +2,10 @@
* `textureInfo` Object - The shared texture info.
* `widgetType` string - The widget type of the texture. Can be `popup` or `frame`.
* `pixelFormat` string - The pixel format of the texture. Can be `rgba` or `bgra`.
* `pixelFormat` string - The pixel format of the texture.
* `rgba` - The texture format is 8-bit unorm RGBA.
* `bgra` - The texture format is 8-bit unorm BGRA.
* `rgbaf16` - The texture format is 16-bit float RGBA.
* `codedSize` [Size](size.md) - The full dimensions of the video frame.
* `colorSpace` [ColorSpace](color-space.md) - The color space of the video frame.
* `visibleRect` [Rectangle](rectangle.md) - A subsection of [0, 0, codedSize.width, codedSize.height]. In OSR case, it is expected to have the full section area.

Some files were not shown because too many files have changed in this diff Show More