Compare commits

..

360 Commits

Author SHA1 Message Date
Shelley Vohr
198616a396 src: throw RangeError on failed ArrayBuffer BackingStore allocation
https://github.com/nodejs/node/pull/61480
2026-02-26 08:25:28 +01:00
Shelley Vohr
bb4ef34a43 test: use fixture directories for sea tests
https://github.com/nodejs/node/pull/61167
2026-02-25 19:09:50 +01:00
Shelley Vohr
040788ce62 chore: fixup patch indices 2026-02-25 17:11:59 +01:00
Shelley Vohr
2d5fb12c8a build,deps: replace cjs-module-lexer with merve
https://github.com/nodejs/node/pull/61456
2026-02-25 17:11:59 +01:00
Shelley Vohr
2be4de1057 lib: prefer call() over apply() if argument list is not array
https://github.com/nodejs/node/pull/60796
2026-02-25 15:58:24 +01:00
electron-roller[bot]
29d7e62a10 chore: bump node in DEPS to v24.14.0 2026-02-25 15:03:13 +01:00
David Sanders
fd9bf54243 build: fix Chromium roll linting merge base determination in CI (#49937) 2026-02-25 08:38:31 -05:00
John Kleinschmidt
d9170093aa build: exit upload with error code if github upload fails (#49936) 2026-02-25 14:16:13 +01:00
David Sanders
aca83afeef ci: add maintainer /request-review command (#49927)
Assisted-by: Claude Opus 4.6
2026-02-24 20:13:37 -08:00
electron-roller[bot]
e5d3fbf6dc chore: bump chromium to 147.0.7699.0 (main) (#49831)
* chore: bump chromium in DEPS to 147.0.7693.0

* chore: bump chromium in DEPS to 147.0.7694.0

* chore: bump chromium in DEPS to 147.0.7695.0

* chore: bump chromium in DEPS to 147.0.7697.0

* chore: bump chromium in DEPS to 147.0.7698.0

* fix(patch): IsGuest moved to SecurityPrincipal

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234613

Co-Authored-By: Claude (claude-opus-4-6)

* chore: update patches (trivial only)

* fix(patch): v8::External API now requires ExternalPointerTypeTag

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7562476

Co-Authored-By: Claude (claude-opus-4-6)

* fix: update CreateCustomWebContents signature

Upstream added disposition and window_features parameters.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7585256

Co-Authored-By: Claude (claude-opus-4-6)

* fix: OriginatingProcess renamed to OriginatingProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7557820

Co-Authored-By: Claude (claude-opus-4-6)

* fix: kLogNetLog moved from network::switches to net::switches

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7559090

Co-Authored-By: Claude (claude-opus-4-6)

* fix(patch): patch out glic and save-to-drive Profile usage in PDF

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7589312

Co-Authored-By: Claude (claude-opus-4-6)

* chore: bump chromium in DEPS to 147.0.7699.0

* chore: remove upstreamed pseudonymization salt descriptor code

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7568382

Co-Authored-By: Claude (claude-opus-4-6)

* chore: update patches (trivial only)

* chore: update reclient patch format (copy-from to new-file)

Co-Authored-By: Claude (claude-opus-4-6)

* chore: remove upstreamed patch and update stale patches

Co-Authored-By: Claude (claude-opus-4-6)

* fix: expose GetLibGdk3 and guard glic function body

GetLibGdk3 needs to be public for Electron's gdk_display_beep usage.
ShouldShowGlicSummarizeButton body must be guarded, not just call site.

Co-Authored-By: Claude (claude-opus-4-6)

* fix(patch): v8::External API in nan requires ExternalPointerTypeTag

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7562476

Co-Authored-By: Claude (claude-opus-4-6)

* fixup fix(patch): v8::External API in nan requires ExternalPointerTypeTag

* fixup: remove extraneous changes to patches

Caused by
debb371681
6e51034728

* fixup: revert fix: expose GetLibGdk3 and guard glic function body

Reverts 6e51034728 as this was an unneeded changed caused by the incorrect changes made in debb371681

* 7586673: Update logic for showing pdf summarize button

7586673: Update logic for showing pdf summarize button | https://chromium-review.googlesource.com/c/chromium/src/+/7586673

Also 7454131: set enable_glic=true | https://chromium-review.googlesource.com/c/chromium/src/+/7454131 (landed in previous roll)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-24 16:42:05 -05:00
Shelley Vohr
0aaea4eaa0 fix: crash after win.showAllTabs() new tab (#49917)
fix: crash after win.showAllTabs new tab
2026-02-24 16:09:09 -05:00
dependabot[bot]
818b28410f build(deps): bump github/codeql-action from 4.32.3 to 4.32.4 (#49925)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.3 to 4.32.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](9e907b5e64...89a39a4e59)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.4
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-24 16:13:04 +01:00
David Sanders
25db585a23 docs: fix some string enum typings (#49923) 2026-02-24 16:11:22 +01:00
dependabot[bot]
02eed1ec0b build(deps): bump actions/stale from 10.1.1 to 10.2.0 (#49924)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.1 to 10.2.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](997185467f...b5d41d4e1d)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.2.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-24 16:11:18 +01:00
Mitchell Cohen
acd01e15e2 fix: prevent crash on Windows when closing child windows (#49901)
* guard against window destruction in min/max size checks

* use weakptr to prevent hit test crash on teardown

* revove web contents views during teardown

* fix test failure

* fix other tests
2026-02-24 15:48:04 +01:00
David Sanders
fc3a0abf19 build: fix roller branch detection in CI (#49920) 2026-02-23 18:10:22 -08:00
David Sanders
fa2b9ac466 ci: fix checking latest release for website docs update (#49918) 2026-02-23 15:22:01 -08:00
Andre Hora
481e224992 docs: remove documentation link to discontinued Touch Bar Simulator (#49899)
Remove link to discontinued Touch Bar Simulator

https://github.com/sindresorhus/touch-bar-simulator is archived.

> This app is discontinued as it no longer works because of changes in macOS.
2026-02-23 15:04:31 -05:00
Shashwat Raj
90c9de70ac fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)
Updated Alt detection to explicitly exclude AltGraph/AltGr
2026-02-23 13:00:27 -05:00
Shelley Vohr
9d0a0a5459 fix: apply zoomFactor from setWindowOpenHandler to window.open() windows (#49886)
fix: apply zoomFactor from setWindowOpenHandler to window.open() windows
2026-02-23 09:02:48 +01:00
Erick Zhao
19d0c072d5 feat: lazy electron download (#49328)
* feat: lazy electron download

* better error messaging?

* add breaking changes script doc

* add binary download step to install instructions

* respect no binary env var
2026-02-20 15:35:38 -05:00
redeemer
2b80f4ccc9 fix: prevent GBytes leak in GdkPixbufFromSkBitmap on Linux/GTK (#49863)
Inside gtk_util::GdkPixbufFromSkBitmap, g_bytes_new() was called
inline as an argument to gdk_pixbuf_new_from_bytes(), which per
GTK docs does not take ownership of the GBytes - it adds its own
internal reference. The caller's GBytes* was never stored or
unreffed, leaking 4 x width x height bytes of pixel data on every
call.
2026-02-20 15:00:46 -05:00
Shelley Vohr
5795689fd9 fix: fullscreen restoration on Windows (#49872) 2026-02-20 11:58:37 -05:00
Shelley Vohr
3e58c6cb3a fix: refresh menu item state on key equivalent dispatch (#49875) 2026-02-20 11:35:44 -05:00
Mitchell Cohen
ea89ba5b8d feat: Shadows and CSD for frameless windows on Wayland (#49295)
* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* layout helper

* CSD shadows for frameless windows on Linux

* simplify min/max size calculation

* use base window size for min/max

* respect HasShadow option

* moved windows min/max size overrides

* add newline at end of file

* fix setting background color for frameless csd windows

* fix wco positioning nad sizing to match prod

* safety improvements
2026-02-19 18:53:13 -06:00
Niklas Wenzel
5ddd8a0200 feat: add support for --experimental-transform-types (#49711)
* feat: add support for `--experimental-transform-types`

* chore: add tests

* docs: add `--experimental-transform-types` to docs
2026-02-19 20:27:49 +01:00
Nilay Arya
8b81bfda8f ci: log mocha retries in spec runner (#49150) 2026-02-19 11:30:46 -05:00
reito
491fa0442b fix: rgbaf16 shared texture remove keyed mutex. (#49798)
* fix: rgbaf16 shared texture remove keyed mutex.

* fix: rgbaf16 patch.

* 更新 shared-texture-handle.md

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-19 11:28:53 -05:00
Shelley Vohr
b508510cab fix: update DBus signal signature for XDG GlobalShortcuts portal (#49842) 2026-02-19 15:22:27 +01:00
David Sanders
469b2af0c0 chore: use relative links from docs/ to files outside of docs/ (#49605) 2026-02-19 01:15:27 -08:00
Noah Gregory
61b3d5d63c refactor: initialize libgdk stubs before use in platform_util:Beep (#49680)
* refactor: initialize libgdk stubs before use in `platform_util:Beep`

* feat: add upstream function to get libgdk handle

* fix: add missing include for libgdk support

* style: adjust comment wording and make linter happy

* style: make linter actually happy
2026-02-19 09:59:10 +01:00
reito
1e437c9a18 feat: use 1.0f as default for offscreen scale factor. (#49683) 2026-02-19 09:58:29 +01:00
David Sanders
efb3fd98c6 build: lint commits on Chromium roller branches (#49655)
* build: lint commits on Chromium roller branches

Assisted-By: Claude Opus 4.5

* chore: add ability to skip linting CLs by adding #nolint

* chore: only exit with non-zero exit code in CI
2026-02-18 20:45:44 -08:00
Shelley Vohr
9ca9311b73 docs: note required windows in 'new-window-for-tab' event (#49851)
docs: note required windows in new-window-for-tab
2026-02-18 19:30:43 -08:00
Samuel Attard
8b05717661 docs: clarify ASAR integrity is supported in MAS builds (#49852)
* docs: clarify ASAR integrity is supported in MAS builds

Add a note to the ASAR integrity documentation explicitly stating
that this feature is fully supported and recommended in Mac App
Store builds. While MAS-installed apps have system-level protections,
ASAR integrity provides an additional security layer and is important
for MAS builds distributed outside the Mac App Store.

Slack thread: https://electronhq.slack.com/archives/CB6CG54DB/p1771449093872419?thread_ts=1771446183.473289&cid=CB6CG54DB

https://claude.ai/code/session_01A97nfiqHUVxLNaQyHVXS7j

* docs: clarify ASAR integrity support for MAS builds

Updates the ASAR integrity documentation to explicitly mention that
it is supported and recommended in Mac App Store builds. Clarifies
that while MAS-installed apps have system-level protections (Resources
folder owned by root), ASAR integrity is especially important when
distributing MAS builds through other channels like direct download,
since those installations won't have the read-only protections.

https://claude.ai/code/session_012mBNZQW34h91NRcdFaLxNh

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-02-18 14:14:00 -08:00
John Kleinschmidt
be45b5f8e7 ci: fixup build stats upload on Windows (#49845) 2026-02-18 15:00:30 -05:00
dependabot[bot]
87597a99de build(deps-dev): bump webpack from 5.95.0 to 5.104.1 in the npm_and_yarn group across 1 directory (#49779)
build(deps-dev): bump webpack

Bumps the npm_and_yarn group with 1 update in the / directory: [webpack](https://github.com/webpack/webpack).


Updates `webpack` from 5.95.0 to 5.104.1
- [Release notes](https://github.com/webpack/webpack/releases)
- [Changelog](https://github.com/webpack/webpack/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack/compare/v5.95.0...v5.104.1)

---
updated-dependencies:
- dependency-name: webpack
  dependency-version: 5.104.1
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-18 14:22:25 -05:00
Shelley Vohr
3ed52a3ded build: roll sysroots (#49844) 2026-02-18 13:24:29 -05:00
Shelley Vohr
dfdf04976e fix: draggable region position with docked DevTools (#49822) 2026-02-18 11:49:18 -05:00
Shelley Vohr
f4ba25a3da fix: frameless window resize in MAS builds (#49780) 2026-02-18 10:35:10 -05:00
Robo
05061544ab feat: enable WASM trap handlers in all Node.js processes (#48983)
fix: enable WASM trap handlers in all Node.js processes

```
Original reason for revert:

Some apps started throwing exception on startup
https://github.com/electron/electron/issues/48956
```

We now move the trap handler registeration before
any user script execution. Add a fuse to support
disabling the feature is application needs to run
in memory constrained environments.
2026-02-18 12:08:03 +09:00
Sam Maddock
10566c2d5f test: MAS for private API usage (#49712) 2026-02-17 15:29:21 -05:00
Mitchell Cohen
931c257de7 fix: accurate window sizing and support for content sizing on Linux/Wayland with CSD (#49209)
* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* simplify min/max size calculation

* use base window size for min/max

* moved windows min/max size overrides

* remove unnecessary checks for client frame

* cleanup
2026-02-17 15:23:54 -05:00
Ronald Eddy Jr
459a88f788 docs: fix typos across tutorial documentation (#49736) 2026-02-17 14:47:45 -05:00
electron-roller[bot]
c98cf69f40 chore: bump chromium to 147.0.7687.0 (main) (#49782)
* chore: bump chromium in DEPS to 147.0.7683.0

* fix(patch): constant moved to header

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* fix(patch): occlusion simplification upstream

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7563790

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: remove upstreamed patches

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: bump chromium in DEPS to 147.0.7685.0

* fix(patch): V1 Keychain removal

Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted

keychain_password_mac.mm to use KeychainV2 APIs.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7535923: Rename ozone buildflags

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7528398: [LNA] Rename PNA-named files to LNA-named files

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528398

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7534194: Convert some functions in ui::Clipboard to async

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7544580: [DevTools] Add command to restart Chrome to DevTools UI bindings

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7544580

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: bump chromium in DEPS to 147.0.7687.0

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: incorporate learnings into claude skill

I asked Claude to reflect on our upgrade session, consider what it learned and should know in the future, and to update its skill documents.

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-02-17 14:25:21 -05:00
John Kleinschmidt
0da0c3a47e build: use spawn instead of spawnSync for build (#49774) 2026-02-17 13:24:19 -05:00
John Kleinschmidt
f19cfce430 chore: add Copilot CLI instructions (#49784)
chore: add copilot-instructions
2026-02-17 09:49:59 -05:00
dependabot[bot]
ca61f2d7df build(deps): bump actions-cool/issues-helper from 3.7.5 to 3.7.6 (#49813)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.5 to 3.7.6.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](e2ff99831a...71b62d7da7)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-17 11:24:20 +01:00
dependabot[bot]
1322bee878 build(deps): bump github/codeql-action from 4.32.2 to 4.32.3 (#49814)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.2 to 4.32.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](45cbd0c69e...9e907b5e64)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-17 11:24:06 +01:00
Samuel Attard
dda71a464c chore: add PR Notes section requirement to CLAUDE.md (#49816)
docs: add PR Notes section requirement to CLAUDE.md

Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-02-17 01:02:52 -08:00
Shelley Vohr
a056c63fd8 fix: excise abort_report_np usage in MAS (#49726)
* fix: excise abort_report_np usage in MAS

* chore: fix it harder
2026-02-16 12:23:53 +01:00
reito
bf3eb098bd fix: missing shared texture docs (#49797) 2026-02-16 10:51:31 +01:00
Shelley Vohr
67cced1270 build: remove *.star files (#49796) 2026-02-16 10:49:39 +01:00
Shelley Vohr
eb29568e45 feat: introduce os_crypt_async in safeStorage (#49054)
* feat: support Freedesktop Secret Service OSCrypt client

Refs https://issues.chromium.org/issues/40086962
Refs https://issues.chromium.org/issues/447372315

* chore: rework to async interface

* refactor: allow customizing freedesktop config

* docs: add more async impl info

* refactor: reject when temporarily unavailable

* chore: feedback from review

* chore: push_back => emplace_back
2026-02-15 19:54:50 +01:00
Shelley Vohr
dcdbb0397e feat: allow defaulting to printer default page size (#49523)
Co-authored-by: Edvan de Matos <edvan.santos@querodelivery.com>
2026-02-13 07:40:14 -05:00
electron-roller[bot]
3a5f9e0a33 chore: bump node to v24.13.1 (main) (#49744)
* chore: bump node in DEPS to v24.13.1

* chore: fixup patches

refs:
* https://github.com/nodejs/node/pull/60425
* https://github.com/nodejs/node/pull/61270
* https://github.com/nodejs/node/pull/61044

* fix: generate_config_gypi needs to generate valid JSON

https://github.com/nodejs/node/pull/60794

* doc: align Buffer.concat documentation with behavior

https://github.com/nodejs/node/pull/60405

* src: fix off-thread cert loading in bundled cert mode

https://github.com/nodejs/node/pull/60764

* build: fix extraneous includes

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-13 09:48:05 +01:00
Keeley Hammond
f90e35cb45 chore: cherry-pick e045399a1ecb from chromium (#49788)
* chore: cherry-pick e045399a1ecb from chromium

* chore: update patch
2026-02-12 19:24:19 -08:00
Shelley Vohr
74fd10450f feat: improve Windows Toast actions support (#48132)
* feat: improve Windows Toast actions support

* fix: ensure MSIX compatibility

* test: add bad clsid format test
2026-02-12 17:25:20 -05:00
electron-roller[bot]
a65cfed500 chore: bump chromium to 146.0.7666.0 (main) (#49528)
* chore: bump chromium in DEPS to 146.0.7652.0

* fix(patch-conflict): update mas_avoid_private_macos_api_usage context for constrainFrameRect method

The upstream CL added a new constrainFrameRect:toScreen: method override to
NativeWidgetMacNSWindow as part of headless mode window zoom implementation.
The MAS patch's #endif for frameViewClassForStyleMask now correctly appears
after that method, since constrainFrameRect is a public API override that
doesn't need to be guarded.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7487666

* fix(patch-conflict): update printing.patch for base::DictValue rename

Updated printing.patch to use the new base::DictValue type name instead of
base::Value::Dict following Chromium's type renaming change. This affects
CompleteUpdatePrintSettings() signature and related code.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* fix(patch-conflict): update accessibility_ui patch for base::DictValue/ListValue rename

Updated adjust_accessibility_ui_for_electron.patch to use the new
base::DictValue and base::ListValue type names instead of base::Value::Dict
and base::Value::List following Chromium's type renaming change.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* chore: update patches

* 6625736: Rename DURABLE_STORAGE to PERSISTENT_STORAGE for consistency | https://chromium-review.googlesource.com/c/chromium/src/+/6625736

* chore: bump chromium in DEPS to 146.0.7653.0

* chore: update patches

* 7000847: add type tag to v8::External for gin_helper function templates

The upstream gin function templates now use v8::ExternalPointerTypeTag
for type safety when using v8::External. Updated Electron's forked
gin_helper function template to use the same kGinInternalCallbackHolderBaseTag
that Chromium's gin uses.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* fix(patch-update): extend V8 Object API deprecation patch for Node.js

Extended the existing patch to cover additional files that use
GetAlignedPointerFromInternalField and SetAlignedPointerInInternalField:
- src/stream_base-inl.h
- src/udp_wrap.cc
- src/js_udp_wrap.cc
- src/node_process_methods.cc
- src/node_snapshotable.cc
- src/base_object.cc

These APIs now require an EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* 7000847: add type tag to v8::External calls in shared_texture

Updated v8::External::New and v8::External::Value calls to use the
kExternalPointerTypeTagDefault tag as required by the V8 API change
that deprecates the tagless versions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* 7508687: use ChildProcessId for file permission APIs

The ChildProcessSecurityPolicy::CanReadFile and GrantReadFile APIs
now require ChildProcessId instead of int. Updated to use GetID()
instead of GetDeprecatedID() for these specific calls.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7508687

* 7000847: add type tag to v8::External calls in callback and osr_converter

The v8::External API now requires an EmbedderPointerTypeTag parameter
for both New() and Value() methods to improve V8 sandbox type safety.

Updated calls in:
- callback.cc: TranslatorHolder constructor and CallTranslator
- osr_converter.cc: OffscreenSharedTextureValue converter

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7000847

* fixup! 7087956: [api] Promote deprecation of v8::Context and v8::Object API methods

Extended the Node.js patch to cover histogram.cc which also uses
SetAlignedPointerInInternalField and GetAlignedPointerFromInternalField
APIs that now require the EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* chore: bump chromium in DEPS to 146.0.7655.0

* chore: update patches

* 7509043: update WebSpellingMarker type for API change

The upstream Chromium API changed - WebSpellingMarker was moved from a
nested type within WebTextCheckClient to a standalone type in the blink
namespace.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509043

* 7498491: update process_id to use OriginatingProcess type

The upstream Chromium API changed - URLLoaderFactoryParams::process_id
was changed from an integer to a union type network::OriginatingProcess
that distinguishes between browser and renderer processes.

- For browser process requests, use OriginatingProcess::browser()
- For renderer process lookups, check !is_browser() and use
  renderer_process().value() to get the child_id

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7498491

* 5710330: Add crash keys to debug NativeWidgetMacNSWindowBorderlessFrame exception | https://chromium-review.googlesource.com/c/chromium/src/+/5710330

5710330 added a new NSNextStepFrame interface extension and
implementations for NativeWidgetMacNSWindowTitledFrame and
NativeWidgetMacNSWindowBorderlessFrame. These use private macOS APIs
that are not available in Mac App Store builds.

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7661.0

* chore: bump chromium in DEPS to 146.0.7663.0

* fix(patch-conflict): update accessibility_ui for string_view API change

Upstream removed redundant std::string(default_api_type) conversion as part
of a string_view optimization cleanup. Updated patch context to match.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7514107

* fix(patch-conflict): update service process launch options for sandbox API refactor

Upstream removed content/common/sandbox_init_win.cc and
content/public/common/sandbox_init_win.h, moving the functionality directly
into ChildProcessLauncherHelper. Updated patch to call
sandbox::policy::SandboxWin::StartSandboxedProcess directly with the
LaunchOptions pointer instead of going through the removed helper.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528253

* fix(patch-conflict): update MAS safestorage for keychain API refactor

Upstream refactored KeychainPassword::GetPassword() to use a new
GetPasswordImpl() helper function with improved error tracking via
base::expected<std::string, OSStatus>. Adapted patch to use the new
GetPasswordImpl with the suffixed account name and handle migration
from legacy accounts through the new API.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7516438

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7663.0

* fix: base::Value::Dict -> base::DictValue
https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: include new cookie exclusion reason
https://chromium-review.googlesource.com/c/chromium/src/+/7486527

* fix: enable libc++ ABI flag for trivially copyable std::vector<bool>

Required for changes introduced in the following CL
https://chromium-review.googlesource.com/c/chromium/src/+/7513653

* fixup! fix: base::Value::Dict -> base::DictValue https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: spellcheck not working in tests
https://chromium-review.googlesource.com/c/chromium/src/+/7452579

* fix: cookie test failing due to multiple rejection reasons
https://chromium-review.googlesource.com/c/chromium/src/+/7506629

* fix: macos sizing unmaximized window incorrectly
https://chromium-review.googlesource.com/c/chromium/src/+/7487666

Changes to headless mode caused the unmaximized window to subtract
the height of the menubar.

* fix: skip tests for incompatible BoringSSL ML-DSA crypto
https://boringssl-review.googlesource.com/c/boringssl/+/84929

* test: fix pseudonymization registration in utility process on Linux

Ref: 7486913: Pass pseudonymization salt via shared memory at process launch | https://chromium-review.googlesource.com/c/chromium/src/+/7486913

* fix: restore MAS patch-outs

Restores some `#if !IS_MAS_BUILD()` gates dropped in 773054ad59

* fixup! 7508687: use ChildProcessId for file permission APIs

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

* chore: add note about parallel upstream change

* fixup! Merge remote-tracking branch 'origin/main' into roller/chromium/main

* Revert "fixup! 7508687: use ChildProcessId for file permission APIs"

This reverts commit 05c43e4e5d.

The _impl version has the signature, but not the public interface. :oof:

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
2026-02-12 12:37:56 -05:00
Calvin
e9faa14cc0 test: drag region tests (#49266) 2026-02-12 01:50:02 -06:00
Niklas Wenzel
ce47542ccd feat: add support for long-animation-frame script attribution (#49706)
* feat: add support for `long-animation-frame` script attribution

* docs: document `AlwaysLogLOAFURL`

* chore: add test

* docs: adjust docs as per PR comment

* fix: test failures

* chore: simplify test

* fix: tests on Windows and Linux
2026-02-11 09:34:22 -08:00
dependabot[bot]
ff2df2c98a build(deps): bump diff from 3.5.0 to 3.5.1 in the npm_and_yarn group across 1 directory (#49666)
build(deps): bump diff in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [diff](https://github.com/kpdecker/jsdiff).


Updates `diff` from 3.5.0 to 3.5.1
- [Changelog](https://github.com/kpdecker/jsdiff/blob/master/release-notes.md)
- [Commits](https://github.com/kpdecker/jsdiff/compare/v3.5.0...v3.5.1)

---
updated-dependencies:
- dependency-name: diff
  dependency-version: 3.5.1
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-11 16:52:05 +01:00
John Kleinschmidt
0284b9afcc build: fixup attestation for release assets (#49732)
* build: fixup attestation for release assets

* Generate artifact attestation for generated artifacts

* set id-token for attestation

* Add artifact-metadata permission for attestation

* add permissions for testing attestations

* Revert "add permissions for testing attestations"

This reverts commit 0284bed175.

* Revert "set id-token for attestation"

This reverts commit 69a1b13a18.

* Revert "Generate artifact attestation for generated artifacts"

This reverts commit ee0536eceb.
2026-02-11 07:17:59 -05:00
David Sanders
52061b4c28 ci: add markdownlint problem matcher (#49751) 2026-02-11 13:17:29 +01:00
David Sanders
ec6d2fe549 build(dev-deps): update micromark-core-commonmark to 2.0.3 (#49749) 2026-02-11 13:11:58 +01:00
Ronald Eddy Jr
1c621cc982 docs: fix typos across documentation (#49734)
Fix 40 typos across 25 documentation files including misspellings,
missing words, doubled words, wrong words, and grammatical errors.
2026-02-11 12:45:46 +01:00
Shelley Vohr
57a6e43025 fix: revoke Read access after removing file via FileSystemAccess API (#49620)
Refs https://chromium-review.googlesource.com/6677249
2026-02-10 15:48:05 +01:00
dependabot[bot]
ef5b232e9f build(deps): bump github/codeql-action from 4.32.1 to 4.32.2 (#49735)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.1 to 4.32.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](6bc82e05fd...45cbd0c69e)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-10 15:06:42 +01:00
Bug-Reaper
99fce5b6ca fix: address upstream Chromium shift to enable CoreAudio Tap API for audio capture used in electron's desktopCapturer (🍏 macOS). (#49717)
* fix: Enable CoreAudio Tap API for Audio Capture (🍏 macOS)

* fix: addressed markdown issue which caused pre-commit hook failure

🧑‍🔧 : Ref : https://github.com/electron/electron/pull/49717#issuecomment-3874660013

* fix: updated docs to cover `desktopCapturer` nuances with macOS

📝 : PR https://github.com/electron/electron/pull/49717
2026-02-10 15:06:21 +01:00
Rushikesh Bobade
7c66112e88 docs: link unlinked type references in API documentation (#49651)
docs: add missing type links in menu.md and shared-texture.md
2026-02-09 23:08:52 -08:00
John Kleinschmidt
fd0108907a build: fixup build attestation (#49730) 2026-02-09 11:50:17 -05:00
reito
3fa3e91f90 docs: fix framerate limit when osr with shared texture (#49705) 2026-02-09 15:18:06 +01:00
David Sanders
a3563422c4 ci: fix patches changes detected in apply patches workflow (#49701) 2026-02-06 13:48:30 -08:00
Keeley Hammond
9db2290bcd fix: restore macos 12 support in Node 24 (#49697) 2026-02-06 07:48:37 -08:00
Samuel Attard
60d35bbaf4 feat: add support for disclaiming utility processes (#49128)
* feat: add support for disclaiming utility processes

* chore: update patches

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-02-05 14:37:24 -08:00
Michaela Laurencin
15dc7170ef ci: fix ai-pr label commenting (#49685) 2026-02-05 14:27:46 -05:00
Keeley Hammond
59e434a27f refactor: use ComPtr pattern for MSIX to avoid exception handling (#49645)
* Revert "fix: fix Windows MSIX release build errors (#49613)"

This reverts commit 4b5d5f9dd5.

* refactor: use WRL ComPtr pattern for MSIX to avoid exception handling

The MSIX auto-updater code was using C++/WinRT (winrt::* namespace), which requires exception handling (/EHsc). Mixing exception and non-exception handling code in the same binary is problematic at runtime. This commit refactors electron_api_msix_updater.cc to use an upstream Chromium pattern and eliminates the need for special exception handling build flags

* build: import correct packages

* build: consolidate IPackage declarations

* refactor: use IPackageManager/IPackageManager5/IPackageManager9 and
IPackage/IPackage2/IPackage4/IPackage6 interfaces as needed for
different API methods.

Also consolidates duplicate completion handler logic, fixes a bug in
RegisterRestartOnUpdate where the command line string could go out of
scope, and removes unused includes.
2026-02-05 10:42:28 -08:00
Samuel Attard
dec7f937ae build: generate artifact attestions for released assets (#48239)
* build: generate artifact attestions for released assets

* chore: address review feedback

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-05 09:37:17 -05:00
Noah Gregory
50381a6d57 refactor: don't log error just for unsigned code (#49654) 2026-02-05 15:26:17 +09:00
David Sanders
41c7e9bb21 ci: use squash merge for apply patches workflow (#49667) 2026-02-04 15:51:49 -08:00
Shelley Vohr
9740c989da fix: default accelerator for role-based menu items (#49558)
fix: apply default accelerator for role-based menu items

Co-authored-by: Kimgun3383 <tygob5247@gmail.com>
2026-02-04 16:45:29 -05:00
John Kleinschmidt
4ea2d816b8 revert(ci): use new case syntax in workflows (#49665)
Revert "ci: use new case syntax in workflows (#49590)"

This reverts commit def7854848.
2026-02-04 14:55:20 -05:00
Noah Gregory
6a47bb4731 fix: use temp directory for singleton test and clean up at end (#49604)
* fix: create directory for singleton test in `temp` instead of `home`

* fix: remove directory for singleton test at test end

* refactor: avoid extraneous declarations in singleton test

* refactor: reintroduce `userDataFolder` declaration in singleton test

* refactor: move cleanup before app exit in singleton test

* style: add missing semicolon

* refactor: set the user data path after pre-test cleanup in singleton test

* fix: release lock before cleanup in singleton test
2026-02-04 14:43:36 -05:00
David Sanders
ef11669b67 ci: handle PRs with no checks in rerun apply patches (#49630) 2026-02-04 16:13:27 +01:00
Shelley Vohr
d7378d96a5 docs: add Wayland note to win.getPosition() and win.getBounds() (#49632)
docs: add Wayland note to win.getPosition()
2026-02-04 16:13:11 +01:00
Keeley Hammond
431f77ca1c fix: remove menu observer before destroying menu_controller_ (#49648)
* fix: remove menu observer before destroying menu_controller_

* fix: resolves private inheritance conflict
2026-02-04 16:11:00 +01:00
Shelley Vohr
51a9101c3d build: remove Core Graphics private macOS APIs on MAS (#49633) 2026-02-03 12:02:06 -05:00
Shelley Vohr
def7854848 ci: use new case syntax in workflows (#49590)
ci: use new case synta in workflows
2026-02-03 11:57:14 -05:00
Niklas Wenzel
28858ecb85 chore: add "I have built and tested this PR" box to PR template (#49434) 2026-02-03 11:39:07 -05:00
Shelley Vohr
8fdb7549bb fix: alt-space should route through 'system-context-menu' (#49619)
fix: alt-space should route through system-context-menu
2026-02-03 11:34:58 -05:00
dependabot[bot]
c3428fa413 build(deps): bump lodash from 4.17.21 to 4.17.23 in the npm_and_yarn group across 1 directory (#49577)
build(deps): bump lodash in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [lodash](https://github.com/lodash/lodash).

Updates `lodash` from 4.17.21 to 4.17.23
- [Release notes](https://github.com/lodash/lodash/releases)
- [Commits](https://github.com/lodash/lodash/compare/4.17.21...4.17.23)

---
updated-dependencies:
- dependency-name: lodash
  dependency-version: 4.17.23
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-03 11:05:40 -05:00
loc
233caf8469 fix(squirrel.mac): clean up old staged updates before downloading new update (#49365)
fix: clean up old staged updates before downloading new update

When checkForUpdates() is called while an update is already staged,
Squirrel creates a new temporary directory for the download without
cleaning up the old one. This can lead to disk usage growth when
new versions are released while the app hasn't restarted.

This adds a force parameter to pruneUpdateDirectories that bypasses
the AwaitingRelaunch state check. This is called before creating a
new temp directory, ensuring old staged updates are cleaned up.
2026-02-03 11:04:06 -05:00
Shelley Vohr
86209f60eb fix: possible crash in FileSystem API (#49578)
Refs https://chromium-review.googlesource.com/6880247

Fixes a crash that can arise in the File System Access API in the
following scenario:

1. Create fileHandle1 at path1.
2. Call fileHandle1.remove() or user manually delete the file.
3. Create fileHandle2 at path2.
4. fileHandle2.move(path1).
2026-02-03 15:15:54 +01:00
dependabot[bot]
bdf2b67462 build(deps): bump github/codeql-action from 4.32.0 to 4.32.1 (#49629)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.0 to 4.32.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b20883b0cd...6bc82e05fd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-03 15:03:22 +01:00
Mr.Chaofan
4413a0f642 fix: wrong cause and removed flag in cookie change listener (#49103) 2026-02-03 10:19:35 +01:00
Shelley Vohr
3776731f4a fix: menu state in macOS dock menus (#49574) 2026-02-02 17:01:34 -05:00
Robo
db5606b4b3 fix: handle out of order recording errors in skia graphite (#49608) 2026-02-02 14:20:19 +01:00
Calvin
1159de52e7 docs: app.getGPUInfo() may reject (#49580) 2026-02-02 10:00:05 +01:00
Keeley Hammond
4b5d5f9dd5 fix: fix Windows MSIX release build errors (#49613)
* fix: fix MSIX release build

* fix: add C++/WinRT headers

* build: modify include paths

* fix: compile msix as seperate source set

* build: add additional needed deps for msix
2026-02-01 22:27:42 -08:00
Prachi Maskar
0cbf3c2918 docs: add jsign instructions for Azure Trusted Signing on Linux/macOS (#49345)
* docs: add jsign instructions for Azure Trusted Signing on Linux/macOS

* docs: add clickable jsign link for Azure Trusted Signing
2026-01-30 15:24:08 -05:00
axolotl
f272723a33 feat: Allow View.setBounds to animate (#48812)
* feat: allow View::SetBounds to animate

* fix: support width/height animations

* fix: jumping on subsequent animations

* fix: segfault race condition

* fix: remove layer background

* fix: layer clips not being reset

* refactor: use gfx tween gin converter

* fix: layer cleanups causing flickering views

* chore: merge artifact

* fix: missing private method in header

* fix: return type

* fix: do not set layer opacity

* refactor: update animate parameter format

* refactor: move animate into options object

* chore: typo

* docs: update

* spec: add view animation test
2026-01-30 15:18:56 -05:00
Shelley Vohr
331d1e16f5 refactor: address PathProvider TODO (#49563) 2026-01-30 14:16:39 -05:00
Shelley Vohr
6825a522e9 fix: duplicate fullscreen macOS menu item (#49074) 2026-01-30 13:23:43 -05:00
Shelley Vohr
e033c10075 fix: issues with xdg activation on Linux (#49499) 2026-01-30 10:53:04 -05:00
Shelley Vohr
64872a6cb8 fix: macOS menu item accelerators when item disabled (#49553)
fix: macOS menu item acceerators when item disabled
2026-01-30 10:07:16 +01:00
Jan Hannemann
d74fcfcecb feat: msix auto-updater (#49230)
* feat: native auto updater for MSIX on Windows

* doc: added MSIX debug documentation

* fix: allow downgrade with json release file and emit update-available

* test: msix auot-update tests

* doc: API documentation

* test: add package version validation

* fix: docs typo

* fix: don't allow auto-updating when using appinstaller manifest

* fix: getPackageInfo interface implementation

* fix: review feedback, add comment

* fix: missed filename commit

* fix: install test cert on demand

* fix: time stamp mismatch in tests

* fix: feedback - rename to MSIXPackageInfo

* fix: update and reference windowsStore property

* fix: remove getPackagInfo from public API

* fix: type error bcause of removed API
2026-01-29 16:38:26 -05:00
Michaela Laurencin
92a3f7d6c1 ci: add workflow for commenting with new 'ai-pr' label (#49564)
* add workflow for commenting with new 'ai-pr' label

* Update .github/workflows/pull-request-labeled.yml

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* add pr autoclose

* replace with specific secret

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* specify repo

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* update wording of comment

* chore: use GH app token

* chore: fix indentation

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-29 13:12:42 -05:00
David Sanders
0e161c18eb ci: rework reapply patches (#49552) 2026-01-29 11:19:07 -05:00
David Sanders
3d76d3a469 build(dev-deps): bump @electron/lint-roller to 3.2.0 (#49565) 2026-01-29 16:06:47 +01:00
Kanishk Ranjan
82d350524e test: fix flaky BrowserView test (#49316)
* test: fix flaky BrowserWindow test

* fix: improved as per review
2026-01-28 11:54:35 -08:00
Shelley Vohr
e6be04a7a0 fix: chrome://accessibility drift (#49547)
https://chromium-review.googlesource.com/c/chromium/src/+/6870052
2026-01-28 12:07:14 +01:00
David Sanders
a7de47084b test: remove split dependency (#49551) 2026-01-28 10:47:43 +01:00
Kanishk Ranjan
3820d3ae6c test: fix flaky BrowserWindow test (#49364)
test: fix flaky BrowserWindow test
2026-01-27 21:47:02 -08:00
Charles Kerr
8364b62f68 fix: potential dangling pointer in api::Screen (#49536)
fixes a regression from #49506
2026-01-27 16:27:38 -05:00
dependabot[bot]
441729c3a0 build(deps): bump actions/checkout from 6.0.1 to 6.0.2 (#49541)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.1 to 6.0.2.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](8e8c483db8...de0fac2e45)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-27 11:37:15 +01:00
Shelley Vohr
c521c2b868 test: update/fix Node.js disabled specs (#49467) 2026-01-27 11:03:09 +01:00
Shelley Vohr
b2c5093542 docs: correct type for process.noDeprecation (#49524)
* docs: correct type for process.noDeprecation

* docs: mark `noDeprecation` as optional instead

Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>
2026-01-27 11:02:51 +01:00
dependabot[bot]
ec5eb64788 build(deps): bump github/codeql-action from 4.31.10 to 4.32.0 (#49540)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.10 to 4.32.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cdefb33c0f...b20883b0cd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-27 11:00:13 +01:00
David Sanders
0cc15a6386 ci: reapply patches if PR base branch updates them (#49516) 2026-01-26 15:13:34 -05:00
David Sanders
4aa89b9c3c ci: add pipeline segment to run clang-tidy (#49072)
* ci: add pipeline segment to run clang-tidy

* chore: set -header-filter='' for clang-tidy

Breaking change in `clang-tidy` 22.0.0:

> clang-tidy now displays warnings from all non-system headers by default.
> Previously, users had to explicitly opt-in to header warnings using
> -header-filter=’.*’. To disable warnings from non-system, set
> -header-filter to an empty string.
2026-01-26 14:37:01 -05:00
Felix Rieseberg
ae43f17b79 build: Run gh workflows only on e/e (#49521) 2026-01-26 14:35:11 -05:00
electron-roller[bot]
b847299f19 chore: bump chromium to 146.0.7650.0 (main) (#49496)
* chore: bump chromium in DEPS to 146.0.7650.0

* 7496671: WaaP: Control hung delay for Initial WebUI

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7496671

* 7494302: [//media] Rename renderable_gpu_memory_buffer_video_frame_pool*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7494302

* chore: update patches

* 7502996: [DevTools] Add ability to toggle Chromium feature flags from DevTools

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7502996

* 7456200: Vectorize StringImpl::CopyChars and EqualIgnoringASCIICase using Highway.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200

* 7236627: spellcheck: supply full spelling marker info, incld. marker type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7236627

* chore: rm dependency on wtf::string from blink public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200
added a public dependency on //third_party/highway for
//third_party/blink/renderer/platform/wtf:wtf which will not be
inherited by //content/renderer since wtf is internal dependency of
blink leading to the following compilation error

```
In file included from ../../content/public/renderer/window_features_converter.cc:5:
In file included from ../../content/public/renderer/window_features_converter.h:10:
In file included from ../../third_party/blink/public/web/web_window_features.h:38:
In file included from ../../third_party/blink/renderer/platform/wtf/text/wtf_string.h:40:
../../third_party/blink/renderer/platform/wtf/text/string_impl.h:27:10: fatal error: 'hwy/highway.h' file not found
   27 | #include <hwy/highway.h>
      |          ^~~~~~~~~~~~~~~
1 error generated.
```

Use `gn desc out/Testing content/renderer:renderer_sources --blame`
to verify the inherited config and dependency list.

* 7493995: Restore directive part of wasm-eval error message

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7493995

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-26 11:18:09 -08:00
Charles Kerr
6766343173 refactor: simplify NativeWindow-to-BaseWindow lookup (#49520)
refactor: simplify native window to base window lookup
2026-01-26 12:28:57 +01:00
Sourav Bera
75be2fe8d6 docs: add type reference links in Menu and MenuItem API documentation (#49437)
* docs: add type reference links in Menu and MenuItem API documentation

* docs: revert type links in Menu return types to fix parser
2026-01-26 12:22:28 +01:00
Charles Kerr
30f365d9d8 refactor: use gin::Wrappable for electron::api::PowerMonitor (#49509)
* refactor: use `gin::Wrappable` for `electron::api::PowerMonitor`

* chore: update patches
2026-01-25 22:51:31 -06:00
Charles Kerr
e8250f9955 refactor: use gin::Wrappable for electron::api::Screen (#49506) 2026-01-25 13:46:25 -06:00
Kyle Cutler
d5de8883a2 feat: add focusOnNavigation flag to WebPreferences (#49425)
* feat: add focusOnNavigation webPreference

* WebContentsView tests

* fix

* fix
2026-01-23 14:29:34 -05:00
David Franco
8a11d5afb1 fix: avoid startup crash when V8 sandbox is disabled (#49210)
* fix: avoid startup crash when V8 sandbox is disabled

* chore: update patch

---------

Co-authored-by: David Franco <davidfrsan@gmail.com>
2026-01-23 11:49:15 -05:00
Shelley Vohr
89963618d9 fix: second argument to shell.writeShortcutLink is optional (#49476)
fix: second argument to shell.writeShortcutLink is optional
2026-01-23 11:24:47 -05:00
Charles Kerr
8c5c6a6088 refactor: use gin::Wrappable for electron::api::DataPipeHolder (#49495)
* refactor: make `DataPipeHolder` inherit from `gin::Wrappable`

* test: add a test to ensure GC clears the data pipe holder

* chore: e patches all

* chore: e patches all (trivial only)

* refactor: make AllDataPipeHolders a base::flat_map of WeakPersistent
2026-01-23 20:29:01 +09:00
Szymon Kurek
24526ccd39 docs: correct yarn part of tutorial-5-packaging (#49401)
docs: fix yarn part of `tutorial-5-packaging` - adding electron forge
2026-01-23 11:14:19 +01:00
Keeley Hammond
1134d95c6d chore: update main patches (#49498)
chore: update patches
2026-01-22 20:30:32 -08:00
Charles Kerr
d76608b945 refactor: use gin::Wrappable in electron::api::PowerSaveBlocker (#49381)
* refactor: PowerSaveBlocker subclasses gin::Wrappable

* chore: update chore_add_electron_objects_to_wrappablepointertag.patch

* chore: e patches all
2026-01-22 17:31:38 -06:00
electron-roller[bot]
d689f76ff9 chore: bump chromium to 146.0.7645.0 (main) (#49453)
* chore: bump chromium in DEPS to 146.0.7643.0

* chore: bump chromium in DEPS to 146.0.7645.0

* chore: update patches

* 7402162: Refactor app shims to call ContentMain

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7402162

* 7454282: Add master key management for HTTP Cache Encryption

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7454282

* 7490440: Reland "Delete unused base::Contains()"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7490440

* chore: update patches

* 7414864: Pass CSSParserLocalContext down to CSSMathExpressionNodeParser

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7414864

* 7460969: Move child_process_id.h to common

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7460969

* 7474608: [api] Remove deprecated v8::PropertyCallbackInfo<T>::This()

Refs https://chromium-review.googlesource.com/c/v8/v8/+/7474608

* 7461067: [Viz] Rename kPreferGpuMemoryBuffer

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7461067

* 7487174: Remove GLHelper

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7487174

* 7457538: Set timeout from multi source page context fetcher

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7457538

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-22 17:01:09 -05:00
reito
e3142865b2 fix: offscreen rendering with correct screen info. (#48730)
fix: osr use correct screen info.
2026-01-22 14:58:54 -05:00
David Sanders
1f8e4079cd test: fix version color output when running prebuilt Electron (#49491) 2026-01-22 16:17:56 +01:00
Shelley Vohr
bad88c6ed4 fix: potential devtools crash on empty (#49468) 2026-01-21 17:05:26 -08:00
Noah Gregory
534cb33465 fix: return early from platform_util::Beep() on Linux if there is no default GDK display (#49442)
fix: return early from beep on linux if there is no default gdk display
2026-01-21 15:55:24 -05:00
Soobin Rho
51e7753ae9 docs: clearer wording performance common pitfalls (#45308)
docs: clearer wording (performance common pitfalls)

Signed-off-by: Soobin Rho <soobinrho@gmail.com>
2026-01-21 14:46:02 -05:00
sam marshall
d141934885 docs: document that shell.trashItem requires backslashes (#49038)
docs: Update shell.md: Document that shell.trashItem requires backslashes

In Windows many functions relating to files (e.g. shell.openItem, the Node fs functions, as well as native Win32 APIs) will accept either type of slash / or \ as a folder separator.

shell.trashItem does not work with / as folder separator in Windows. This documentation change explains that.

See also:
https://github.com/electron/electron/issues/28831
2026-01-21 13:21:01 -05:00
Erick Zhao
22e8cf9416 docs: add a few API history fragments (#49340)
* docs: add a few API history fragments

* manual fixes
2026-01-21 12:57:02 -05:00
David Sanders
5856b2e01c ci: trigger website docs update on release published (#49429) 2026-01-21 10:44:18 -05:00
Shelley Vohr
49d91dd02b revert: use deprecated setAllowedFileTypes in macOS dialogs (#49444)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

* chore: remove stray import
2026-01-21 13:08:04 +01:00
David Franco
2f20d287d1 feat: import shared texture supports p010le (#49272)
feat: import shared texture supports p010le.
2026-01-20 11:50:30 +01:00
Shelley Vohr
73377af79e build: try removing zero-fill sandbox patch component (#49452) 2026-01-20 09:40:33 +01:00
dependabot[bot]
47766801e4 build(deps): bump actions/setup-node from 6.1.0 to 6.2.0 (#49456)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.1.0 to 6.2.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](395ad32622...6044e13b5d)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.2.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-20 09:40:02 +01:00
dependabot[bot]
bf0510dc22 build(deps): bump electron/github-app-auth-action from 1.1.1 to 2.0.0 (#49457)
Bumps [electron/github-app-auth-action](https://github.com/electron/github-app-auth-action) from 1.1.1 to 2.0.0.
- [Release notes](https://github.com/electron/github-app-auth-action/releases)
- [Commits](384fd19694...e14e47722e)

---
updated-dependencies:
- dependency-name: electron/github-app-auth-action
  dependency-version: 2.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-20 09:39:47 +01:00
electron-roller[bot]
486a9a61d2 chore: bump chromium to 146.0.7635.0 (main) (#49408)
* chore: bump chromium in DEPS to 146.0.7635.0

* chore: update patch hunk headers

* 7078551: [wasm] Refactor caching API

https://chromium-review.googlesource.com/c/v8/v8/+/7078551

* 7141498: [api] Remove unused context parameter from FixedArray::Get

https://chromium-review.googlesource.com/c/v8/v8/+/7141498

* 7454865: Add timeouts to content API for CopyFromSurface

https://chromium-review.googlesource.com/c/chromium/src/+/7454865

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 15:37:02 +01:00
Niklas Wenzel
7851a34c2d docs: fix webContents.hostWebContents types (#49424) 2026-01-19 10:45:23 +01:00
Shelley Vohr
faa21a748f fix: MAS rejection for private APIs (#49391) 2026-01-18 10:34:16 +01:00
Shelley Vohr
5bd2938f6a fix: try clearing InspectableWebContents delegate earlier (#49406)
fix: try clearing InspectableWebContents delegate earlier
2026-01-16 21:36:34 +01:00
electron-roller[bot]
f149efe32e chore: bump node to v24.13.0 (main) (#49189)
* chore: bump node in DEPS to v24.12.0

* src: use CP_UTF8 for wide file names on win32

https://github.com/nodejs/node/pull/60575

* test,crypto: handle a few more BoringSSL tests

https://github.com/nodejs/node/pull/59030

* chore: fixup patch indices

* chore: re-add accidentally removed sslv23 test

* chore: fixup crypto patch rebase

* test: make buffer sizes 32bit-aware in test-internal-util-construct-sab

https://github.com/nodejs/node/pull/61026

* src: add internal binding for constructing SharedArrayBuffers

https://github.com/nodejs/node/pull/60497

* chore: bump node in DEPS to v24.13.0

* chore: fixup patch indices

* chore: fixup sandboxed pointers patch

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-16 11:08:38 -05:00
Daniel Gräfe
5dd509d2f4 fix: restore AXDocument accessibility attribute for representedFilename on macOS (#49346)
Starting from Chromium 134.0.6989.0 (Electron 35.0.0-beta.5), the
NativeWidgetMacNSWindow class overrides accessibilityDocument to return
the web content URL from the accessibility tree, but doesn't fall back
to NSWindow's default behavior when that URL is empty.

This broke Electron's setRepresentedFilename() API - the file path was
still set on the NSWindow, but no longer exposed via the AXDocument
accessibility attribute that screen readers use.

This fix adds an accessibilityDocument override in ElectronNSWindow that
checks representedFilename first, falling back to Chromium's behavior
for web content URLs.

Fixes: https://github.com/electron/electron/issues/XXXXX

Co-authored-by: Claude Opus 4.5 <noreply@anthropic.com>
2026-01-16 10:27:29 +01:00
Alex Schwartz
bdd7730a24 fix: make toplevel icon Wayland protocol work (#49290) 2026-01-16 09:55:52 +01:00
dependabot[bot]
060e76f1b6 build(deps): bump actions/upload-artifact from 5.0.0 to 6.0.0 (#49220)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](330a01c490...b7c566a772)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-16 09:55:38 +01:00
David Sanders
2fbf1f5c72 ci: detect patch needs update error with problem matcher (#49405) 2026-01-15 19:18:50 -08:00
Charles Kerr
c769361af2 fix: warning: default arguments on virtual or override methods (#49398)
fix: warning: default arguments on virtual or override methods are prohibited [google-default-arguments]

we never override these, so just make them nonvirtual
2026-01-15 16:09:43 -08:00
electron-roller[bot]
6ea7d6d5a4 chore: bump chromium to 146.0.7633.0 (main) (#49390)
* chore: bump chromium in DEPS to 146.0.7633.0

* chore: fixup patch indices

* chore: fix unsafe buffer usage in browser_linux.cc

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-15 10:52:42 -05:00
Charles Kerr
27b3a32307 chore: update patches (#49399) 2026-01-14 22:33:23 -08:00
Charles Kerr
ddeb970f18 refactor: make ReplyChannel inherit from gin::Wrappable (#49339)
* refactor: make ReplyChannel inherit from gin::Wrappable

* chore: add kElectronReplyChannel to chore_add_electron_objects_to_wrappablepointertag.patch

* fix: use gin::PerIsolateData::DisposeObserver

* fix: lifetime issues

* chore: rm perisolatedata hook in favor of prefinalizer

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-14 18:35:01 -06:00
electron-roller[bot]
5d80264944 chore: bump chromium to 145.0.7628.0 (main) (#49331)
* chore: bump chromium in DEPS to 145.0.7620.0

* chore: bump chromium in DEPS to 145.0.7622.0

* chore: bump chromium in DEPS to 145.0.7624.0

* chore: bump chromium in DEPS to 145.0.7626.0

* chore: bump chromium in DEPS to 145.0.7628.0

* 7362759: Migrate various base::Contains() to contains() in ui | https://chromium-review.googlesource.com/c/chromium/src/+/7362759

* chore: update patches

* 7411324: url: Mark deprecated functions as UNSAFE_BUFFER_USAGE

https://chromium-review.googlesource.com/c/chromium/src/+/7411324

* 7366867: Store property info in CSSParserLocalContext for random()

https://chromium-review.googlesource.com/c/chromium/src/+/7366867

* 7277406: Exclude PiP from getDisplayMedia picker thumbnails

https://chromium-review.googlesource.com/c/chromium/src/+/7277406

* 7253489: activity_reporter: Create stub module owned by browser_process

https://chromium-review.googlesource.com/c/chromium/src/+/7253489

* 7404514: Create device parental controls delegate

https://chromium-review.googlesource.com/c/chromium/src/+/7404514

* 7269504: Update histograms to use the updated MediaStreamRequestResult enum

https://chromium-review.googlesource.com/c/chromium/src/+/7269504

* fixup! 7253489: activity_reporter: Create stub module owned by browser_process

* 7368549: Reland "Use native rollup"

https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7368549

* 4803165: Enable suppressing input event dispatch while paint-holding.

https://chromium-review.googlesource.com/c/chromium/src/+/4803165

* chore: make device_parental_controls lazy

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-14 15:34:24 +01:00
Erick Zhao
dae76c2885 docs: remove stale example and standardize DevTools capitalization (#49321)
* docs: remove stale example and standardize `DevTools` capitalization

* Update docs/api/web-contents.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

---------

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>
2026-01-14 10:35:53 +01:00
Erick Zhao
a368c5da0c docs: improve build-tools instructions (#49294)
* docs: improve build-tools instructions

* address comments

* update directory structure

* update

* nits

* node -> electron_node

* update macos build version

* Update docs/development/build-instructions-gn.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-14 09:51:55 +01:00
Keeley Hammond
1b2679b315 fix: revert os_crypt async cookie provider implementation (#49382)
* Revert "fix: provide explicit cookie encryption provider for cookie encryption (#49348)"

This reverts commit 95f097a392.

* Revert "fix: fix cookie encryption provider loading on Windows and Linux (#49371)"

This reverts commit 0e4ee9f03a.

* revert: 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-14 09:34:00 +01:00
Shelley Vohr
15acf70760 build: roll build-image to a82b87d (#49377)
build: roll build-image to a82b87d
2026-01-13 12:13:14 +01:00
dependabot[bot]
324eb0eb1c build(deps): bump github/codeql-action from 4.31.7 to 4.31.10 (#49376)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.7 to 4.31.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cf1bb45a27...cdefb33c0f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-13 10:25:10 +01:00
Keeley Hammond
0e4ee9f03a fix: fix cookie encryption provider loading on Windows and Linux (#49371)
* fix: support cookie encryption provider cross-platform

* fix: add async macos key provider
2026-01-12 19:39:29 -08:00
Charles Kerr
ae94cefdba refactor: add static ReplyChannel::SendError() helper (#49338)
* refactor: add static void ReplyChannel::SendError()

* refactor: use static SendError() instead of instantiating a temporary

* refactor: remove non-static version of SendError()

* refactor: remove redundant callback-is-non-null checks
2026-01-12 17:02:58 -06:00
Shelley Vohr
409c29b12b build: roll build-tools SHA to 4430e4a (#49362)
build: roll build-tools SHA to 4430e4a
2026-01-12 12:22:30 -05:00
Shelley Vohr
b0e012f14e build: update on-create-command for siso (#49357) 2026-01-12 14:30:48 +01:00
Calvin
9a5ffd920c feat: suppress devtools console logging (#49292)
* feat: suppress devtools console logging

* Emit messages as-is in testing builds

* Promote `DCHECK_IS_ON()` to preprocessor check
2026-01-12 11:31:33 +01:00
Charles Kerr
cf2e283332 fix: clang-tidy warnings, pt. 1 (#49083)
* fix: google-readability-casting warning about the uint32_t cast

* fix: modernize-use-equals-default warnings

* fix: readability-redundant-member-init warning

* fix: modernize-make-unique warnings

* fix: modernize-use-emplace

warning: use emplace_back instead of push_back

* refactor: address code review feedback
2026-01-09 22:57:38 -08:00
Niklas Wenzel
d6a6312fc8 build: update NMV to 145 (#49349) 2026-01-09 18:14:18 -08:00
Keeley Hammond
95f097a392 fix: provide explicit cookie encryption provider for cookie encryption (#49348)
fix: provide explicit cookie encryption provider

Fixes 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-09 11:53:58 -08:00
Niklas Wenzel
b380755514 chore: remove stakeholders mention from PR template (#49317) 2026-01-09 00:36:40 -08:00
David Sanders
3985daa81c chore: improvements to script/run-clang-tidy.ts (#49335)
* chore: disable color output for clang-tidy in CI

* chore: small QoL improvements to run-clang-tidy.ts

* chore: add --fix option to script/run-clang-tidy.ts
2026-01-08 22:05:44 -08:00
Erick Zhao
5901d8a6d8 docs: document ELECTRON_SKIP_BINARY_DOWNLOAD (#49320) 2026-01-07 14:54:22 -08:00
electron-roller[bot]
eee60f202c chore: bump chromium to 145.0.7618.0 (main) (#49314)
* chore: bump chromium in DEPS to 145.0.7618.0

* 7399531: [GTK] Don't preselect file dialog accept buttons | https://chromium-review.googlesource.com/c/chromium/src/+/7399531

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-07 15:01:56 -05:00
Charles Kerr
b5a7d81c7d refactor: have GetXdgAppId() return a std::optional<std::string> (#49318)
* refactor: GetXdgAppId() now returns std::optional<std::string>

* refactor: slightly simplify app.setDesktopName() ts calls

* refactor: add better documentation for dekstop-entry in XDG notifications
2026-01-07 14:30:09 -05:00
dependabot[bot]
a89b2cd9bc build(deps): bump actions/download-artifact from 6.0.0 to 7.0.0 (#49221)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](018cc2cf5b...37930b1c2a)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-06 15:48:38 -05:00
Niklas Wenzel
44fa30695f docs: update roundedCorners documentation (#49195) 2026-01-05 16:27:46 -05:00
Niklas Wenzel
2ab56adbbd test: remove outdated disabled test (#49196) 2026-01-05 16:27:01 -05:00
electron-roller[bot]
a1f0ef80d4 chore: bump chromium to 145.0.7616.0 (main) (#49279)
* chore: bump chromium in DEPS to 145.0.7605.0

* chore: bump chromium in DEPS to 145.0.7606.0

* chore: bump chromium in DEPS to 145.0.7608.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7610.0

* chore: update patches

* [InputVizard] Fix missing touch cancel in InputTransferHandlerAndroid
using InputEventSource

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7302368

* chore: bump chromium in DEPS to 145.0.7611.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7614.0

* chore: bump chromium in DEPS to 145.0.7615.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7616.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-05 13:34:36 -05:00
dependabot[bot]
c1a031be83 build(deps): bump actions-cool/issues-helper from 3.7.3 to 3.7.5 (#49282)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.3 to 3.7.5.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](3809910bc1...e2ff99831a)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-05 12:26:03 -05:00
John Kleinschmidt
c8bb700509 build: fixup release notes generation (#49302) 2026-01-05 11:11:40 -05:00
Calvin
46922de638 fix: drag regions in child windows (#49231)
* fix: drag regions in child windows

* Update comments
2026-01-05 10:34:01 -05:00
Niklas Wenzel
75ea93a279 chore: remove quiet period mention from PR template (#49298) 2026-01-05 10:12:07 -05:00
John Kleinschmidt
ace0beaa3f build: add logging to notes generator (#49300) 2026-01-05 09:49:51 -05:00
electron-roller[bot]
9eb43f3286 chore: bump chromium to 145.0.7604.0 (main) (#49265)
* chore: bump chromium in DEPS to 145.0.7599.0

* chore: bump chromium in DEPS to 145.0.7600.0

* chore: bump chromium in DEPS to 145.0.7602.0

* chore: bump chromium in DEPS to 145.0.7604.0

* chore: update patches (trivial only)

* [bytesize] Migrate network data in Task Manager to ByteSize.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/7266090

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-28 20:40:50 -08:00
electron-roller[bot]
809ab09b6f chore: bump chromium to 145.0.7596.0 (main) (#49224)
* chore: bump chromium in DEPS to 145.0.7588.0

* fix(patch-conflict): update scroll_bounce_flag for split overscroll methods

Chromium split IsElasticOverscrollEnabled() into two methods:
IsElasticOverscrollEnabledOnRoot() and IsElasticOverscrollSupported().
Updated patch to apply the scroll-bounce command-line switch to both
methods.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7233733

* fix(patch-conflict): update exclusive_access patch context

Upstream refactored the profile variable declaration. Updated patch to
match new surrounding context with brace-style if statement.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239252

* fix(patch-conflict): update screen capture kit non-shareable filter

Upstream refactored PiP window exclusion to use GetWindowsToExclude()
helper function. Updated patch to combine non-shareable window filtering
with the new helper's output.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7274596

* fix(patch-conflict): update corner smoothing CSS property id position

Upstream added new internal overscroll CSS properties. Updated patch to
add kElectronCornerSmoothing after the new entries.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234051

* fix(patch-conflict): update permission patches for new permission types

Upstream added new permission types: LOCAL_NETWORK, LOOPBACK_NETWORK,
and GEOLOCATION_APPROXIMATE. Updated Electron permission patches to
include these new types and renumber Electron-specific permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7231952

* fix(patch-conflict): update memory query fallback for new function signature

Upstream added AmountOfTotalPhysicalMemory() with PCHECK. Updated patch
to maintain fallback logic with correct ByteSize return type.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254886

* chore: update patch hunk headers

* fix(patch): update reclient-configs patch to use new file mode

The fix_add_python_remote_wrapper patch was using 'copy from' mode
which caused inconsistent behavior between local and CI git versions.
Changed to 'new file' mode for consistent patch application.

* fix(patch-conflict): remove duplicate GEOLOCATION_APPROXIMATE case

Upstream moved GEOLOCATION_APPROXIMATE earlier in the switch statement
in GetPermissionString(). The 3-way merge kept both the old and new
positions, causing a duplicate case error.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6397637

* chore: update libcxx filenames for new headers

* chore: bump chromium in DEPS to 145.0.7590.0

* chore: update patch hunk headers

* fix(patch): update memory fallback return type to ByteSize

Upstream changed the return type from ByteCount to ByteSize.

* fix: suppress nodiscard warning in node_file.cc

libc++ added [[nodiscard]] to std::filesystem::copy_options operator|=
which causes build failures with -Werror.

* 7229082: update CopyFromSurface to use CopyFromSurfaceResult

Upstream changed CopyFromSurface callback to return
base::expected<viz::CopyOutputBitmapWithMetadata, std::string>
instead of SkBitmap, enabling better error handling.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7229082

* 7254070: add ip_address_space param to OnLocalNetworkAccessPermissionRequired

Upstream added IPAddressSpace parameter to check address space for
proper permission handling in Local Network Access.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254070

* 7136679: add spelling_markers param to RequestCheckingOfText

Upstream added spelling_markers parameter to report misspelling
ranges from Blink to Spellcheck to IME.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7136679

* 7240487: remove second param from RegisterWebSafeIsolatedScheme

Upstream removed the schemes_okay_to_appear_as_origin_headers_ parameter.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7240487

* 7254577: use explicit WebElement constructor

WebElement default constructor now requires explicit construction
rather than brace initialization.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254577

* 7256335: remove override from CreateGlobalFeaturesForTesting

Upstream removed BrowserProcess::CreateGlobalFeaturesForTesting virtual
method so the override specifier is no longer valid.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7256335

* chore: add missing SingleThreadTaskRunner include

A transitive include of SingleThreadTaskRunner was removed upstream,
requiring an explicit include.

Ref: Unable to locate specific CL (transitive include change)

* 7260483: add LOCAL_NETWORK, LOOPBACK_NETWORK permission type cases

Upstream added new permission types for Local Network Access split
permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7260483

* chore: update patch hunk headers

* 7264893: update postMessage tests for file: origin serialization change

Chromium now serializes file: origins as 'null' in MessageEvent per spec.
This is a security improvement aligning with the HTML spec behavior.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893

* fix: add paths to custom scheme URLs in protocol tests

Custom scheme URLs without paths (e.g. test-scheme://foo) cause a
DCHECK crash in ASAN builds when CorsURLLoader tries to log the
request via GenerateRequestLine -> PathForRequest, which asserts
that the path is non-empty.

Adding trailing slashes ensures URLs have valid paths.

* chore: bump chromium in DEPS to 145.0.7592.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 145.0.7594.0

* chore: bump chromium in DEPS to 145.0.7596.0

* chore: update accelerator.patch

no manual changes; patch applied with fuzz 2 (offset 1 line)

* chore: update patches (trivial only)

* chore: node ./script/gen-libc++-filenames.js

---------

Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-25 17:15:53 -06:00
Samuel Attard
3df3a6a736 fix: webRequest.onBeforeSendHeaders not being able to modify reserved headers (#49226)
* fix: `webRequest.onBeforeSendHeaders` not being able to modify reserved headers

* chore: add unit test for reserved header
2025-12-19 23:08:40 +13:00
Samuel Attard
7433c14af5 chore: add CLAUDE.md and Chromium Upgrade claude skill (#49229)
* chore: add CLAUDE.md and Chromium Upgrade claude skill

* Update script/lint.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-12-19 13:07:58 +13:00
electron-roller[bot]
a90ccc753b chore: bump chromium to 145.0.7577.0 (main) (#49175)
* chore: bump chromium in DEPS to 145.0.7572.0

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Polished the edits and formatted the result. No real changes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7232079 "7232079: Use WindowsToExclude to exclude PiP window in macOS screencapture device"

* chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7214586 "7214586: Refactor SelectFileDialogLinuxPortal to request XDG portal on demand"
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910 "7237910: Remove g_gtk_ui global"

* 7228586: Migrate SystemMemoryInfo from ByteCount to ByteSize

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7228586

* 7207583: GlobalRenderFrameHostId to ChildProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7207583

* 7205548: Remove uses of BodyAsStringCallbackDeprecated (extensions/)

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7205548

* chore: bump chromium in DEPS to 145.0.7574.0

* chore: update libc++ filenames

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7246150 "7246150: Fix crash in ScreenCaptureKitDeviceMac due to null PIPScreenCaptureCoordinator"

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* fixup! chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

* 7239572: [OOPIF PDF] Enable OOPIF PDF by default on Windows/macOS/Linux

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239572

* chore: bump chromium in DEPS to 145.0.7576.0

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* chore: update patches (trivial only)

* chore: add note to keep patch that was upstreamed but reverted

fix_restore_original_resize_performance_on_macos.patch was organically upstreamed but that change got reverted just after the current roll's cutoff.

I've added a note in the patch contents so the patch sticks around and so we can keep it after the revert is included.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* chore: bump chromium in DEPS to 145.0.7577.0

* chore: update patches (trivial only)

* chore(patch-conflict): keep patch after revert

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* 7237910: Remove g_gtk_ui global

I tried to find a way to avoid the patch, but other approaches seemed complex and involved.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910

* 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7251900

* 7170174: [LNA] Retry requests for cached local resources

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7170174

* fix: PDFs use OOPIF (behavior change)

* fixup! 7237910: Remove g_gtk_ui global

* fixup! 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-16 12:32:38 -05:00
John Kleinschmidt
e181fd040f build: drop dugite as a dependency (#49194) 2025-12-12 13:43:12 -05:00
David Sanders
a486185e10 ci: disallow non-maintainer changes to Yarn files (#49186) 2025-12-11 09:25:29 -05:00
John Kleinschmidt
8cefc8425c build: upgrade yarn to 4.12.0 (#49176) 2025-12-10 14:04:14 -05:00
electron-roller[bot]
fe477ce3aa chore: bump chromium to 145.0.7568.0 (main) (#49145)
* chore: bump chromium in DEPS to 145.0.7562.0

* fix(patch-conflict): update code cache patch for PersistentCache refactor

Upstream refactored code cache to use PersistentCache with new class-based
implementation (NoopCodeCacheHost, LocalCodeCacheHost, CodeCacheWithPersistentCacheHost).
Updated patch to integrate custom scheme support into the new structure while
preserving ProcessLockURLIsCodeCacheScheme checks for embedder-registered schemes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7044986

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update dialog patch for RequestXdgDesktopPortal API

Upstream changed from SetSystemdScopeUnitNameForXdgPortal to RequestXdgDesktopPortal
API pattern. Updated OnServiceStarted signature and kept OnSystemdUnitStarted callback
that calls Electron's file_dialog::StartPortalAvailabilityTestInBackground().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7204285

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): remove reference to deleted AbortByPlaceholderLayout flag

Upstream removed the AbortByPlaceholderLayout runtime flag from
runtime_enabled_features.json5. Updated patch to only add ElectronCSSCornerSmoothing
without the removed flag reference.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7226494

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): guard media_file_system_registry for ChromeOS only

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7100719
moved media_file_system_registry to be ChromeOS-only since Media
Galleries is a Chrome Apps API and Chrome Apps are only available
on Chrome OS now.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): update VideoPixelFormat API for SharedImageFormat

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7207153
removed VideoPixelFormatToGfxBufferFormat as part of migration to
SharedImageFormat. Update to use VideoPixelFormatToSharedImageFormat
which directly returns the SharedImageFormat.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): extend profile methods patch for ShouldEnableXfaForms

The ShouldEnableXfaForms function uses Profile::FromBrowserContext()
which is not available in Electron. Wrap the profile-dependent code
in #if 0 to fall through to the feature flag default.

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: bump chromium in DEPS to 145.0.7563.0

* chore: bump chromium in DEPS to 145.0.7565.0

* chore: bump chromium in DEPS to 145.0.7567.0

* chore: bump chromium in DEPS to 145.0.7568.0

* fix(patch-conflict): update content_main_delegate.h context for IsInitFeatureListEarly

Upstream added a new IsInitFeatureListEarly() virtual method to ContentMainDelegate
just before where our GetBrowserV8SnapshotFilename() method is added. Updated patch
context to account for this new method.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-update): include v8-cppgc.h for CppHeap complete type

The std::unique_ptr<v8::CppHeap> default argument in node.h requires
the complete CppHeap type definition for the destructor. Added the
v8-cppgc.h include to provide the full type definition.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): move NativeAppWindowFrameViewMacClient before constructor

The std::unique_ptr<NativeAppWindowFrameViewMacClient> member requires
the complete type definition to be visible at the point of the constructor
because the unique_ptr destructor may be instantiated during exception
handling. Moved the class definition before the NativeWindowMac constructor.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update create_browser_v8_snapshot_file_name_fuse context for IsInitFeatureListEarly

The upstream added IsInitFeatureListEarly() virtual method declaration to
ContentMainDelegate class. Updated the patch context to account for this
new function being present before the GetBrowserV8SnapshotFilename()
declaration we add.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-update): remove reverted IsInitFeatureListEarly from v8 snapshot patch

The upstream added IsInitFeatureListEarly() was reverted, so the patch should
not include this declaration. Only GetBrowserV8SnapshotFilename() should be
added by the create_browser_v8_snapshot_file_name_fuse patch.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7230430

Co-Authored-By: Claude <noreply@anthropic.com>

* 6171655: include single_thread_task_runner.h for complete type

Added include for base/task/single_thread_task_runner.h in osr_converter.cc
to resolve incomplete type error when using
base::SingleThreadTaskRunner::GetCurrentDefault().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6171655

Co-Authored-By: Claude <noreply@anthropic.com>

* 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

Upstream removed GetChromiumGitRevision() function from embedder_support.
Updated to use CHROMIUM_GIT_REVISION macro directly via
build/util/chromium_git_revision.h as recommended in the Chromium CL.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7224136

Co-Authored-By: Claude <noreply@anthropic.com>

* fixup! 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

* fix(build): add missing include

`components/dbus/xdg/systemd.h` for `void OnSystemdUnitStarted(dbus_xdg::SystemdUnitStatus)` in the same patch.

* fix(build): adapt to string-view-ification change in windows jump_list.cc

7186922: Fix unsafe buffer usage in base/win/win_util.cc
https://chromium-review.googlesource.com/c/chromium/src/+/7186922

* chore: update libc++ filenames

* fixup! fix(build): add missing include

* fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

* fixup! fix(build): guard media_file_system_registry for ChromeOS only

* fixup! fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-10 10:28:31 -05:00
John Kleinschmidt
bab6bd3dae build: use @electron-ci/dev-root for package.json default (#49154) 2025-12-09 14:49:12 -05:00
dependabot[bot]
33f6942565 build(deps): bump actions/stale from 10.1.0 to 10.1.1 (#49159)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.0 to 10.1.1.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5f858e3efb...997185467f)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:50 -05:00
dependabot[bot]
a1b2e82778 build(deps): bump actions-cool/issues-helper from 3.7.2 to 3.7.3 (#49157)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.2 to 3.7.3.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](9861779a69...3809910bc1)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:13 -05:00
dependabot[bot]
1e06b74cd2 build(deps): bump github/codeql-action from 4.31.6 to 4.31.7 (#49155)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.6 to 4.31.7.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fe4161a26a...cf1bb45a27)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.7
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:15:08 -05:00
dependabot[bot]
fe0caa0e0d build(deps): bump actions/checkout from 6.0.0 to 6.0.1 (#49158)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.0 to 6.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](1af3b93b68...8e8c483db8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:14:41 -05:00
dependabot[bot]
cd48083be8 build(deps): bump actions/setup-node from 6.0.0 to 6.1.0 (#49156)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.0.0 to 6.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](2028fbc5c2...395ad32622)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:13:56 -05:00
John Kleinschmidt
8d5b104c17 build: upgrade github-app-auth to 3.2.0 (#49152) 2025-12-09 09:49:37 -05:00
John Kleinschmidt
6e134a8ad9 build: use powershell for Electron build step (#49144) 2025-12-08 16:03:40 -05:00
electron-roller[bot]
95e87e46ab chore: bump chromium to 144.0.7547.0 (main) (#49058)
* chore: bump chromium in DEPS to 144.0.7543.0

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

* chore: update patches

* chore: update filenames.libcxx.gni

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

* chore: bump chromium in DEPS to 144.0.7545.0

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7547.0

* chore: update patches

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

* fixup Add support for UnownedUserData in GlobalFeatures

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

* fixup BUILD.gn for lint

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

* chore: skip setting LPAC ACLs

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <70381+ckerr@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Samuel Attard <MarshallOfSound@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-12-04 16:40:04 -08:00
Jan Hannemann
90e338df50 fix: run toast creation on background thread (#49106)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

* fix: comments
2025-12-02 15:27:22 -08:00
dependabot[bot]
1b3fc9c174 build(deps): bump actions/checkout from 4.2.2 to 6.0.0 (#49125)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.2.2...1af3b93b6815bc44a9784bd300feb67ff0d1eeb3)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:02:06 -05:00
dependabot[bot]
c51018281f build(deps): bump github/codeql-action from 4.31.5 to 4.31.6 (#49124)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.5 to 4.31.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fdbfb4d275...fe4161a26a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:01:21 -05:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
817 changed files with 41443 additions and 22104 deletions

1
.claude/.gitignore vendored Normal file
View File

@@ -0,0 +1 @@
settings.local.json

24
.claude/settings.json Normal file
View File

@@ -0,0 +1,24 @@
{
"permissions": {
"allow": [
"Bash(e sync)",
"Bash(e patches --list-targets:*)",
"Bash(git add:*)",
"Bash(git am:*)",
"Bash(git commit:*)",
"Bash(git log:*)",
"Bash(git show:*)",
"Bash(e patches:*)",
"Bash(e sync:*)",
"Skill(electron-chromium-upgrade)",
"Read(*)",
"Bash(echo:*)",
"Bash(e build:*)",
"Bash(tee:*)",
"Bash(git diff:*)",
"Bash(git rev-parse:*)"
],
"deny": [],
"ask": []
}
}

View File

@@ -0,0 +1,181 @@
---
name: electron-chromium-upgrade
description: Guide for performing Chromium version upgrades in the Electron project. Use when working on the roller/chromium/main branch to fix patch conflicts during `e sync --3`. Covers the patch application workflow, conflict resolution, analyzing upstream Chromium changes, and proper commit formatting for patch fixes.
---
# Electron Chromium Upgrade: Phase One
## Summary
Run `e sync --3` repeatedly, fixing patch conflicts as they arise, until it succeeds. Then export patches and commit changes atomically.
## Success Criteria
Phase One is complete when:
- `e sync --3` exits with code 0 (no patch failures)
- All changes are committed per the commit guidelines
Do not stop until these criteria are met.
**CRITICAL** Do not delete or skip patches unless 100% certain the patch is no longer needed. Complicated conflicts or hard to resolve issues should be presented to the user after you have exhausted all other options. Do not delete the patch just because you can't solve it.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (where most patches apply)
- `patches/`: Patch files organized by target
- `docs/development/patches.md`: Patch system documentation
## Pre-flight Checks
Run these once at the start of each upgrade session:
1. **Clear rerere cache** (if enabled): `git rerere clear` in both the electron and `..` repos. Stale recorded resolutions from a prior attempt can silently apply wrong merges.
2. **Ensure pre-commit hooks are installed**: Check that `.git/hooks/pre-commit` exists. If not, run `yarn husky` to install it. The hook runs `lint-staged` which handles clang-format for C++ files.
## Workflow
1. Run `e sync --3` (the `--3` flag enables 3-way merge, always required)
2. If succeeds → skip to step 5
3. If patch fails:
- Identify target repo and patch from error output
- Analyze failure (see references/patch-analysis.md)
- Fix conflict in target repo's working directory
- Run `git am --continue` in affected repo
- Repeat until all patches for that repo apply
- IMPORTANT: Once `git am --continue` succeeds you MUST run `e patches {target}` to export fixes
- Return to step 1
4. When `e sync --3` succeeds, run `e patches all`
5. **Read `references/phase-one-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e sync --3` | Clone deps and apply patches with 3-way merge |
| `git am --continue` | Continue after resolving conflict (run in target repo) |
| `e patches {target}` | Export commits from target repo to patch files |
| `e patches all` | Export all patches from all targets |
| `e patches {target} --commit-updates` | Export patches and auto-commit trivial changes |
| `e patches --list-targets` | List targets and config paths |
## Patch System Mental Model
```
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
## When to Edit Patches
| Situation | Action |
|-----------|--------|
| During active `git am` conflict | Fix in target repo, then `git am --continue` |
| Modifying patch outside conflict | Edit `.patch` file directly |
| Creating new patch (rare, avoid) | Commit in target repo, then `e patches {target}` |
Fix existing patches 99% of the time rather than creating new ones.
## Patch Fixing Rules
1. **Preserve authorship**: Keep original author in TODO comments (from patch `From:` field)
2. **Never change TODO assignees**: `TODO(name)` must retain original name
3. **Update descriptions**: If upstream changed (e.g., `DCHECK``CHECK_IS_TEST`), update patch commit message to reflect current state
# Electron Chromium Upgrade: Phase Two
## Summary
Run `e build -k 999 -- --quiet` repeatedly, fixing build issues as they arise, until it succeeds. Then run `e start --version` to validate Electron launches and commit changes atomically.
Run Phase Two immediately after Phase One is complete.
## Success Criteria
Phase Two is complete when:
- `e build -k 999 -- --quiet` exits with code 0 (no build failures)
- `e start --version` has been run to check Electron launches
- All changes are committed per the commit guidelines
Do not stop until these criteria are met. Do not delete code or features, never comment out code in order to take short cut. Make all existing code, logic and intention work.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions. Chromium APIs frequently are renamed or refactored. In every case the code in Electron must be updated to account for the change in Chromium, strongly avoid making changes to the code in chromium to fix Electrons build.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (do not touch this code to fix build issues, just read it to obtain context)
## Workflow
1. Run `e build -k 999 -- --quiet` (the `--quiet` flag suppresses per-target status lines, showing only errors and the final result)
2. If succeeds → skip to step 6
3. If build fails:
- Identify underlying file in "electron" from the compilation error message
- Analyze failure
- Fix build issue by adapting Electron's code for the change in Chromium
- Run `e build -t {target_that_failed}.o` to build just the failed target we were specifically fixing
- You can identify the target_that_failed from the failure line in the build log. E.g. `FAILED: 2e506007-8d5d-4f38-bdd1-b5cd77999a77 "./obj/electron/chromium_src/chrome/process_singleton_posix.o" CXX obj/electron/chromium_src/chrome/process_singleton_posix.o` the target name is `obj/electron/chromium_src/chrome/process_singleton_posix.o`
- **Read `references/phase-two-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
- Return to step 1
4. **CRITICAL**: After ANY commit (especially patch commits), immediately run `git status` in the electron repo
- Look for other modified `.patch` files that only have index/hunk header changes
- These are dependent patches affected by your fix
- Commit them immediately with: `git commit -am "chore: update patches (trivial only)"`
5. Return to step 1
6. When `e build` succeeds, run `e start --version`
7. Check if you have any pending changes in the Chromium repo by running `git status`
- If you have changes follow the instructions below in "A. Patch Fixes" to correctly commit those modifications into the appropriate patch file
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e build -k 999 -- --quiet` | Build Electron, continue on errors, suppress status lines |
| `e build -t {target}.o` | Build just one specific target to verify a fix |
| `e start --version` | Validate Electron launches after successful build |
## Two Types of Build Fixes
### A. Patch Fixes (for files in chromium_src or patched Chromium files)
When the error is in a file that Electron patches (check with `grep -l "filename" patches/chromium/*.patch`):
1. Edit the file in the Chromium source tree (e.g., `/src/chrome/browser/...`)
2. Create a fixup commit targeting the original patch commit:
```bash
cd .. # to chromium repo
git add <modified-file>
git commit --fixup=<original-patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
```
3. Export the updated patch: `e patches chromium`
4. Commit the updated patch file following `references/phase-one-commit-guidelines.md`.
To find the original patch commit to fixup: `git log --oneline | grep -i "keyword from patch name"`
The base commit for rebase is the Chromium commit before patches were applied. Find it by checking the `refs/patches/upstream-head` ref.
### B. Electron Code Fixes (for files in shell/, electron/, etc.)
When the error is in Electron's own source code:
1. Edit files directly in the electron repo
2. Commit directly (no patch export needed)
# Critical: Read Before Committing
- Before ANY Phase One commits: Read `references/phase-one-commit-guidelines.md`
- Before ANY Phase Two commits: Read `references/phase-two-commit-guidelines.md`
# Skill Directory Structure
This skill has additional reference files in `references/`:
- patch-analysis.md - How to analyze patch failures
- phase-one-commit-guidelines.md - Commit format for Phase One
- phase-two-commit-guidelines.md - Commit format for Phase Two
Read these when referenced in the workflow steps.

View File

@@ -0,0 +1,119 @@
# Analyzing Patch Failures
## Investigation Steps
1. **Read the patch file** at `patches/{target}/{patch_name}.patch`
2. **Examine current state** of the file in Chromium at mentioned line numbers
3. **Check recent upstream changes:**
```bash
cd .. # or relevant target repo
git log --oneline -10 -- {file}
```
4. **Find Chromium CL** in commit messages:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/{CL_NUMBER}
```
## Critical: Resolve by Intent, Not by Mechanical Merge
When resolving a patch conflict, do NOT blindly preserve the patch's old code. Instead:
1. **Understand the upstream CL's full scope** — not just the conflicting hunk.
Run `git show <commit> --stat` and read diffs for all affected files.
Upstream may have removed structs, members, or methods that the patch
references in other hunks or files.
2. **Re-read the patch commit message** to understand its *intent* — what
behavior does it need to preserve or add?
3. **Implement the intent against the new upstream code.** If the patch's
purpose is "add a feature flag guard", add only the guard — don't also
restore old code inside the guard that upstream separately removed.
### Lesson: Upstream Removals Break Patch References
- **Trigger:** Patch conflict involves an upstream refactor (not just context drift)
- **Strategy:** After identifying the upstream CL, check its full diff for
removed types, members, and methods. If the patch's old code references
something removed, the resolution must use the new upstream mechanism.
- **Evidence:** An upstream CL removed a `HeadlessModeWindow` struct from a
header, but the conflict was only in a `.mm` file. Mechanically keeping the
patch's old line (`headless_mode_window_ = ...`) produced code referencing
a nonexistent type — caught only on review, not at patch-apply time.
### Lesson: Separate Patch Purpose from Patch Implementation
- **Trigger:** Conflict between "upstream simplified code" vs "patch has older code"
- **Strategy:** Identify the *minimal* change the patch needs. If the patch
wraps code in a conditional, only add the conditional — don't restore old
code that was inside the conditional but was separately cleaned up upstream.
- **Evidence:** An occlusion patch needed only a feature flag check, but the
old patch also contained a version check that upstream intentionally removed.
Mechanically preserving the old patch code re-added the removed check.
### Lesson: Finish the Adaptation at Conflict Time
- **Trigger:** A patch conflict involves an upstream API removal or replacement
- **Strategy:** When resolving the conflict, fully adapt the patch to use the
new API in the same commit. Don't remove the old code and leave behind stale
references that will "be fixed in Phase Two." Each patch fix commit should be
a complete resolution.
- **Evidence:** A safestorage patch conflicted because Chromium removed Keychain V1.
The conflict was resolved by removing V1 hunks, but the remaining code still
called V1 methods (`FindGenericPassword` with 3 args, `ItemDelete` with
`SecKeychainItemRef`). These should have been adapted to V2 APIs in the same
commit, not deferred.
## Common Failure Patterns
| Pattern | Cause | Solution |
|---------|-------|----------|
| Context lines don't match | Surrounding code changed | Update context in patch |
| File not found | File renamed/moved | Update patch target path |
| Function not found | Refactored upstream | Find new function name |
| `DCHECK` → `CHECK_IS_TEST` | Macro change | Update to new macro |
| Deleted code | Feature removed | Verify patch still needed |
## Using Git Blame
To find the CL that changed specific lines:
```bash
cd ..
git blame -L {start},{end} -- {file}
git log -1 {commit_sha} # Look for Reviewed-on: line
```
## Verifying Patch Necessity
Before deleting a patch, verify:
1. The patched functionality was intentionally removed upstream
2. Electron doesn't need the patch for other reasons
3. No other code depends on the patched behavior
When in doubt, keep the patch and adapt it.
## Phase Two: Build-Time Patch Issues
Sometimes patches that applied successfully in Phase One cause build errors in Phase Two. This can happen when:
1. **Incomplete types**: A patch disables a header include, but new upstream code uses the type
2. **Missing members**: A patch modifies a class, but upstream added new code referencing the original
### Finding Which Patch Affects a File
```bash
grep -l "filename.cc" patches/chromium/*.patch
```
Matching Existing Patch Patterns
When fixing build errors in patched files, examine the existing patch to understand its style:
- Does it use #if 0 / #endif guards?
- Does it use #if BUILDFLAG(...) conditionals?
- What's the pattern for disabled functionality?
Apply fixes consistent with the existing patch style.

View File

@@ -0,0 +1,102 @@
# Phase One Commit Guidelines
Only follow these instructions if there are uncommitted changes to `patches/` after Phase One succeeds.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Each Commit Must Be Complete
When resolving a patch conflict, fully adapt the patch to the new upstream code in the same commit. If the upstream change removes an API the patch uses, update the patch to use the replacement API now — don't leave stale references knowing they'll need fixing later. The goal is that each commit represents a finished resolution, not a partial one that defers known work to a future phase.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
### Patch conflict fixes
Use `fix(patch):` prefix. The title should name the upstream change, not your response to it:
```
fix(patch): {topic headline}
Ref: {Chromium CL link}
Co-Authored-By: <AI model attribution>
```
Only add a description body if it provides clarity beyond the title. For straightforward context drift or simple API renames, the title + Ref is sufficient.
Examples:
- `fix(patch): constant moved to header`
- `fix(patch): headless mode refactor upstream`
- `fix(patch): V1 Keychain removal`
### Upstreamed patch removal
When patches are no longer needed (applied cleanly with "already applied" or confirmed upstreamed), group ALL removals into a single commit:
```
chore: remove upstreamed patch
```
or (if multiple):
```
chore: remove upstreamed patches
```
If the patch file did NOT contain a `Reviewed-on: https://chromium-review.googlesource.com/c/chromium/...` link, add a `Ref:` in the commit. If it did (i.e. cherry-picks), no `Ref:` is needed.
### Trivial patch updates
After all fix commits, stage remaining trivial changes (index, line numbers, context only):
```bash
git add patches
git commit -m "chore: update patches (trivial only)"
```
**Conflict resolution can produce trivial results.** A `git am` conflict doesn't always mean the patch content changed — context drift alone can cause a conflict. After resolving and exporting, inspect the patch diff: if only index hashes, line numbers, and context lines changed (not the patch's own `+`/`-` lines), it's trivial and belongs here, not in a `fix(patch):` commit.
## Atomic Commits
Each patch conflict fix gets its own commit with its own Ref.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
## Finding CL References
Use `git log` or `git blame` on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Example Commits
### Patch conflict fix (simple — title is sufficient)
```
fix(patch): constant moved to header
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483
Co-Authored-By: <AI model attribution>
```
### Patch conflict fix (complex — description adds value)
```
fix(patch): V1 Keychain removal
Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted
keychain_password_mac.mm to use KeychainV2 APIs.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447
Co-Authored-By: <AI model attribution>
```

View File

@@ -0,0 +1,84 @@
# Phase Two Commit Guidelines
Only follow these instructions if there are uncommitted changes in the Electron repo after any fixes are made during Phase Two that result a target that was failing, successfully building.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters. Exception: upstream Chromium CL titles are used verbatim even if longer.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
## Two Commit Types
### For Electron Source Changes (shell/, electron/, etc.)
```
{CL-Number}: {upstream CL's original title}
Ref: {Chromium CL link}
Co-Authored-By: <AI model attribution>
```
Use the **upstream CL's original commit title** — do not paraphrase or rewrite it. To find it: `git log -1 --format=%s <chromium-commit-hash>`.
Only add a description body if it provides clarity beyond what the title already says (e.g., when Electron's adaptation is non-obvious). For simple renames, method additions, or straightforward API updates, the title + Ref link is sufficient.
Each change should have its own commit and its own Ref. Logically group into commits that make sense rather than one giant commit. You may include multiple "Ref" links if required.
For a CL link in the format `https://chromium-review.googlesource.com/c/chromium/src/+/2958369` the "CL-Number" is `2958369`.
IMPORTANT: Try really hard to find the CL reference. Each change you made should in theory have been in response to a change in Chromium. Do not give up easily.
### For Patch Updates (patches/chromium/*.patch)
Use the same fixup workflow as Phase One and follow `references/phase-one-commit-guidelines.md` for the commit message format (`fix(patch):` prefix, topic style).
## Dependent Patch Header Updates
After any patch modification, check for other affected patches:
```bash
git status
# If other .patch files show as modified with only index, line number, and context changes:
git add patches/
git commit -m "chore: update patches (trivial only)"
```
## Finding CL References
Use git log or git blame on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Example Commits
### Electron Source Fix (simple — title is self-explanatory)
```
7535923: Rename ozone buildflags
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923
Co-Authored-By: <AI model attribution>
```
### Electron Source Fix (complex — description adds value)
```
7534194: Convert some functions in ui::Clipboard to async
Adapted ExtractCustomPlatformNames calls to use RunLoop pattern
consistent with existing ReadImage implementation, since upstream
converted the API from synchronous return to callback-based.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194
Co-Authored-By: <AI model attribution>
```

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:933c7d6ff6802706875270bec2e3c891cf8add3f
image: ghcr.io/electron/devcontainer:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -48,7 +48,8 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
\"gen\": {
\"args\": [
\"import(\\\"//electron/build/args/testing.gn\\\")\",
\"use_remoteexec = true\"
\"use_remoteexec = true\",
\"use_siso=true\"
],
\"out\": \"Testing\"
},
@@ -58,7 +59,7 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
},
\"\$schema\": \"file:///home/builduser/.electron_build_tools/evm-config.schema.json\",
\"configValidationLevel\": \"strict\",
\"remoteBuild\": \"reclient\",
\"remoteBuild\": \"siso\",
\"preserveSDK\": 5
}
" >$buildtools/configs/evm.testing.json

View File

@@ -10,7 +10,8 @@ Contributors guide: https://github.com/electron/electron/blob/main/CONTRIBUTING.
#### Checklist
<!-- Remove items that do not apply. For completed items, change [ ] to [x]. -->
- [ ] PR description included and stakeholders cc'd
- [ ] PR description included
- [ ] I have built and tested this PR
- [ ] `npm test` passes
- [ ] tests are [changed or added](https://github.com/electron/electron/blob/main/docs/development/testing.md)
- [ ] relevant API documentation, tutorials, and examples are updated and follow the [documentation style guide](https://github.com/electron/electron/blob/main/docs/development/style-guide.md)

View File

@@ -26,6 +26,9 @@ inputs:
is-asan:
description: 'The ASan Linux build'
required: false
upload-out-gen-artifacts:
description: 'Whether to upload the out/${dir}/gen artifacts'
required: false
runs:
using: "composite"
steps:
@@ -45,6 +48,7 @@ runs:
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Build Electron ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
rm -rf "src/out/Default/Electron Framework.framework"
@@ -60,25 +64,51 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
if [ "$TARGET_PLATFORM" = "win" ]; then
npx node electron/script/build-stats.mjs out/Default/siso.exe.INFO --upload-stats || true
else
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
fi
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
- name: Build Electron (Windows) ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
cd src\electron
git pack-refs
cd ..
$env:NINJA_SUMMARIZE_BUILD = 1
if ("${{ inputs.is-release }}" -eq "true") {
e build --target electron:release_build
} else {
e build --target electron:testing_build
}
Copy-Item out\Default\.ninja_log out\electron_ninja_log
node electron\script\check-symlinks.js
# Upload build stats to Datadog
if ($env:DD_API_KEY) {
try {
npx node electron\script\build-stats.mjs out\Default\siso.exe.INFO --upload-stats ; $LASTEXITCODE = 0
} catch {
Write-Host "Build stats upload failed, continuing..."
}
} else {
Write-Host "Skipping build-stats.mjs upload because DD_API_KEY is not set"
}
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -86,11 +116,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot_zip
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -142,11 +171,6 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -166,17 +190,11 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -189,18 +207,6 @@ runs:
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip
e build --target electron:libcxxabi_headers_zip
e build --target electron:libcxx_objects_zip
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
@@ -209,10 +215,11 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -223,6 +230,11 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash
@@ -271,3 +283,9 @@ runs:
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
- name: Upload Out Gen Artifacts ${{ inputs.step-suffix }}
if: ${{ inputs.upload-out-gen-artifacts == 'true' }}
uses: actions/upload-artifact@65462800fd760344b1a7b4382951275a0abb4808
with:
name: out_gen_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src/out/Default/gen

View File

@@ -143,16 +143,17 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matcher
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
npx node src/electron/script/patches-stats.mjs --upload-stats || true
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD

View File

@@ -37,6 +37,22 @@ runs:
installation-dir: third_party/esbuild
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/esbuild/${platform}
- name: Fix rollup
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
dependency: rollup_libs
deps-file: src/third_party/devtools-frontend/src/DEPS
installation-dir: third_party/rollup_libs
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/rollup_libs/${platform}
- name: Sync native rollup libs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/devtools-frontend/src
python3 scripts/deps/sync_rollup_libs.py
- name: Fix rustc
if: ${{ inputs.target-platform != 'linux' }}
shell: bash

View File

@@ -64,15 +64,26 @@ runs:
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -15,7 +15,7 @@ runs:
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=a5d9f9052dcc36ee88bef5c8b13acbefd87b7d8d
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools

View File

@@ -6,7 +6,7 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@5a3ec84eff668545956fd18022155c47e93e2684 # v4.2.3
id: yarn-cache
with:
@@ -18,4 +18,14 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

122
.github/copilot-instructions.md vendored Normal file
View File

@@ -0,0 +1,122 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

View File

@@ -0,0 +1,16 @@
{
"problemMatcher": [
{
"owner": "markdownlint",
"pattern": [
{
"regexp": "^(.+):(\\d+):(\\d+)\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"message": 4
}
]
}
]
}

View File

@@ -19,6 +19,16 @@
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

73
.github/workflows/apply-patches.yml vendored Normal file
View File

@@ -0,0 +1,73 @@
name: Apply Patches
on:
pull_request:
permissions: {}
concurrency:
group: apply-patches-${{ github.ref }}
cancel-in-progress: true
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
has-patches: ${{ steps.filter.outputs.patches }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
persist-credentials: false
ref: ${{ github.event.pull_request.head.sha }}
# Use dorny/paths-filter instead of the path filter under the on: pull_request: block
# so that the output can be used to conditionally run the apply-patches job, which lets
# the job be marked as a required status check (conditional skip counts as a success).
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
id: filter
with:
filters: |
patches:
- DEPS
- 'patches/**'
apply-patches:
needs: setup
if: ${{ needs.setup.outputs.has-patches == 'true' }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
persist-credentials: false
ref: ${{ github.event.pull_request.base.ref }}
- name: Merge PR HEAD
working-directory: src/electron
env:
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
git config user.email "electron@github.com"
git config user.name "Electron Bot"
git fetch origin refs/pull/${PR_NUMBER}/head
git merge --squash FETCH_HEAD
git commit -n -m "Squashed commits"
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux

View File

@@ -3,19 +3,23 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@6044e13b5dc448c55e2357c09f80417699197238
with:
node-version: 20.19.x
node-version: 24.12.x
- name: Setting Up Dig Site
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
@@ -41,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f #v6.0.0
with:
name: artifacts
path: electron/artifacts

View File

@@ -11,20 +11,31 @@ permissions: {}
jobs:
audit_branch_ci:
name: Audit CI on Branches
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444 # v5.0.0
uses: actions/setup-node@6044e13b5dc448c55e2357c09f80417699197238 # v6.2.0
with:
node-version: 22.17.x
- run: npm install @actions/cache@4.0.3 @electron/fiddle-core@2.0.1
- name: Sparse checkout repository
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
@@ -74,6 +85,7 @@ jobs:
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)

View File

@@ -14,7 +14,7 @@ permissions: {}
jobs:
release-branch-created:
name: Release Branch Created
if: ${{ github.event_name == 'workflow_dispatch' || (github.event.ref_type == 'branch' && endsWith(github.event.ref, '-x-y') && !startsWith(github.event.ref, 'roller')) }}
if: ${{ github.repository == 'electron/electron' && (github.event_name == 'workflow_dispatch' || (github.event.ref_type == 'branch' && endsWith(github.event.ref, '-x-y') && !startsWith(github.event.ref, 'roller'))) }}
permissions:
contents: read
pull-requests: write
@@ -68,7 +68,7 @@ jobs:
done
- name: Generate GitHub App token
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}

View File

@@ -6,11 +6,16 @@ on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -19,7 +24,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -29,9 +34,12 @@ jobs:
target-platform: linux
build-git-cache-windows:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -41,7 +49,7 @@ jobs:
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -51,11 +59,14 @@ jobs:
target-platform: win
build-git-cache-macos:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -64,7 +75,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
skip-macos:
type: boolean
@@ -43,10 +43,14 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -54,7 +58,7 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
@@ -63,13 +67,17 @@ jobs:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=933c7d6ff6802706875270bec2e3c891cf8add3f" >> "$GITHUB_OUTPUT"
echo "build-image-sha=a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -80,6 +88,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
@@ -89,6 +99,8 @@ jobs:
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
@@ -98,6 +110,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -111,7 +125,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -126,6 +140,8 @@ jobs:
needs: setup
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -141,7 +157,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -155,6 +171,8 @@ jobs:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -171,7 +189,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -185,6 +203,8 @@ jobs:
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
@@ -195,6 +215,8 @@ jobs:
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
@@ -207,6 +229,8 @@ jobs:
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
@@ -260,13 +284,15 @@ jobs:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test-and-nan.yml
uses: ./.github/workflows/pipeline-electron-build-and-tidy-and-test-and-nan.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-centralus-linux-amd64-32core
clang-tidy-runs-on: electron-arc-centralus-linux-amd64-8core
test-runs-on: electron-arc-centralus-linux-amd64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
clang-tidy-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
target-arch: x64
@@ -310,7 +336,7 @@ jobs:
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -400,8 +426,10 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
if: always() && github.repository == 'electron/electron' && !contains(needs.*.result, 'failure')
steps:
- name: GitHub Actions Jobs Done
run: |

View File

@@ -1,16 +1,21 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root

View File

@@ -1,4 +1,4 @@
name: Issue Commented
name: Issue / Pull Request Commented
on:
issue_comment:
@@ -8,20 +8,20 @@ on:
permissions: {}
jobs:
issue-commented:
blocked-issue-commented:
name: Remove blocked/{need-info,need-repro} on comment
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-latest
if: ${{ !github.event.issue.pull_request && (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-slim
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
run: &get-author-association |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
@@ -33,3 +33,56 @@ jobs:
ISSUE_URL: ${{ github.event.issue.html_url }}
run: |
gh issue edit $ISSUE_URL --remove-label 'blocked/need-repro','blocked/need-info ❌'
pr-reviewer-requested:
name: Maintainer requested reviewer on PR
if: ${{ github.event.issue.pull_request && startsWith(github.event.comment.body, '/request-review') && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-slim
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: *get-author-association
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
if: ${{ contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Request reviewer
if: ${{ contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
PR_URL: ${{ github.event.issue.html_url }}
COMMENT_BODY: ${{ github.event.comment.body }}
run: |
RAW=$(echo "$COMMENT_BODY" | head -n 1 | sed 's|/request-review\s*||' | xargs)
if [ -z "$RAW" ]; then
echo "::warning::No username provided. Usage: /request-review <username>[,<username>,...]"
exit 0
fi
IFS=',' read -ra USERS <<< "$RAW"
for USER in "${USERS[@]}"; do
NAME=$(echo "$USER" | sed 's/@//g' | xargs)
if [ -z "$NAME" ]; then
continue
fi
# Strip "electron/" prefix if present to get the bare name
BARE_NAME=$(echo "$NAME" | sed 's|^electron/||')
# If the original name contained "electron/" or looks like a team slug, treat as team
if [ "$NAME" != "$BARE_NAME" ]; then
gh pr edit $PR_URL --add-reviewer "electron/$BARE_NAME"
else
if ! gh api /orgs/electron/public_members/$BARE_NAME --silent > /dev/null 2>&1; then
echo "::warning::$BARE_NAME is not a public member of the electron organization."
continue
fi
gh pr edit $PR_URL --add-reviewer "$BARE_NAME"
fi
done

View File

@@ -4,17 +4,18 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
@@ -31,9 +32,11 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
@@ -66,13 +69,13 @@ jobs:
fi
- name: Generate GitHub App token
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@71b62d7da76e59ff7b193904feb6e77d4dbb2777 # v3.7.6
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,9 +11,10 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
@@ -28,14 +29,22 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
@@ -44,9 +53,13 @@ jobs:
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -77,7 +90,6 @@ jobs:
labelExists = true;
} catch {}
const { ElectronVersions } = await import('${{ github.workspace }}/node_modules/@electron/fiddle-core/dist/index.js');
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
@@ -134,7 +146,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@50068f49b7b2b3857270ead65e2d02e4459b022c # v3.6.2
uses: actions-cool/issues-helper@71b62d7da76e59ff7b193904feb6e77d4dbb2777 # v3.7.6
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -10,10 +10,11 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels
@@ -23,7 +24,7 @@ jobs:
fi
- name: Generate GitHub App token
if: ${{ steps.check-for-blocked-labels.outputs.NOT_BLOCKED }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,9 +17,14 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -31,7 +36,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +44,12 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -54,7 +64,12 @@ jobs:
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
@@ -69,7 +84,12 @@ jobs:
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release

105
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,105 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
if: github.repository == 'electron/electron'
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,14 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -32,7 +37,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -43,7 +48,12 @@ jobs:
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
@@ -58,7 +68,12 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
@@ -73,7 +88,12 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
@@ -88,7 +108,12 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release

View File

@@ -7,6 +7,8 @@ on:
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -64,14 +64,13 @@ concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -86,6 +85,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -0,0 +1,124 @@
name: Electron Build & Clang Tidy & Test (+ Node + NaN) Pipeline
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux.'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
build-runs-on:
type: string
description: 'What host to run the build'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
build-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
clang-tidy-container:
type: string
description: 'JSON container information to run clang-tidy on'
required: false
default: '{"image":null}'
test-container:
type: string
description: 'JSON container information for testing'
required: false
default: '{"image":null}'
is-release:
description: 'Whether this build job is a release job'
required: true
type: boolean
default: false
gn-build-type:
description: 'The gn build type - testing or release'
required: true
type: string
default: testing
generate-symbols:
description: 'Whether or not to generate symbols'
required: true
type: boolean
default: false
upload-to-storage:
description: 'Whether or not to upload build artifacts to external storage'
required: true
type: string
default: '0'
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
is-release: ${{ inputs.is-release }}
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
upload-out-gen-artifacts: true
secrets: inherit
clang-tidy:
uses: ./.github/workflows/pipeline-segment-electron-clang-tidy.yml
permissions:
contents: read
needs: build
with:
clang-tidy-runs-on: ${{ inputs.clang-tidy-runs-on }}
clang-tidy-container: ${{ inputs.clang-tidy-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
gn-build-type: ${{ inputs.gn-build-type }}
secrets: inherit

View File

@@ -0,0 +1,121 @@
name: Electron Build & Clang Tidy & Test Pipeline
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
build-runs-on:
type: string
description: 'What host to run the build'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
build-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
clang-tidy-container:
type: string
description: 'JSON container information to run clang-tidy on'
required: false
default: '{"image":null}'
test-container:
type: string
description: 'JSON container information for testing'
required: false
default: '{"image":null}'
is-release:
description: 'Whether this build job is a release job'
required: true
type: boolean
default: false
gn-build-type:
description: 'The gn build type - testing or release'
required: true
type: string
default: testing
generate-symbols:
description: 'Whether or not to generate symbols'
required: true
type: boolean
default: false
upload-to-storage:
description: 'Whether or not to upload build artifacts to external storage'
required: true
type: string
default: '0'
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
concurrency:
group: electron-build-and-tidy-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
is-release: ${{ inputs.is-release }}
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
upload-out-gen-artifacts: true
secrets: inherit
clang-tidy:
uses: ./.github/workflows/pipeline-segment-electron-clang-tidy.yml
permissions:
contents: read
needs: build
with:
clang-tidy-runs-on: ${{ inputs.clang-tidy-runs-on }}
clang-tidy-container: ${{ inputs.clang-tidy-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
@@ -19,11 +21,13 @@ jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -39,7 +43,7 @@ jobs:
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -50,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -19,11 +21,13 @@ jobs:
lint:
name: Lint
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -61,9 +65,11 @@ jobs:
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add ESLint problem matcher
- name: Add problem matchers
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
run: |
echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
echo "::add-matcher::src/electron/.github/problem-matchers/markdownlint.json"
- name: Run Lint
shell: bash
run: |
@@ -74,11 +80,15 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -53,12 +53,19 @@ on:
required: false
type: boolean
default: false
upload-out-gen-artifacts:
description: 'Whether to upload the src/gen artifacts'
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -81,6 +88,8 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
@@ -91,7 +100,7 @@ jobs:
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -115,9 +124,9 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@6044e13b5dc448c55e2357c09f80417699197238
with:
node-version: 20.19.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
@@ -159,7 +168,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -197,6 +206,7 @@ jobs:
generate-symbols: '${{ inputs.generate-symbols }}'
upload-to-storage: '${{ inputs.upload-to-storage }}'
is-asan: '${{ inputs.is-asan }}'
upload-out-gen-artifacts: '${{ inputs.upload-out-gen-artifacts }}'
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' || inputs.target-variant == 'mas') }}
run: |

View File

@@ -0,0 +1,159 @@
name: Pipeline Segment - Electron Clang-Tidy
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
clang-tidy-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
permissions: {}
concurrency:
group: electron-clang-tidy-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref }}
cancel-in-progress: true
env:
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || (inputs.target-platform == 'linux' && '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' || '--custom-var=checkout_win=True') }}
ELECTRON_OUT_DIR: Default
jobs:
clang-tidy:
defaults:
run:
shell: bash
runs-on: ${{ inputs.clang-tidy-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.clang-tidy-container) }}
env:
BUILD_TYPE: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
ARTIFACT_KEY: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}_${{ inputs.target-arch }}
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Cleanup disk space on macOS
if: ${{ inputs.target-platform == 'macos' }}
shell: bash
run: |
sudo mkdir -p $TMPDIR/del-target
tmpify() {
if [ -d "$1" ]; then
sudo mv "$1" $TMPDIR/del-target/$(echo $1|shasum -a 256|head -n1|cut -d " " -f1)
fi
}
tmpify /Library/Developer/CoreSimulator
tmpify ~/Library/Developer/CoreSimulator
sudo rm -rf $TMPDIR/del-target
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Enable windows toolchain
if: ${{ inputs.target-platform == 'win' }}
run: |
echo "ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=1" >> $GITHUB_ENV
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' || inputs.target-platform == 'win' }}
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: ${{ inputs.target-platform }}
- name: Run Electron Only Hooks
run: |
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]" > tmpgclient
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False,'install_sysroot':False,'checkout_win':True},'managed':False}]" > tmpgclient
echo "target_os=['win']" >> tmpgclient
fi
e d gclient runhooks --gclientfile=tmpgclient
# Fix VS Toolchain
if [ "${{ inputs.target-platform }}" = "win" ]; then
rm -rf src/third_party/depot_tools/win_toolchain/vs_files
e d python3 src/build/vs_toolchain.py update --force
fi
- name: Regenerate DEPS Hash
run: |
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Default GN gen
run: |
cd src/electron
git pack-refs
- name: Download Out Gen Artifacts
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: out_gen_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src/out/${{ env.ELECTRON_OUT_DIR }}/gen
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Clang-Tidy
run: |
e init -f --root=$(pwd) --out=${ELECTRON_OUT_DIR} testing --target-cpu ${TARGET_ARCH}
export GN_EXTRA_ARGS="target_cpu=\"${TARGET_ARCH}\""
if [ "${{ inputs.target-platform }}" = "win" ]; then
export GN_EXTRA_ARGS="$GN_EXTRA_ARGS use_v8_context_snapshot=true target_os=\"win\""
fi
e build --only-gen
cd src/electron
node script/yarn.js lint:clang-tidy --jobs 8 --out-dir ../out/${ELECTRON_OUT_DIR}
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
if: always() && !cancelled()
shell: bash
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0

View File

@@ -0,0 +1,243 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
upload-out-gen-artifacts:
description: Whether to upload the src/gen artifacts
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@6044e13b5dc448c55e2357c09f80417699197238
with:
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
upload-out-gen-artifacts: ${{ inputs.upload-out-gen-artifacts }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -35,10 +35,7 @@ concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
@@ -53,6 +50,10 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
@@ -68,11 +69,12 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@a0853c24544627f65ddf259abe73b1d18a591444
uses: actions/setup-node@6044e13b5dc448c55e2357c09f80417699197238
with:
node-version: 20.19.x
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
@@ -117,7 +119,7 @@ jobs:
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -166,12 +168,12 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
@@ -195,10 +197,7 @@ jobs:
# sudo security authorizationdb write com.apple.trust-settings.admin allow
# cd src/electron
# ./script/codesign/generate-identity.sh
- name: Install Datadog CLI
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
- name: Run Electron Tests
shell: bash
env:
@@ -224,7 +223,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -241,9 +240,14 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
- name: Upload Test results to Datadog
@@ -255,13 +259,14 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
path: src/electron/spec/artifacts

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -39,6 +41,8 @@ jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +50,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +65,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +97,8 @@ jobs:
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +106,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +121,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@634f93cb2916e3fdff6788551b99b062d0335ce0
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +138,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

View File

@@ -11,6 +11,7 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
@@ -19,15 +20,19 @@ jobs:
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
@@ -39,3 +44,35 @@ jobs:
project-number: 94
field: Status
field-value: ✅ Reviewed
pull-request-labeled-ai-pr:
name: ai-pr label added
if: github.event.label.name == 'ai-pr'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
uses: actions-cool/issues-helper@71b62d7da76e59ff7b193904feb6e77d4dbb2777 # v3.7.6
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}
issue-number: ${{ github.event.pull_request.number }}
body: |
<!-- ai-pr -->
*AI PR Detected*
Hello @${{ github.event.pull_request.user.login }}. Due to the high amount of AI spam PRs we receive, if a PR is detected to be majority AI-generated without disclosure and untested, we will automatically close the PR.
We welcome the use of AI tools, as long as the PR meets our quality standards and has clearly been built and tested. If you believe your PR was closed in error, we welcome you to resubmit. However, please read our [CONTRIBUTING.md](http://contributing.md/) carefully before reopening. Thanks for your contribution.
- name: Close the pull request
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
GH_REPO: electron/electron
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
gh pr close "$PR_NUMBER"

View File

@@ -0,0 +1,71 @@
name: Rerun PR Apply Patches
on:
push:
branches:
- main
- '[1-9][0-9]-x-y'
paths:
- 'DEPS'
- 'patches/**'
permissions: {}
jobs:
rerun-apply-patches:
runs-on: ubuntu-latest
permissions:
actions: write
checks: read
contents: read
pull-requests: read
steps:
- name: Find PRs and Rerun Apply Patches
env:
GH_REPO: ${{ github.repository }}
GH_TOKEN: ${{ github.token }}
run: |
BRANCH="${GITHUB_REF#refs/heads/}"
# Find all open PRs targeting this branch
PRS=$(gh pr list --base "$BRANCH" --state open --limit 250 --json number)
echo "$PRS" | jq -c '.[]' | while read -r pr; do
PR_NUMBER=$(echo "$pr" | jq -r '.number')
echo "Processing PR #${PR_NUMBER}"
# Find the Apply Patches workflow check for this PR
CHECK=$(gh pr view "$PR_NUMBER" --json statusCheckRollup --jq '[.statusCheckRollup[] | select(.workflowName == "Apply Patches" and .name == "apply-patches")] | first')
if [ -z "$CHECK" ] || [ "$CHECK" = "null" ]; then
echo " No Apply Patches workflow found for PR #${PR_NUMBER}"
continue
fi
CONCLUSION=$(echo "$CHECK" | jq -r '.conclusion')
if [ "$CONCLUSION" = "SKIPPED" ]; then
echo " apply-patches job was skipped for PR #${PR_NUMBER} (no patches)"
continue
fi
LINK=$(echo "$CHECK" | jq -r '.detailsUrl')
# Extract the run ID from the link (format: .../runs/RUN_ID/job/JOB_ID)
RUN_ID=$(echo "$LINK" | grep -oE 'runs/[0-9]+' | cut -d'/' -f2)
if [ -z "$RUN_ID" ]; then
echo " Could not extract run ID from link: ${LINK}"
continue
fi
# Check if the workflow is currently in progress
RUN_STATUS=$(gh run view "$RUN_ID" --json status --jq '.status')
if [ "$RUN_STATUS" = "in_progress" ] || [ "$RUN_STATUS" = "queued" ] || [ "$RUN_STATUS" = "waiting" ]; then
echo " Workflow run ${RUN_ID} is ${RUN_STATUS}, cancelling..."
gh run cancel "$RUN_ID" --force
gh run watch "$RUN_ID"
fi
gh run rerun "$RUN_ID"
done

View File

@@ -13,6 +13,7 @@ permissions: read-all
jobs:
analysis:
name: Scorecards analysis
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
# Needed to upload the results to code-scanning dashboard.
@@ -22,7 +23,7 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
persist-credentials: false
@@ -42,7 +43,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@b7c566a772e6b6bfb58ed0dc250532a479d7789f # v6.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +51,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@f443b600d91635bebf5b0d9ebc620189c0d6fba5 # v3.29.5
uses: github/codeql-action/upload-sarif@89a39a4e59826350b863aa6b6252a07ad50cf83e # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:

View File

@@ -10,10 +10,12 @@ permissions: {}
jobs:
check-stable-prep-items:
name: Check Stable Prep Items
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}

View File

@@ -9,14 +9,16 @@ permissions: {}
jobs:
stale:
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
- uses: actions/stale@b5d41d4e1d5dceea10e7104786b73624c18a190f # tag: v10.2.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,19 +29,20 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
if: ${{ always() }}
permissions: {}
if: ${{ always() && github.repository == 'electron/electron' }}
needs: stale
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5f858e3efba33a5ca4407a664cc011ad407f2008 # tag: v10.1.0
- uses: actions/stale@b5d41d4e1d5dceea10e7104786b73624c18a190f # tag: v10.2.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -0,0 +1,39 @@
name: Update Website Docs
on:
release:
types: [published]
permissions: {}
jobs:
update-website-docs:
name: Update Website Docs
runs-on: ubuntu-latest
environment: website-docs-updater
permissions:
contents: read
id-token: write # needed for secret-service-action
steps:
- name: Get GitHub App token
id: secret-service
uses: electron/secret-service-action@3476425e8b30555aac15b1b7096938e254b0e155 # v1.0.0
- name: Check if this release is the latest
id: check-if-latest-release
env:
GH_REPO: electron/electron
GH_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
LATEST_RELEASE_TAG="$(gh release view --json tagName --jq '.tagName')"
if [ "$LATEST_RELEASE_TAG" = "${GITHUB_REF#refs/tags/}" ]; then
echo "isLatestRelease=true" >> $GITHUB_OUTPUT
else
echo "isLatestRelease=false" >> $GITHUB_OUTPUT
fi
- name: Trigger website docs update
if: ${{ steps.check-if-latest-release.outputs.isLatestRelease == 'true' }}
env:
GH_REPO: electron/website
GH_TOKEN: ${{ fromJSON(steps.secret-service.outputs.secrets).WEBSITE_DOCS_UPDATER_APP_TOKEN }}
run: |
gh workflow run update-docs.yml -f sha=$GITHUB_SHA

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '933c7d6ff6802706875270bec2e3c891cf8add3f'
default: 'a82b87d7a4f5ff0cab61405f8151ac4cf4942aeb'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,14 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -36,7 +41,7 @@ jobs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -47,7 +52,12 @@ jobs:
target-platform: win
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -61,7 +71,12 @@ jobs:
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
@@ -75,7 +90,12 @@ jobs:
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release

2
.gitignore vendored
View File

@@ -53,3 +53,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

942
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

12
.yarnrc.yml Normal file
View File

@@ -0,0 +1,12 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

View File

@@ -446,6 +446,7 @@ source_set("electron_lib") {
"shell/services/node/public/mojom",
"//base:base_static",
"//base/allocator:buildflags",
"//build/util:chromium_git_revision",
"//chrome:strings",
"//chrome/app:command_ids",
"//chrome/app/resources:platform_locale_settings",
@@ -480,6 +481,7 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
@@ -500,6 +502,7 @@ source_set("electron_lib") {
"//third_party/blink/public/platform/media",
"//third_party/boringssl",
"//third_party/electron_node:libnode",
"//third_party/highway:libhwy",
"//third_party/inspector_protocol:crdtp",
"//third_party/leveldatabase",
"//third_party/libyuv",
@@ -527,6 +530,7 @@ source_set("electron_lib") {
"//base",
"//base:i18n",
"//content/public/app",
"//ui/base/unowned_user_data",
]
include_dirs = [
@@ -592,6 +596,8 @@ source_set("electron_lib") {
use_libcxx_modules = false
deps += [
"//components/os_crypt/async/browser:keychain_key_provider",
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -653,6 +659,9 @@ source_set("electron_lib") {
":libnotify_loader",
"//build/config/linux/gtk",
"//components/crash/content/browser",
"//components/os_crypt/async/browser:freedesktop_secret_key_provider",
"//components/os_crypt/async/browser:posix_key_provider",
"//components/os_crypt/async/browser:secret_portal_key_provider",
"//dbus",
"//device/bluetooth",
"//third_party/crashpad/crashpad/client",
@@ -693,6 +702,7 @@ source_set("electron_lib") {
deps += [
"//components/app_launch_prefetch",
"//components/crash/core/app:crash_export_thunks",
"//components/os_crypt/async/browser:dpapi_key_provider",
"//third_party/libxml:xml_writer",
"//ui/wm",
"//ui/wm/public",
@@ -760,11 +770,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]
@@ -1624,6 +1636,29 @@ group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"

230
CLAUDE.md Normal file
View File

@@ -0,0 +1,230 @@
# Electron Development Guide
## Project Overview
Electron is a framework for building cross-platform desktop applications using web technologies. It embeds Chromium for rendering and Node.js for backend functionality.
## Directory Structure
```text
electron/ # This repo (run `e` commands here)
├── shell/ # Core C++ application code
│ ├── browser/ # Main process implementation (107+ API modules)
│ ├── renderer/ # Renderer process code
│ ├── common/ # Shared code between processes
│ ├── app/ # Application entry points
│ └── services/ # Node.js service integration
├── lib/ # TypeScript/JavaScript library code
│ ├── browser/ # Main process JS (47 API implementations)
│ ├── renderer/ # Renderer process JS
│ └── common/ # Shared JS modules
├── patches/ # Patches for upstream dependencies
│ ├── chromium/ # ~159 patches to Chromium
│ ├── node/ # ~48 patches to Node.js
│ └── ... # Other targets (v8, boringssl, etc.)
├── spec/ # Test suite (1189+ TypeScript test files)
├── docs/ # API documentation and guides
├── build/ # Build configuration
├── script/ # Build and automation scripts
└── chromium_src/ # Chromium source overrides
../ # Parent directory is Chromium source
```
## Build Tools Setup
Electron uses `@electron/build-tools` for development. The `e` command is the primary CLI.
**Installation:**
```bash
npm i -g @electron/build-tools
```
**Configuration location:** `~/.electron_build_tools/configs/`
## Essential Commands
### Configuration Management
| Command | Purpose |
|---------|---------|
| `e init <name> --root=<path> --bootstrap testing` | Create new build config and sync |
| `e use <name>` | Switch to a different build configuration |
| `e show current` | Display active configuration name |
| `e show configs` | List all available configurations |
### Build & Development Loop
| Command | Purpose |
|---------|---------|
| `e sync` | Fetch/update all source code and apply patches |
| `e sync --3` | Sync with 3-way merge (required for Chromium upgrades) |
| `e build` | Build Electron (runs GN + Ninja) |
| `e build -k 999` | Build and continue on errors (up to 999) |
| `e build -t <target>` | Build specific target (e.g., `electron:node_headers`) |
| `e start` | Run the built Electron executable |
| `e start --version` | Verify Electron launches and print version |
| `e test` | Run the test suite |
| `e debug` | Run Electron in debugger (lldb on macOS, gdb on Linux) |
### Patch Management
| Command | Purpose |
|---------|---------|
| `e patches <target>` | Export patches for a target (chromium, node, v8, etc.) |
| `e patches all` | Export all patches from all targets |
| `e patches --list-targets` | List available patch targets |
## Typical Development Workflow
```bash
# 1. Ensure you're on the right config
e show current
# 2. Sync to get latest code
e sync
# 3. Make your changes in shell/ or lib/ or ../
# 4. Build
e build
# 5. Test your changes (Leave the user to do this, don't run these commands unless asked)
e start
e test
# 6. If you modified patched files in Chromium:
cd .. # Go to Chromium repo
git add <files>
git commit -m "description of change"
cd electron
e patches chromium # Export the patch
```
## Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) to add features or modify behavior.
**How patches work:**
```text
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
**Patch configuration:** `patches/config.json` maps patch directories to target repos.
**Key rules:**
- Fix existing patches 99% of the time rather than creating new ones
- Preserve original authorship in TODO comments
- Never change TODO assignees (`TODO(name)` must retain original name)
- Each patch file includes commit message explaining its purpose
**Creating/modifying patches:**
1. Make changes in the target repo (e.g., `../` for Chromium)
2. Create a git commit
3. Run `e patches <target>` to export
## Testing
**Test location:** `spec/` directory
**Running tests:**
```bash
e test # Run full test suite
```
**Test frameworks:** Mocha, Chai, Sinon
## Build Configuration
**GN build arguments:** Located in `build/args/`:
- `testing.gn` - Debug/testing builds
- `release.gn` - Release builds
- `all.gn` - Common arguments for all builds
**Main build file:** `BUILD.gn`
**Feature flags:** `buildflags/buildflags.gni`
## Chromium Upgrade Workflow
When working on the `roller/chromium/main` branch to upgrade Chromium activate the "Electron Chromium Upgrade" skill.
## Pull Requests
PR bodies must always include a `Notes:` section as the **last line** of the body. This is a consumer-facing release note for Electron app developers — describe the user-visible fix or change, not internal implementation details. Use `Notes: none` if there is no user-facing change.
## Code Style
**C++:** Follows Chromium style, enforced by clang-format
**TypeScript/JavaScript:** ESLint configuration in `.eslintrc.json`
**Linting:**
```bash
npm run lint # Run all linters
npm run lint:clang-format # C++ formatting
```
## Key Files
| File | Purpose |
|------|---------|
| `BUILD.gn` | Main GN build configuration |
| `DEPS` | Dependency versions and checkout paths |
| `patches/config.json` | Patch target configuration |
| `filenames.gni` | Source file lists by platform |
| `package.json` | Node.js dependencies and scripts |
## Environment Variables
| Variable | Purpose |
|----------|---------|
| `GN_EXTRA_ARGS` | Additional GN arguments (useful in CI) |
| `ELECTRON_RUN_AS_NODE=1` | Run Electron as Node.js |
## Useful Git Commands for Chromium
```bash
# Find CL that changed a file
cd ..
git log --oneline -10 -- {file}
git blame -L {start},{end} -- {file}
# Look for Chromium CL reference in commit
git log -1 {commit_sha} # Find "Reviewed-on:" line
# Find which patch affects a file
grep -l "filename.cc" patches/chromium/*.patch
```
## CI/CD
GitHub Actions workflows in `.github/workflows/`:
- `build.yml` - Main build workflow
- `pipeline-electron-lint.yml` - Linting
- `pipeline-segment-electron-test.yml` - Testing
## Common Issues
**Patch conflict during sync:**
- Use `e sync --3` for 3-way merge
- Check if file was renamed/moved upstream
- Verify patch is still needed
**Build error in patched file:**
- Find the patch: `grep -l "filename" patches/chromium/*.patch`
- Match existing patch style (#if 0 guards, BUILDFLAG conditionals, etc.)
**Remote build issues:**
- Try `e build --no-remote` to build locally
- Check reclient/siso configuration in your build config

13
DEPS
View File

@@ -2,17 +2,17 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'143.0.7469.0',
'147.0.7699.0',
'node_version':
'v22.20.0',
'v24.14.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
'74ab5baccc6f7202c8ac69a8d1e152c29dc1ea76',
'mantle_version':
'78d3966b3c331292ea29ec38661b25df0a245948',
'2a8e2123a3931038179ee06105c9e6ec336b12ea',
'engflow_reclient_configs_version':
'955335c30a752e9ef7bff375baab5e0819b6c00d',
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.22.22',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -155,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -37,9 +37,9 @@ For more installation options and troubleshooting tips, see
Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Big Sur and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* macOS (Monterey and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer

View File

@@ -2,7 +2,7 @@ is_electron_build = true
root_extra_deps = [ "//electron" ]
# Registry of NMVs --> https://github.com/nodejs/node/blob/main/doc/abi_version_registry.json
node_module_version = 140
node_module_version = 145
v8_promise_internal_field_count = 1
v8_embedder_string = "-electron.0"

View File

@@ -9,5 +9,6 @@
"embedded_asar_integrity_validation": "0",
"only_load_app_from_asar": "0",
"load_browser_process_specific_v8_snapshot": "0",
"grant_file_protocol_extra_privileges": "1"
"grant_file_protocol_extra_privileges": "1",
"wasm_trap_handlers": "1"
}

View File

@@ -1,21 +0,0 @@
# -*- bazel-starlark -*-
load("@builtin//struct.star", "module")
def __platform_properties(ctx):
container_image = "docker://gcr.io/chops-public-images-prod/rbe/siso-chromium/linux@sha256:d7cb1ab14a0f20aa669c23f22c15a9dead761dcac19f43985bf9dd5f41fbef3a"
return {
"default": {
"OSFamily": "Linux",
"container-image": container_image,
},
"large": {
"OSFamily": "Linux",
"container-image": container_image,
},
}
backend = module(
"backend",
platform_properties = __platform_properties,
)

View File

@@ -1,66 +0,0 @@
load("@builtin//encoding.star", "json")
load("@builtin//path.star", "path")
load("@builtin//runtime.star", "runtime")
load("@builtin//struct.star", "module")
load("@config//main.star", upstream_init = "init")
load("@config//win_sdk.star", "win_sdk")
load("@config//gn_logs.star", "gn_logs")
def init(ctx):
mod = upstream_init(ctx)
step_config = json.decode(mod.step_config)
# Buildbarn doesn't support input_root_absolute_path so disable that
for rule in step_config["rules"]:
input_root_absolute_path = rule.get("input_root_absolute_path", False)
if input_root_absolute_path:
rule.pop("input_root_absolute_path", None)
# Only wrap clang rules with a remote wrapper if not on Linux. These are currently only
# needed for X-Compile builds, which run on Windows and Mac.
if runtime.os != "linux":
for rule in step_config["rules"]:
if rule["name"].startswith("clang/") or rule["name"].startswith("clang-cl/"):
rule["remote_wrapper"] = "../../buildtools/reclient_cfgs/chromium-browser-clang/clang_remote_wrapper"
if "inputs" not in rule:
rule["inputs"] = []
rule["inputs"].append("buildtools/reclient_cfgs/chromium-browser-clang/clang_remote_wrapper")
rule["inputs"].append("third_party/llvm-build/Release+Asserts_linux/bin/clang")
if "executables" not in step_config:
step_config["executables"] = []
step_config["executables"].append("buildtools/reclient_cfgs/chromium-browser-clang/clang_remote_wrapper")
step_config["executables"].append("third_party/llvm-build/Release+Asserts_linux/bin/clang")
if runtime.os == "darwin":
# Update platforms to match our default siso config instead of reclient configs.
step_config["platforms"].update({
"clang": step_config["platforms"]["default"],
"clang_large": step_config["platforms"]["default"],
})
if runtime.os == "windows":
# Add additional Windows SDK headers needed by Electron
win_toolchain_dir = win_sdk.toolchain_dir(ctx)
if win_toolchain_dir:
sdk_version = gn_logs.read(ctx).get("windows_sdk_version")
step_config["input_deps"][win_toolchain_dir + ":headers"].extend([
# third_party/electron_node/deps/uv/include/uv/win.h includes mswsock.h
path.join(win_toolchain_dir, "Windows Kits/10/Include", sdk_version, "um/mswsock.h"),
# third_party/electron_node/src/debug_utils.cc includes lm.h
path.join(win_toolchain_dir, "Windows Kits/10/Include", sdk_version, "um/Lm.h"),
])
# Update platforms to match our default siso config instead of reclient configs.
step_config["platforms"].update({
"clang-cl": step_config["platforms"]["default"],
"clang-cl_large": step_config["platforms"]["default"],
"lld-link": step_config["platforms"]["default"],
})
return module(
"config",
step_config = json.encode(step_config),
filegroups = mod.filegroups,
handlers = mod.handlers,
)

View File

@@ -383,6 +383,8 @@ static_library("chrome") {
"//chrome/browser/pdf/chrome_pdf_stream_delegate.h",
"//chrome/browser/pdf/pdf_extension_util.cc",
"//chrome/browser/pdf/pdf_extension_util.h",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.cc",
"//chrome/browser/pdf/pdf_help_bubble_handler_factory.h",
"//chrome/browser/pdf/pdf_viewer_stream_manager.cc",
"//chrome/browser/pdf/pdf_viewer_stream_manager.h",
"//chrome/browser/plugins/pdf_iframe_navigation_throttle.cc",
@@ -391,6 +393,8 @@ static_library("chrome") {
deps += [
"//components/pdf/browser",
"//components/pdf/renderer",
"//ui/base/interaction",
"//ui/webui/resources/cr_components/help_bubble:mojo_bindings",
]
}
} else {

View File

@@ -110,11 +110,9 @@ async function loadApplicationPackage (packagePath: string) {
} else if (packageJson.name) {
app.name = packageJson.name;
}
if (packageJson.desktopName) {
app.setDesktopName(packageJson.desktopName);
} else {
app.setDesktopName(`${app.name}.desktop`);
}
app.setDesktopName(packageJson.desktopName || `${app.name}.desktop`);
// Set v8 flags, deliberately lazy load so that apps that do not use this
// feature do not pay the price
if (packageJson.v8Flags) {

View File

@@ -250,7 +250,9 @@ Returns:
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
### Event: 'browser-window-blur'
@@ -565,8 +567,9 @@ and subscribing to the `ready` event if the app is not ready yet.
* `steal` boolean _macOS_ - Make the receiver the active app even if another app is
currently active.
On Linux, focuses on the first visible window. On macOS, makes the application
the active app. On Windows, focuses on the application's first window.
On macOS, makes the application the active app. On Windows, focuses on the application's
first window. On Linux, either focuses on the first visible window (X11) or requests
focus but may instead show a notification or flash the app icon (Wayland).
You should seek to use the `steal` option as sparingly as possible.
@@ -611,7 +614,7 @@ Returns `string` - The current application directory.
may backup this directory to cloud storage.
* `sessionData` The directory for storing data generated by `Session`, such
as localStorage, cookies, disk cache, downloaded dictionaries, network
state, devtools files. By default this points to `userData`. Chromium may
state, DevTools files. By default this points to `userData`. Chromium may
write very large disk cache here, so if your app does not rely on browser
storage like localStorage or cookies to save user data, it is recommended
to set this directory to other locations to avoid polluting the `userData`
@@ -632,7 +635,7 @@ Returns `string` - The current application directory.
Returns `string` - A path to a special directory or file associated with `name`. On
failure, an `Error` is thrown.
If `app.getPath('logs')` is called without called `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
If `app.getPath('logs')` is called without calling `app.setAppLogsPath()` being called first, a default log directory will be created equivalent to calling `app.setAppLogsPath()` without a `path` parameter.
### `app.getFileIcon(path[, options])`
@@ -647,7 +650,7 @@ Returns `Promise<NativeImage>` - fulfilled with the app's icon, which is a [Nati
Fetches a path's associated icon.
On _Windows_, there a 2 kinds of icons:
On _Windows_, there are 2 kinds of icons:
* Icons associated with certain file extensions, like `.mp3`, `.png`, etc.
* Icons inside the file itself, like `.exe`, `.dll`, `.ico`.
@@ -763,7 +766,7 @@ app.getPreferredSystemLanguages() // ['fr-CA', 'en-US', 'zh-Hans-FI', 'es-419']
Both the available languages and regions and the possible return values differ between the two operating systems.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region,and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
As can be seen with the example above, on Windows, it is possible that a preferred system language has no country code, and that one of the preferred system languages corresponds with the language used for the regional format. On macOS, the region serves more as a default country code: the user doesn't need to have Finnish as a preferred language to use Finland as the region, and the country code `FI` is used as the country code for preferred system languages that do not have associated countries in the language name.
### `app.addRecentDocument(path)` _macOS_ _Windows_
@@ -1121,6 +1124,19 @@ Updates the current activity if its type matches `type`, merging the entries fro
Changes the [Application User Model ID][app-user-model-id] to `id`.
### `app.setToastActivatorCLSID(id)` _Windows_
* `id` string
Changes the [Toast Activator CLSID][toast-activator-clsid] to `id`. If one is not set via this method, it will be randomly generated for the app.
* The value must be a valid GUID/CLSID in one of the following forms:
* Canonical brace-wrapped: `{XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX}` (preferred)
* Canonical without braces: `XXXXXXXX-XXXX-XXXX-XXXX-XXXXXXXXXXXX` (braces will be added automatically)
* Hex digits are case-insensitive.
This method should be called early (before showing notifications) so the value is baked into the registration/shortcut. Supplying an empty string or an unparsable value throws and leaves the existing (or generated) CLSID unchanged. If this method is never called, a random CLSID is generated once per run and exposed via `app.toastActivatorCLSID`.
### `app.setActivationPolicy(policy)` _macOS_
* `policy` string - Can be 'regular', 'accessory', or 'prohibited'.
@@ -1215,10 +1231,17 @@ Disables hardware acceleration for current app.
This method can only be called before app is ready.
### `app.isHardwareAccelerationEnabled()`
Returns `boolean` - whether hardware acceleration is currently enabled.
> [!NOTE]
> This information is only usable after the `gpu-info-update` event is emitted.
### `app.disableDomainBlockingFor3DAPIs()`
By default, Chromium disables 3D APIs (e.g. WebGL) until restart on a per
domain basis if the GPU processes crashes too frequently. This function
domain basis if the GPU process crashes too frequently. This function
disables that behavior.
This method can only be called before app is ready.
@@ -1277,6 +1300,8 @@ For `infoType` equal to `basic`:
Using `basic` should be preferred if only basic information like `vendorId` or `deviceId` is needed.
Promise is rejected if the GPU is completely disabled, i.e. no hardware and software implementations are available.
### `app.setBadgeCount([count])` _Linux_ _macOS_
* `count` Integer (optional) - If a value is provided, set the badge to the provided value otherwise, on macOS, display a plain white dot (e.g. unknown number of notifications). On Linux, if a value is not provided the badge will not display.
@@ -1307,7 +1332,7 @@ Returns `boolean` - Whether the current desktop environment is Unity launcher.
### `app.getLoginItemSettings([options])` _macOS_ _Windows_
* `options` Object (optional)
* `type` string (optional) _macOS_ - Can be one of `mainAppService`, `agentService`, `daemonService`, or `loginItemService`. Defaults to `mainAppService`. Only available on macOS 13 and up. See [app.setLoginItemSettings](app.md#appsetloginitemsettingssettings-macos-windows) for more information about each type.
* `type` string (optional) _macOS_ - Can be `mainAppService`, `agentService`, `daemonService`, or `loginItemService`. Defaults to `mainAppService`. Only available on macOS 13 and up. See [app.setLoginItemSettings](app.md#appsetloginitemsettingssettings-macos-windows) for more information about each type.
* `serviceName` string (optional) _macOS_ - The name of the service. Required if `type` is non-default. Only available on macOS 13 and up.
* `path` string (optional) _Windows_ - The executable path to compare against. Defaults to `process.execPath`.
* `args` string[] (optional) _Windows_ - The command-line arguments to compare against. Defaults to an empty array.
@@ -1322,13 +1347,13 @@ Returns `Object`:
* `wasOpenedAtLogin` boolean _macOS_ - `true` if the app was opened at login automatically.
* `wasOpenedAsHidden` boolean _macOS_ _Deprecated_ - `true` if the app was opened as a hidden login item. This indicates that the app should not open any windows at startup. This setting is not available on [MAS builds][mas-builds] or on macOS 13 and up.
* `restoreState` boolean _macOS_ _Deprecated_ - `true` if the app was opened as a login item that should restore the state from the previous session. This indicates that the app should restore the windows that were open the last time the app was closed. This setting is not available on [MAS builds][mas-builds] or on macOS 13 and up.
* `status` string _macOS_ - can be one of `not-registered`, `enabled`, `requires-approval`, or `not-found`.
* `status` string _macOS_ - can be `not-registered`, `enabled`, `requires-approval`, or `not-found`.
* `executableWillLaunchAtLogin` boolean _Windows_ - `true` if app is set to open at login and its run key is not deactivated. This differs from `openAtLogin` as it ignores the `args` option, this property will be true if the given executable would be launched at login with **any** arguments.
* `launchItems` Object[] _Windows_
* `name` string _Windows_ - name value of a registry entry.
* `path` string _Windows_ - The executable to an app that corresponds to a registry entry.
* `args` string[] _Windows_ - the command-line arguments to pass to the executable.
* `scope` string _Windows_ - one of `user` or `machine`. Indicates whether the registry entry is under `HKEY_CURRENT USER` or `HKEY_LOCAL_MACHINE`.
* `scope` string _Windows_ - can be `user` or `machine`. Indicates whether the registry entry is under `HKEY_CURRENT USER` or `HKEY_LOCAL_MACHINE`.
* `enabled` boolean _Windows_ - `true` if the app registry key is startup approved and therefore shows as `enabled` in Task Manager and Windows settings.
### `app.setLoginItemSettings(settings)` _macOS_ _Windows_
@@ -1398,7 +1423,75 @@ details. Disabled by default.
This API must be called after the `ready` event is emitted.
> [!NOTE]
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default.
> Rendering accessibility tree can significantly affect the performance of your app. It should not be enabled by default. Calling this method will enable the following accessibility support features: `nativeAPIs`, `webContents`, `inlineTextBoxes`, and `extendedProperties`.
### `app.getAccessibilitySupportFeatures()` _macOS_ _Windows_
Returns `string[]` - Array of strings naming currently enabled accessibility support components. Possible values:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
Notes:
* The array may be empty if no accessibility modes are active.
* Use `app.isAccessibilitySupportEnabled()` for the legacy boolean check;
prefer this method for granular diagnostics or telemetry.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
if (app.getAccessibilitySupportFeatures().includes('screenReader')) {
// Change some app UI to better work with Screen Readers.
}
})
```
### `app.setAccessibilitySupportFeatures(features)` _macOS_ _Windows_
* `features` string[] - An array of the accessibility features to enable.
Possible values are:
* `nativeAPIs` - Native OS accessibility APIs integration enabled.
* `webContents` - Web contents accessibility tree exposure enabled.
* `inlineTextBoxes` - Inline text boxes (character bounding boxes) enabled.
* `extendedProperties` - Extended accessibility properties enabled.
* `screenReader` - Screen reader specific mode enabled.
* `html` - HTML accessibility tree construction enabled.
* `labelImages` - Accessibility support for automatic image annotations.
* `pdfPrinting` - Accessibility support for PDF printing enabled.
To disable all supported features, pass an empty array `[]`.
Example:
```js
const { app } = require('electron')
app.whenReady().then(() => {
// Enable a subset of features:
app.setAccessibilitySupportFeatures([
'screenReader',
'pdfPrinting',
'webContents'
])
// Other logic
// Some time later, disable all features:
app.setAccessibilitySupportFeatures([])
})
```
### `app.showAboutPanel()`
@@ -1626,8 +1719,13 @@ platforms) that allows you to perform actions on your app icon in the user's doc
A `boolean` property that returns `true` if the app is packaged, `false` otherwise. For many apps, this property can be used to distinguish development and production environments.
### `app.toastActivatorCLSID` _Windows_ _Readonly_
A `string` property that returns the app's [Toast Activator CLSID][toast-activator-clsid].
[tasks]:https://learn.microsoft.com/en-us/windows/win32/shell/taskbar-extensions#tasks
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[toast-activator-clsid]: https://learn.microsoft.com/en-us/windows/win32/properties/props-system-appusermodel-toastactivatorclsid
[electron-forge]: https://www.electronforge.io/
[electron-packager]: https://github.com/electron/packager
[CFBundleURLTypes]: https://developer.apple.com/library/ios/documentation/General/Reference/InfoPlistKeyReference/Articles/CoreFoundationKeys.html#//apple_ref/doc/uid/TP40009249-102207-TPXREF115

View File

@@ -32,9 +32,19 @@ update process. Apps that need to disable ATS can add the
### Windows
On Windows, you have to install your app into a user's machine before you can
use the `autoUpdater`, so it is recommended that you use
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib] to generate a Windows installer.
On Windows, the `autoUpdater` module automatically selects the appropriate update mechanism
based on how your app is packaged:
* **MSIX packages**: If your app is running as an MSIX package (created with [electron-windows-msix][msix-lib] and detected via [`process.windowsStore`](process.md#processwindowsstore-readonly)),
the module uses the MSIX updater, which supports direct MSIX file links and JSON update feeds.
* **Squirrel.Windows**: For apps installed via traditional installers (created with
[electron-winstaller][installer-lib] or [Electron Forge's Squirrel.Windows maker][electron-forge-lib]),
the module uses Squirrel.Windows for updates.
You don't need to configure which updater to use; Electron automatically detects the packaging
format and uses the appropriate one.
#### Squirrel.Windows
Apps built with Squirrel.Windows will trigger [custom launch events](https://github.com/Squirrel/Squirrel.Windows/blob/51f5e2cb01add79280a53d51e8d0cfa20f8c9f9f/docs/using/custom-squirrel-events-non-cs.md#application-startup-commands)
that must be handled by your Electron application to ensure proper setup and teardown.
@@ -55,6 +65,14 @@ The installer generated with Squirrel.Windows will create a shortcut icon with a
same ID for your app with `app.setAppUserModelId` API, otherwise Windows will
not be able to pin your app properly in task bar.
#### MSIX Packages
When your app is packaged as an MSIX, the `autoUpdater` module provides additional
functionality:
* Use the `allowAnyVersion` option in `setFeedURL()` to allow updates to older versions (downgrades)
* Support for direct MSIX file links or JSON update feeds (similar to Squirrel.Mac format)
## Events
The `autoUpdater` object emits the following events:
@@ -92,7 +110,7 @@ Returns:
Emitted when an update has been downloaded.
On Windows only `releaseName` is available.
With Squirrel.Windows only `releaseName` is available.
> [!NOTE]
> It is not strictly necessary to handle this event. A successfully
@@ -100,6 +118,13 @@ On Windows only `releaseName` is available.
### Event: 'before-quit-for-update'
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/12619
```
-->
This event is emitted after a user calls `quitAndInstall()`.
When this API is called, the `before-quit` event is not emitted before all windows are closed. As a result you should listen to this event if you wish to perform actions before the windows are closed while a process is quitting, as well as listening to `before-quit`.
@@ -110,11 +135,23 @@ The `autoUpdater` object has the following methods:
### `autoUpdater.setFeedURL(options)`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/5879
description: "Added `headers` as a second parameter."
- pr-url: https://github.com/electron/electron/pull/11925
description: "Changed API to accept a single `options` argument (contains `url`, `headers`, and `serverType` properties)."
```
-->
* `options` Object
* `url` string
* `url` string - The update server URL. For _Windows_ MSIX, this can be either a direct link to an MSIX file (e.g., `https://example.com/update.msix`) or a JSON endpoint that returns update information (see the [Squirrel.Mac][squirrel-mac] README for more information).
* `headers` Record\<string, string\> (optional) _macOS_ - HTTP request headers.
* `serverType` string (optional) _macOS_ - Can be `json` or `default`, see the [Squirrel.Mac][squirrel-mac]
README for more information.
* `allowAnyVersion` boolean (optional) _Windows_ - If `true`, allows downgrades to older versions for MSIX packages.
Defaults to `false`.
Sets the `url` and initialize the auto updater.
@@ -151,3 +188,4 @@ closed.
[electron-forge-lib]: https://www.electronforge.io/config/makers/squirrel.windows
[app-user-model-id]: https://learn.microsoft.com/en-us/windows/win32/shell/appids
[event-emitter]: https://nodejs.org/api/events.html#events_class_eventemitter
[msix-lib]: https://github.com/electron-userland/electron-windows-msix

View File

@@ -351,7 +351,11 @@ Emitted when the window has closed a sheet.
#### Event: 'new-window-for-tab' _macOS_
Emitted when the native new tab button is clicked.
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
#### Event: 'system-context-menu' _Windows_ _Linux_
@@ -756,6 +760,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -969,6 +976,9 @@ Moves window to `x` and `y`.
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1043,7 +1053,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1262,15 +1272,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1283,11 +1294,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -140,6 +140,10 @@ state is `hidden` in order to minimize power consumption.
move.
* On Linux the type of modal windows will be changed to `dialog`.
* On Linux many desktop environments do not support hiding a modal window.
* On Wayland (Linux) it is generally not possible to programmatically resize windows
after creation, or to position, move, focus, or blur windows without user input.
If your app needs these capabilities, run it in Xwayland by appending the flag
`--ozone-platform=x11`.
## Class: BrowserWindow extends `BaseWindow`
@@ -431,7 +435,11 @@ Emitted when the window has closed a sheet.
#### Event: 'new-window-for-tab' _macOS_
Emitted when the native new tab button is clicked.
Emitted when the user clicks the native macOS new tab button. The new
tab button is only visible if the current `BrowserWindow` has a
`tabbingIdentifier`.
You must create a window in this handler in order for macOS tabbing to work as expected.
#### Event: 'system-context-menu' _Windows_ _Linux_
@@ -656,10 +664,15 @@ the [close event](#event-close).
Focuses on the window.
On Wayland (Linux), the desktop environment may show a notification or flash
the app icon if the window or app is not already focused.
#### `win.blur()`
Removes focus from the window.
Not supported on Wayland (Linux).
#### `win.isFocused()`
Returns `boolean` - Whether the window is focused.
@@ -676,6 +689,8 @@ Shows and gives focus to the window.
Shows the window but doesn't focus on it.
Not supported on Wayland (Linux).
#### `win.hide()`
Hides the window.
@@ -824,6 +839,8 @@ Closes the currently open [Quick Look][quick-look] panel.
Resizes and moves the window to the supplied bounds. Any properties that are not supplied will default to their current values.
On Wayland (Linux), has the same limitations as `setSize` and `setPosition`.
```js
const { BrowserWindow } = require('electron')
@@ -849,6 +866,9 @@ Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window as `
> [!NOTE]
> On macOS, the y-coordinate value returned will be at minimum the [Tray](tray.md) height. For example, calling `win.setBounds({ x: 25, y: 20, width: 800, height: 600 })` with a tray height of 38 means that `win.getBounds()` will return `{ x: 25, y: 38, width: 800, height: 600 }`.
> [!NOTE]
> On Wayland, this method will return `{ x: 0, y: 0, ... }` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.getBackgroundColor()`
Returns `string` - Gets the background color of the window in Hex (`#RRGGBB`) format.
@@ -866,6 +886,8 @@ See [Setting `backgroundColor`](#setting-the-backgroundcolor-property).
Resizes and moves the window's client area (e.g. the web page) to
the supplied bounds.
On Wayland (Linux), has the same limitations as `setContentSize` and `setPosition`.
#### `win.getContentBounds()`
Returns [`Rectangle`](structures/rectangle.md) - The `bounds` of the window's client area as `Object`.
@@ -895,6 +917,8 @@ Returns `boolean` - whether the window is enabled.
Resizes the window to `width` and `height`. If `width` or `height` are below any set minimum size constraints the window will snap to its minimum size.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getSize()`
Returns `Integer[]` - Contains the window's width and height.
@@ -907,6 +931,8 @@ Returns `Integer[]` - Contains the window's width and height.
Resizes the window's client area (e.g. the web page) to `width` and `height`.
On Wayland (Linux), may not work as some window managers restrict programmatic window resizing.
#### `win.getContentSize()`
Returns `Integer[]` - Contains the window's client area's width and height.
@@ -1044,12 +1070,16 @@ this method throws an error.
#### `win.moveTop()`
Moves window to top(z-order) regardless of focus
Moves window to top(z-order) regardless of focus.
Not supported on Wayland (Linux).
#### `win.center()`
Moves window to the center of the screen.
Not supported on Wayland (Linux).
#### `win.setPosition(x, y[, animate])`
* `x` Integer
@@ -1058,10 +1088,15 @@ Moves window to the center of the screen.
Moves window to `x` and `y`.
Not supported on Wayland (Linux).
#### `win.getPosition()`
Returns `Integer[]` - Contains the window's current position.
> [!NOTE]
> On Wayland, this method will return `[0, 0]` as introspecting or programmatically changing the global window coordinates is prohibited.
#### `win.setTitle(title)`
* `title` string
@@ -1134,7 +1169,7 @@ under this mode apps can choose to optimize their UI for tablets, such as
enlarging the titlebar and hiding titlebar buttons.
This API returns whether the window is in tablet mode, and the `resize` event
can be be used to listen to changes to tablet mode.
can be used to listen to changes to tablet mode.
#### `win.getMediaSourceId()`
@@ -1227,7 +1262,8 @@ Captures a snapshot of the page within `rect`. Omitting `rect` will capture the
Returns `Promise<void>` - the promise will resolve when the page has finished loading
(see [`did-finish-load`](web-contents.md#event-did-finish-load)), and rejects
if the page fails to load (see [`did-fail-load`](web-contents.md#event-did-fail-load)).
if the page fails to load (see
[`did-fail-load`](web-contents.md#event-did-fail-load)). A noop rejection handler is already attached, which avoids unhandled rejection errors. If the existing page has a beforeUnload handler, [`did-fail-load`](web-contents.md#event-did-fail-load) will be called unless [`will-prevent-unload`](web-contents.md#event-did-fail-load) is handled.
Same as [`webContents.loadURL(url[, options])`](web-contents.md#contentsloadurlurl-options).
@@ -1442,15 +1478,16 @@ Sets the properties for the window's taskbar button.
#### `win.setAccentColor(accentColor)` _Windows_
* `accentColor` boolean | string - The accent color for the window. By default, follows user preference in System Settings.
* `accentColor` boolean | string | null - The accent color for the window. By default, follows user preference in System Settings. To reset to system default, pass `null`.
Sets the system accent color and highlighting of active window border.
The `accentColor` parameter accepts the following values:
* **Color string** - Sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Uses the system's default accent color from user preferences in System Settings.
* **`false`** - Explicitly disables accent color highlighting for the window.
* **Color string** - Like `true`, but sets a custom accent color using standard CSS color formats (Hex, RGB, RGBA, HSL, HSLA, or named colors). Alpha values in RGBA/HSLA formats are ignored and the color is treated as fully opaque.
* **`true`** - Enable accent color highlighting for the window with the system accent color regardless of whether accent colors are enabled for windows in System `Settings.`
* **`false`** - Disable accent color highlighting for the window regardless of whether accent colors are currently enabled for windows in System Settings.
* **`null`** - Reset window accent color behavior to follow behavior set in System Settings.
Examples:
@@ -1463,11 +1500,14 @@ win.setAccentColor('#ff0000')
// RGB format (alpha ignored if present).
win.setAccentColor('rgba(255,0,0,0.5)')
// Use system accent color.
// Enable accent color, using the color specified in System Settings.
win.setAccentColor(true)
// Disable accent color.
win.setAccentColor(false)
// Reset window accent color behavior to follow behavior set in System Settings.
win.setAccentColor(null)
```
#### `win.getAccentColor()` _Windows_

View File

@@ -25,6 +25,11 @@ following properties:
with which the request is associated. Defaults to the empty string. The
`session` option supersedes `partition`. Thus if a `session` is explicitly
specified, `partition` is ignored.
* `bypassCustomProtocolHandlers` boolean (optional) - When set to `true`,
custom protocol handlers registered for the request's URL scheme will not be
called. This allows forwarding an intercepted request to the built-in
handler. [webRequest](web-request.md) handlers will still be triggered
when bypassing custom protocols. Defaults to `false`.
* `credentials` string (optional) - Can be `include`, `omit` or
`same-origin`. Whether to send
[credentials](https://fetch.spec.whatwg.org/#credentials) with this
@@ -259,7 +264,7 @@ will not be allowed. The `finish` event is emitted just after the end operation.
Cancels an ongoing HTTP transaction. If the request has already emitted the
`close` event, the abort operation will have no effect. Otherwise an ongoing
event will emit `abort` and `close` events. Additionally, if there is an ongoing
response object,it will emit the `aborted` event.
response object, it will emit the `aborted` event.
#### `request.followRedirect()`

View File

@@ -2,10 +2,13 @@
> Perform copy and paste operations on the system clipboard.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) (non-sandboxed only)
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process) _Deprecated_ (non-sandboxed only)
> [!NOTE]
> Using the `clipboard` API from the renderer process is deprecated.
> [!IMPORTANT]
> If you want to call this API from a renderer process with context isolation enabled,
> If you want to call this API from a renderer process,
> place the API call in your preload script and
> [expose](../tutorial/context-isolation.md#after-context-isolation-enabled) it using the
> [`contextBridge`](context-bridge.md) API.

View File

@@ -49,6 +49,10 @@ Disables the disk cache for HTTP requests.
Disable HTTP/2 and SPDY/3.1 protocols.
### --disable-geolocation _macOS_
Disables the Geolocation API. Permission requests for geolocation will be denied internally regardless of the decision made by a handler set via `session.setPermissionRequestHandler`. This functionality is currently implemented only for macOS. Has no effect on other platforms.
### --disable-renderer-backgrounding
Prevents Chromium from lowering the priority of invisible pages' renderer
@@ -168,7 +172,7 @@ Enables net log events to be saved and writes them to `path`.
Sets the verbosity of logging when used together with `--enable-logging`.
`N` should be one of [Chrome's LogSeverities][severities].
Note that two complimentary logging mechanisms in Chromium -- `LOG()`
Note that two complementary logging mechanisms in Chromium -- `LOG()`
and `VLOG()` -- are controlled by different switches. `--log-level`
controls `LOG()` messages, while `--v` and `--vmodule` control `VLOG()`
messages. So you may want to use a combination of these three switches
@@ -313,7 +317,7 @@ By default inspector websocket url is available in stderr and under /json/list e
### `--experimental-network-inspection`
Enable support for devtools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
Enable support for DevTools network inspector events, for visibility into requests made by the nodejs `http` and `https` modules.
### `--no-deprecation`
@@ -350,6 +354,11 @@ Affects the default output directory of [v8.setHeapSnapshotNearHeapLimit](https:
Disable exposition of [Navigator API][] on the global scope from Node.js.
### `--experimental-transform-types`
Enables the [transformation](https://nodejs.org/api/typescript.html#type-stripping)
of TypeScript-only syntax into JavaScript code.
## Chromium Flags
There isn't a documented list of all Chromium switches, but there are a few ways to find them.
@@ -366,6 +375,13 @@ Keep in mind that standalone switches can sometimes be split into individual fea
Finally, you'll need to ensure that the version of Chromium in Electron matches the version of the browser you're using to cross-reference the switches.
### Chromium features relevant to Electron apps
* `AlwaysLogLOAFURL`: enables script attribution for
[`long-animation-frame`](https://developer.mozilla.org/en-US/docs/Web/API/Performance_API/Long_animation_frame_timing)
`PerformanceObserver` events for non-http(s), non-data, non-blob URLs (such as `file:` or custom
protocol URLs).
[app]: app.md
[append-switch]: command-line.md#commandlineappendswitchswitch-value
[debugging-main-process]: ../tutorial/debugging-main-process.md

View File

@@ -51,7 +51,12 @@ Returns:
* `event` Event
* `cookie` [Cookie](structures/cookie.md) - The cookie that was changed.
* `cause` string - The cause of the change with one of the following values:
* `explicit` - The cookie was changed directly by a consumer's action.
* `inserted` - The cookie was inserted.
* `inserted-no-change-overwrite` - The newly inserted cookie overwrote a cookie but
did not result in any change. For example, inserting an identical cookie will produce this cause.
* `inserted-no-value-change-overwrite` - The newly inserted cookie overwrote a cookie but
did not result in any value change, but it's web observable (e.g. updates the expiry).
* `explicit` - The cookie was deleted directly by a consumer's action.
* `overwrite` - The cookie was automatically removed due to an insert
operation that overwrote it.
* `expired` - The cookie was automatically removed as it expired.
@@ -102,7 +107,7 @@ the response.
cookie and will not be retained between sessions.
* `sameSite` string (optional) - The [Same Site](https://developer.mozilla.org/en-US/docs/Web/HTTP/Cookies#SameSite_cookies) policy to apply to this cookie. Can be `unspecified`, `no_restriction`, `lax` or `strict`. Default is `lax`.
Returns `Promise<void>` - A promise which resolves when the cookie has been set
Returns `Promise<void>` - A promise which resolves when the cookie has been set.
Sets a cookie with `details`.
@@ -111,16 +116,16 @@ Sets a cookie with `details`.
* `url` string - The URL associated with the cookie.
* `name` string - The name of cookie to remove.
Returns `Promise<void>` - A promise which resolves when the cookie has been removed
Returns `Promise<void>` - A promise which resolves when the cookie has been removed.
Removes the cookies matching `url` and `name`
Removes the cookies matching `url` and `name`.
#### `cookies.flushStore()`
Returns `Promise<void>` - A promise which resolves when the cookie store has been flushed
Returns `Promise<void>` - A promise which resolves when the cookie store has been flushed.
Writes any unwritten cookies data to disk
Writes any unwritten cookies data to disk.
Cookies written by any method will not be written to disk immediately, but will be written every 30 seconds or 512 operations
Cookies written by any method will not be written to disk immediately, but will be written every 30 seconds or 512 operations.
Calling this method can cause the cookie to be written to disk immediately.

View File

@@ -49,7 +49,7 @@ Use the `system-ui` keyword to match the smoothness to the OS design language.
| Value: | `60%` | `0%` |
| Example: | ![A rectangle with round corners whose smoothness matches macOS](../images/corner-smoothing-example-60.svg) | ![A rectangle with round corners whose smoothness matches Windows and Linux](../images/corner-smoothing-example-0.svg) |
### Controlling availibility
### Controlling availability
This CSS rule can be disabled using the Blink feature flag `ElectronCSSCornerSmoothing`.

View File

@@ -44,7 +44,7 @@ Returns:
* `reason` string - Reason for detaching debugger.
Emitted when the debugging session is terminated. This happens either when
`webContents` is closed or devtools is invoked for the attached `webContents`.
`webContents` is closed or DevTools is invoked for the attached `webContents`.
#### Event: 'message'

View File

@@ -94,14 +94,45 @@ The `desktopCapturer` module has the following methods:
Returns `Promise<DesktopCapturerSource[]>` - Resolves with an array of [`DesktopCapturerSource`](structures/desktop-capturer-source.md) objects, each `DesktopCapturerSource` represents a screen or an individual window that can be captured.
> [!NOTE]
> Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher,
> which can detected by [`systemPreferences.getMediaAccessStatus`][].
> * Capturing audio requires `NSAudioCaptureUsageDescription` Info.plist key on macOS 14.2 Sonoma and higher - [read more](#macos-versions-142-or-higher).
> * Capturing the screen contents requires user consent on macOS 10.15 Catalina or higher, which can detected by [`systemPreferences.getMediaAccessStatus`][].
[`navigator.mediaDevices.getUserMedia`]: https://developer.mozilla.org/en/docs/Web/API/MediaDevices/getUserMedia
[`systemPreferences.getMediaAccessStatus`]: system-preferences.md#systempreferencesgetmediaaccessstatusmediatype-windows-macos
## Caveats
`navigator.mediaDevices.getUserMedia` does not work on macOS for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this.
### Linux
It is possible to circumvent this limitation by capturing system audio with another macOS app like Soundflower and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.
`desktopCapturer.getSources(options)` only returns a single source on Linux when using Pipewire.
PipeWire supports a single capture for both screens and windows. If you request the window and screen type, the selected source will be returned as a window capture.
---
### MacOS versions 14.2 or higher
`NSAudioCaptureUsageDescription` Info.plist key must be added in-order for audio to be captured by `desktopCapturer`. If instead you are running electron from another program like a terminal or IDE then that parent program must contain the Info.plist key.
This is in order to facillitate use of Apple's new [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps#Configure-the-sample-code-project) by Chromium.
> [!WARNING]
> Failure of `desktopCapturer` to start an audio stream due to `NSAudioCaptureUsageDescription` permission not present will still create a dead audio stream however no warnings or errors are displayed.
As of electron `v39.0.0-beta.4` Chromium [made Apple's new `CoreAudio Tap API` the default](https://source.chromium.org/chromium/chromium/src/+/ad17e8f8b93d5f34891b06085d373a668918255e) for desktop audio capture. There is no fallback to the older `Screen & System Audio Recording` permissions system even if [CoreAudio Tap API](https://developer.apple.com/documentation/CoreAudio/capturing-system-audio-with-core-audio-taps) stream creation fails.
If you need to continue using `Screen & System Audio Recording` permissions for `desktopCapturer` on macOS versions 14.2 and later, you can apply a chromium feature flag to force use of that older permissions system:
```js
// main.js (right beneath your require/import statments)
app.commandLine.appendSwitch('disable-features', 'MacCatapLoopbackAudioForScreenShare')
```
---
### MacOS versions 12.7.6 or lower
`navigator.mediaDevices.getUserMedia` does not work on macOS versions 12.7.6 and prior for audio capture due to a fundamental limitation whereby apps that want to access the system's audio require a [signed kernel extension](https://developer.apple.com/library/archive/documentation/Security/Conceptual/System_Integrity_Protection_Guide/KernelExtensions/KernelExtensions.html). Chromium, and by extension Electron, does not provide this. Only in macOS 13 and onwards does Apple provide APIs to capture desktop audio without the need for a signed kernel extension.
It is possible to circumvent this limitation by capturing system audio with another macOS app like [BlackHole](https://existential.audio/blackhole/) or [Soundflower](https://rogueamoeba.com/freebies/soundflower/) and passing it through a virtual audio input device. This virtual device can then be queried with `navigator.mediaDevices.getUserMedia`.

View File

@@ -344,7 +344,7 @@ Displays a modal dialog that shows an error message.
This API can be called safely before the `ready` event the `app` module emits,
it is usually used to report errors in early stage of startup. If called
before the app `ready`event on Linux, the message will be emitted to stderr,
before the app `ready` event on Linux, the message will be emitted to stderr,
and no GUI dialog will appear.
### `dialog.showCertificateTrustDialog([window, ]options)` _macOS_ _Windows_

View File

@@ -159,6 +159,22 @@ Notification activated (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76
Notification replied to (com.github.Electron:notification:EAF7B87C-A113-43D7-8E76-F88EC9D73D44)
```
### `ELECTRON_DEBUG_MSIX_UPDATER`
Adds extra logs to MSIX updater operations on Windows to aid in debugging. Extra logging will be displayed when MSIX update operations are initiated, including package updates, package registration, and restart registration. This helps diagnose issues with MSIX package updates and deployments.
Sample output:
```sh
UpdateMsix called with URI: https://example.com/app.msix
DoUpdateMsix: Starting
Calling AddPackageByUriAsync... URI: https://example.com/app.msix
Update options - deferRegistration: true, developerMode: false, forceShutdown: false, forceTargetShutdown: false, forceUpdateFromAnyVersion: false
Waiting for deployment...
Deployment finished.
MSIX Deployment completed.
```
### `ELECTRON_LOG_ASAR_READS`
When Electron reads from an ASAR file, log the read offset and file path to
@@ -187,13 +203,13 @@ the one downloaded by `npm install`. Usage:
export ELECTRON_OVERRIDE_DIST_PATH=/Users/username/projects/electron/out/Testing
```
## Set By Electron
### `ELECTRON_SKIP_BINARY_DOWNLOAD`
Electron sets some variables in your environment at runtime.
If you want to install your project's dependencies but don't need to use Electron functionality,
you can set the `ELECTRON_SKIP_BINARY_DOWNLOAD` environment variable to prevent the binary from being
downloaded. For instance, this feature can be useful in continuous integration environments when
running unit tests that mock out the `electron` module.
### `ORIGINAL_XDG_CURRENT_DESKTOP`
This variable is set to the value of `XDG_CURRENT_DESKTOP` that your application
originally launched with. Electron sometimes modifies the value of `XDG_CURRENT_DESKTOP`
to affect other logic within Chromium so if you want access to the _original_ value
you should look up this environment variable instead.
```sh
ELECTRON_SKIP_BINARY_DOWNLOAD=1 npm install
```

View File

@@ -57,7 +57,7 @@ The following methods are available on instances of `Extensions`:
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -83,7 +83,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.extensions.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -34,7 +34,7 @@ Returns:
* `error` Error - Typically holds an error string identifying failure root cause.
Emitted when an error was encountered while streaming response data events. For
instance, if the server closes the underlying while the response is still
instance, if the server closes the underlying connection while the response is still
streaming, an `error` event will be emitted on the response object and a `close`
event will subsequently follow on the request object.

View File

@@ -17,7 +17,7 @@ See [`Menu`](menu.md) for examples.
* `options` Object
* `click` Function (optional) - Will be called with
`click(menuItem, window, event)` when the menu item is clicked.
* `menuItem` MenuItem
* `menuItem` [MenuItem](menu-item.md)
* `window` [BaseWindow](base-window.md) | undefined - This will not be defined if no window is open.
* `event` [KeyboardEvent](structures/keyboard-event.md)
* `role` string (optional) - Can be `undo`, `redo`, `cut`, `copy`, `paste`, `pasteAndMatchStyle`, `delete`, `selectAll`, `reload`, `forceReload`, `toggleDevTools`, `resetZoom`, `zoomIn`, `zoomOut`, `toggleSpellChecker`, `togglefullscreen`, `window`, `minimize`, `close`, `help`, `about`, `services`, `hide`, `hideOthers`, `unhide`, `quit`, `showSubstitutions`, `toggleSmartQuotes`, `toggleSmartDashes`, `toggleTextReplacement`, `startSpeaking`, `stopSpeaking`, `zoom`, `front`, `appMenu`, `fileMenu`, `editMenu`, `viewMenu`, `shareMenu`, `recentDocuments`, `toggleTabBar`, `selectNextTab`, `selectPreviousTab`, `showAllTabs`, `mergeAllWindows`, `clearRecentDocuments`, `moveTabToNewWindow` or `windowMenu` - Define the action of the menu item, when specified the
@@ -34,7 +34,8 @@ See [`Menu`](menu.md) for examples.
* `sublabel` string (optional) _macOS_ - Available in macOS >= 14.4
* `toolTip` string (optional) _macOS_ - Hover text for this menu item.
* `accelerator` string (optional) - An [Accelerator](../tutorial/keyboard-shortcuts.md#accelerators) string.
* `icon` ([NativeImage](native-image.md) | string) (optional)
* `icon` ([NativeImage](native-image.md) | string) (optional) - Can be a
[NativeImage](native-image.md) or the file path of an icon.
* `enabled` boolean (optional) - If false, the menu item will be greyed out and
unclickable.
* `acceleratorWorksWhenHidden` boolean (optional) _macOS_ - default is `true`, and when `false` will prevent the accelerator from triggering the item if the item is not visible.
@@ -90,7 +91,7 @@ It can be called with `menuItem.click(event, focusedWindow, focusedWebContents)`
#### `menuItem.submenu`
A `Menu` (optional) containing the menu
A [`Menu`](menu.md) (optional) containing the menu
item's submenu, if present.
#### `menuItem.type`
@@ -106,7 +107,7 @@ A `string` (optional) indicating the item's role, if set. Can be `undo`, `redo`,
#### `menuItem.accelerator`
An `Accelerator` (optional) indicating the item's accelerator, if set.
An `Accelerator | null` indicating the item's accelerator, if set.
#### `menuItem.userAccelerator` _Readonly_ _macOS_
@@ -170,4 +171,4 @@ A `number` indicating an item's sequential unique id.
#### `menuItem.menu`
A `Menu` that the item is a part of.
A [`Menu`](menu.md) that the item is a part of.

View File

@@ -2,10 +2,15 @@
## Class: Menu
> Create native application menus and context menus.
> Create application menus and context menus.
Process: [Main](../glossary.md#main-process)
The presentation of menus varies depending on the operating system:
- Under Windows and Linux, menus are visually similar to Chromium.
- Under macOS, these will be native menus.
> [!TIP]
> See also: [A detailed guide about how to implement menus in your application](../tutorial/menus.md).
@@ -23,7 +28,7 @@ The `Menu` class has the following static methods:
#### `Menu.setApplicationMenu(menu)`
- `menu` Menu | null
- `menu` [Menu](menu.md) | null
Sets `menu` as the application menu on macOS. On Windows and Linux, the
`menu` will be set as each window's top menu.
@@ -34,7 +39,7 @@ indicate which letter should get a generated accelerator. For example, using
opens the associated menu. The indicated character in the button label then gets an
underline, and the `&` character is not displayed on the button label.
In order to escape the `&` character in an item name, add a proceeding `&`. For example, `&&File` would result in `&File` displayed on the button label.
In order to escape the `&` character in an item name, add a preceding `&`. For example, `&&File` would result in `&File` displayed on the button label.
Passing `null` will suppress the default menu. On Windows and Linux,
this has the additional effect of removing the menu bar from the window.
@@ -65,9 +70,9 @@ for more information on macOS' native actions.
#### `Menu.buildFromTemplate(template)`
- `template` (MenuItemConstructorOptions | MenuItem)[]
- `template` (MenuItemConstructorOptions | [MenuItem](menu-item.md))[]
Returns `Menu`
Returns [`Menu`](menu.md)
Generally, the `template` is an array of `options` for constructing a
[MenuItem](menu-item.md). The usage can be referenced above.
@@ -118,7 +123,7 @@ Appends the `menuItem` to the menu.
- `id` string
Returns `MenuItem | null` the item with the specified `id`
Returns [`MenuItem | null`](menu-item.md) - the item with the specified `id`
#### `menu.insert(pos, menuItem)`

View File

@@ -202,8 +202,7 @@ Creates a new `NativeImage` instance from `dataUrl`, a base 64 encoded [Data URL
Returns `NativeImage`
Creates a new `NativeImage` instance from the `NSImage` that maps to the
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388)
documentation for a list of possible values.
given image name. See Apple's [`NSImageName`](https://developer.apple.com/documentation/appkit/nsimagename#2901388) documentation and [SF Symbols](https://developer.apple.com/sf-symbols/) for a list of possible values.
The `hslShift` is applied to the image with the following rules:
@@ -231,6 +230,15 @@ echo -e '#import <Cocoa/Cocoa.h>\nint main() { NSLog(@"%@", SYSTEM_IMAGE_NAME);
where `SYSTEM_IMAGE_NAME` should be replaced with any value from [this list](https://developer.apple.com/documentation/appkit/nsimagename?language=objc).
For SF Symbols, usage looks as follows:
```js
const image = nativeImage.createFromNamedImage('square.and.pencil')
```
where `'square.and.pencil'` is the symbol name from the
[SF Symbols app](https://developer.apple.com/sf-symbols/).
## Class: NativeImage
> Natively wrap images such as tray, dock, and application icons.

View File

@@ -36,7 +36,7 @@ everything will be reset to the OS default. By default `themeSource` is `system
Settings this property to `dark` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `true` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the dark UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the dark UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the dark UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `dark` mode.
* The `updated` event will be emitted
@@ -44,7 +44,7 @@ Settings this property to `dark` will have the following effects:
Settings this property to `light` will have the following effects:
* `nativeTheme.shouldUseDarkColors` will be `false` when accessed
* Any UI Electron renders on Linux and Windows including context menus, devtools, etc. will use the light UI.
* Any UI Electron renders on Linux and Windows including context menus, DevTools, etc. will use the light UI.
* Any UI the OS renders on macOS including menus, window frames, etc. will use the light UI.
* The [`prefers-color-scheme`](https://developer.mozilla.org/en-US/docs/Web/CSS/@media/prefers-color-scheme) CSS query will match `light` mode.
* The `updated` event will be emitted
@@ -83,4 +83,4 @@ Currently, Windows high contrast is the only system setting that triggers forced
### `nativeTheme.prefersReducedTransparency` _Readonly_
A `boolean` that indicates the whether the user has chosen via system accessibility settings to reduce transparency at the OS level.
A `boolean` that indicates whether the user has chosen via system accessibility settings to reduce transparency at the OS level.

View File

@@ -67,6 +67,22 @@ Emitted when the notification is shown to the user. Note that this event can be
multiple times as a notification can be shown multiple times through the
`show()` method.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('show', () => console.log('Notification shown!'))
n.show()
})
```
#### Event: 'click'
Returns:
@@ -75,6 +91,22 @@ Returns:
Emitted when the notification is clicked by the user.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('click', () => console.log('Notification clicked!'))
n.show()
})
```
#### Event: 'close'
Returns:
@@ -88,21 +120,85 @@ is closed.
On Windows, the `close` event can be emitted in one of three ways: programmatic dismissal with `notification.close()`, by the user closing the notification, or via system timeout. If a notification is in the Action Center after the initial `close` event is emitted, a call to `notification.close()` will remove the notification from the action center but the `close` event will not be emitted again.
#### Event: 'reply' _macOS_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.on('close', () => console.log('Notification closed!'))
n.show()
})
```
#### Event: 'reply' _macOS_ _Windows_
Returns:
* `event` Event
* `reply` string - The string the user entered into the inline reply field.
* `details` Event\<\>
* `reply` string - The string the user entered into the inline reply field.
* `reply` string _Deprecated_
Emitted when the user clicks the "Reply" button on a notification with `hasReply: true`.
#### Event: 'action' _macOS_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Send a Message',
body: 'Body Text',
hasReply: true,
replyPlaceholder: 'Message text...'
})
n.on('reply', (e, reply) => console.log(`User replied: ${reply}`))
n.on('click', () => console.log('Notification clicked'))
n.show()
})
```
#### Event: 'action' _macOS_ _Windows_
Returns:
* `event` Event
* `index` number - The index of the action that was activated.
* `details` Event\<\>
* `actionIndex` number - The index of the action that was activated.
* `selectionIndex` number _Windows_ - The index of the selected item, if one was chosen. -1 if none was chosen.
* `actionIndex` number _Deprecated_
* `selectionIndex` number _Windows_ _Deprecated_
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const items = ['One', 'Two', 'Three']
const n = new Notification({
title: 'Choose an Action!',
actions: [
{ type: 'button', text: 'Action 1' },
{ type: 'button', text: 'Action 2' },
{ type: 'selection', text: 'Apply', items }
]
})
n.on('click', () => console.log('Notification clicked'))
n.on('action', (e) => {
console.log(`User triggered action at index: ${e.actionIndex}`)
if (e.selectionIndex > -1) {
console.log(`User chose selection item '${items[e.selectionIndex]}'`)
}
})
n.show()
})
```
#### Event: 'failed' _Windows_
@@ -113,6 +209,22 @@ Returns:
Emitted when an error is encountered while creating and showing the native notification.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Bad Action'
})
n.on('failed', (e, err) => {
console.log('Notification failed: ', err)
})
n.show()
})
```
### Instance Methods
Objects created with the `new Notification()` constructor have the following instance methods:
@@ -126,12 +238,42 @@ call this method before the OS will display it.
If the notification has been shown before, this method will dismiss the previously
shown notification and create a new one with identical properties.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.show()
})
```
#### `notification.close()`
Dismisses the notification.
On Windows, calling `notification.close()` while the notification is visible on screen will dismiss the notification and remove it from the Action Center. If `notification.close()` is called after the notification is no longer visible on screen, calling `notification.close()` will try remove it from the Action Center.
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const n = new Notification({
title: 'Title!',
subtitle: 'Subtitle!',
body: 'Body!'
})
n.show()
setTimeout(() => n.close(), 5000)
})
```
### Instance Properties
#### `notification.title`

View File

@@ -71,7 +71,7 @@ will disable the support for `asar` archives in Node's built-in modules.
### `process.noDeprecation`
A `boolean` that controls whether or not deprecation warnings are printed to `stderr`.
A `boolean` (optional) that controls whether or not deprecation warnings are printed to `stderr`.
Setting this to `true` will silence deprecation warnings. This property is used
instead of the `--no-deprecation` command line flag.
@@ -99,13 +99,13 @@ property is used instead of the `--throw-deprecation` command line flag.
A `boolean` that controls whether or not deprecations printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for deprecations.
This property is instead of the `--trace-deprecation` command line flag.
This property is used instead of the `--trace-deprecation` command line flag.
### `process.traceProcessWarnings`
A `boolean` that controls whether or not process warnings printed to `stderr` include
their stack trace. Setting this to `true` will print stack traces for process warnings
(including deprecations). This property is instead of the `--trace-warnings` command
(including deprecations). This property is used instead of the `--trace-warnings` command
line flag.
### `process.type` _Readonly_
@@ -128,8 +128,8 @@ A `string` representing Electron's version string.
### `process.windowsStore` _Readonly_
A `boolean`. If the app is running as a Windows Store app (appx), this property is `true`,
for otherwise it is `undefined`.
A `boolean`. If the app is running as an MSIX package (including AppX for Windows Store),
this property is `true`, otherwise it is `undefined`.
### `process.contextId` _Readonly_

View File

@@ -7,21 +7,44 @@ Process: [Main](../glossary.md#main-process)
This module adds extra protection to data being stored on disk by using OS-provided cryptography systems. Current
security semantics for each platform are outlined below.
> [!NOTE]
> We recommend using the asynchronous API (`encryptStringAsync`/`decryptStringAsync`) over the synchronous API.
> The async API is non-blocking, supports key rotation, and handles temporary unavailability gracefully.
> The synchronous API may be deprecated in a future version of Electron.
## Platform-Specific Key Providers
### Synchronous API
* **macOS**: Encryption keys are stored for your app in [Keychain Access](https://support.apple.com/en-ca/guide/keychain-access/kyca1083/mac) in a way that prevents
other applications from loading them without user override. Therefore, content is protected from other users and other apps running in the same userspace.
* **Windows**: Encryption keys are generated via [DPAPI](https://learn.microsoft.com/en-us/windows/win32/api/dpapi/nf-dpapi-cryptprotectdata).
As per the Windows documentation: "Typically, only a user with the same logon credential as the user who encrypted the data can typically
decrypt the data". Therefore, content is protected from other users on the same machine, but not from other apps running in the
* **Windows**: Encryption keys are generated via [DPAPI](https://learn.microsoft.com/en-us/windows/win32/api/dpapi/nf-dpapi-cryptprotectdata). As per the Windows documentation: "Typically, only a user with the same logon credential as the user who encrypted the data can typically decrypt the data". Therefore, content is protected from other users on the same machine, but not from other apps running in the
same userspace.
* **Linux**: Encryption keys are generated and stored in a secret store that varies depending on your window manager and system setup. Options currently supported are `kwallet`, `kwallet5`, `kwallet6` and `gnome-libsecret`, but more may be available in future versions of Electron. As such, the
security semantics of content protected via the `safeStorage` API vary between window managers and secret stores.
* Note that not all Linux setups have an available secret store. If no secret store is available, items stored in using the `safeStorage` API will be unprotected
as they are encrypted via hardcoded plaintext password. You can detect when this happens when `safeStorage.getSelectedStorageBackend()` returns `basic_text`.
* Note that not all Linux setups have an available secret store. If no secret store is available, items stored in using the `safeStorage` API will be unprotected as they are encrypted via hardcoded plaintext password. You can detect when this happens when `safeStorage.getSelectedStorageBackend()` returns `basic_text`.
Note that on Mac, access to the system Keychain is required and
Note that on macOS, access to the system Keychain is required and
these calls can block the current thread to collect user input.
The same is true for Linux, if a password management tool is available.
### Asynchronous API
The asynchronous API uses pluggable key providers that vary by platform:
* **macOS**: Encryption keys are stored and retrieved from [Keychain Access](https://developer.apple.com/documentation/security/keychain-items). This provides the same security model as the synchronous API, protecting content from other users and other apps running in the same userspace.
* **Windows**: Encryption keys are protected via [DPAPI](https://learn.microsoft.com/en-us/windows/win32/api/dpapi). This provides the same security model as the synchronous API, protecting content from other users on the same machine but not from other apps running in the same userspace.
* **Linux**: Multiple key providers may be available depending on the desktop environment:
* [`org.freedesktop.portal.Secret`](https://flatpak.github.io/xdg-desktop-portal/docs/doc-org.freedesktop.portal.Secret.html): Uses the Portal Secret D-Bus interface to retrieve application-specific secrets. This is the preferred provider for sandboxed environments like Flatpak.
* [Secret Service API](https://specifications.freedesktop.org/secret-service/latest/): Uses the freedesktop.org Secret Service API (e.g., GNOME Keyring) for key storage.
* A fallback provider is used for environments without a secret service available.
Unlike the synchronous API, these operations are non-blocking and support additional features like key rotation (indicated by `shouldReEncrypt`) and temporary unavailability handling (indicated by `isTemporarilyUnavailable`).
## Events
The `safeStorage` module emits the following events:
## Methods
The `safeStorage` module has the following methods:
@@ -34,6 +57,10 @@ On Linux, returns true if the app has emitted the `ready` event and the secret k
On MacOS, returns true if Keychain is available.
On Windows, returns true once the app has emitted the `ready` event.
### `safeStorage.isAsyncEncryptionAvailable()`
Returns `Promise<Boolean>` - Whether encryption is available for asynchronous safeStorage operations.
### `safeStorage.encryptString(plainText)`
* `plainText` string
@@ -49,7 +76,21 @@ This function will throw an error if encryption fails.
Returns `string` - the decrypted string. Decrypts the encrypted buffer
obtained with `safeStorage.encryptString` back into a string.
This function will throw an error if decryption fails.
### `safeStorage.encryptStringAsync(plainText)`
* `plainText` string
Returns `Promise<Buffer>` - An array of bytes representing the encrypted string.
### `safeStorage.decryptStringAsync(encrypted)`
* `encrypted` Buffer
Returns `Promise<Object>` - Resolve with an object containing the following:
* `shouldReEncrypt` boolean - whether data that has just been returned from the decrypt operation should be
re-encrypted, as the key has been rotated or a new key is available that provides a different security level. If `true`, you should call `decryptStringAsync` again to receive the new decrypted string.
* `result` string - the decrypted string.
### `safeStorage.setUsePlainTextEncryption(usePlainText)`

View File

@@ -66,7 +66,7 @@ The `session` module has the following properties:
### `session.defaultSession`
A `Session` object, the default session object of the app.
A `Session` object, the default session object of the app, available after `app.whenReady` is called.
## Class: Session
@@ -1216,7 +1216,7 @@ function createWindow () {
mainWindow.webContents.session.setBluetoothPairingHandler((details, callback) => {
bluetoothPinCallback = callback
// Send a IPC message to the renderer to prompt the user to confirm the pairing.
// Send an IPC message to the renderer to prompt the user to confirm the pairing.
// Note that this will require logic in the renderer to handle this message and
// display a prompt to the user.
mainWindow.webContents.send('bluetooth-pairing-request', details)
@@ -1264,7 +1264,7 @@ session.defaultSession.allowNTLMCredentialsForDomains('*')
Overrides the `userAgent` and `acceptLanguages` for this session.
The `acceptLanguages` must a comma separated ordered list of language codes, for
The `acceptLanguages` must be a comma separated ordered list of language codes, for
example `"en-US,fr,de,ko,zh-CN,ja"`.
This doesn't affect existing `WebContents`, and each `WebContents` can use
@@ -1512,7 +1512,7 @@ will not work on non-persistent (in-memory) sessions.
* `options` Object (optional)
* `allowFileAccess` boolean - Whether to allow the extension to read local files over `file://`
protocol and inject content scripts into `file://` pages. This is required e.g. for loading
devtools extensions on `file://` URLs. Defaults to false.
DevTools extensions on `file://` URLs. Defaults to false.
Returns `Promise<Extension>` - resolves when the extension is loaded.
@@ -1538,7 +1538,7 @@ const path = require('node:path')
app.whenReady().then(async () => {
await session.defaultSession.loadExtension(
path.join(__dirname, 'react-devtools'),
// allowFileAccess is required to load the devtools extension on file:// URLs.
// allowFileAccess is required to load the DevTools extension on file:// URLs.
{ allowFileAccess: true }
)
// Note that in order to use the React DevTools extension, you'll need to

View File

@@ -9,6 +9,13 @@ For including the share menu as a submenu of other menus, please use the
## Class: ShareMenu
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25629
```
-->
> Create share menu on macOS.
Process: [Main](../glossary.md#main-process)

View File

@@ -0,0 +1,58 @@
# sharedTexture
> Import shared textures into Electron and converts platform specific handles into [`VideoFrame`](https://developer.mozilla.org/en-US/docs/Web/API/VideoFrame). Supports all Web rendering systems, and can be transferred across Electron processes. Read [here](../../shell/common/api/shared_texture/README.md) for more information.
Process: [Main](../glossary.md#main-process), [Renderer](../glossary.md#renderer-process)
## Methods
The `sharedTexture` module has the following methods:
**Note:** Experimental APIs are marked as such and could be removed in the future.
### `sharedTexture.importSharedTexture(options)` _Experimental_
* `options` Object - Options for importing shared textures.
* `textureInfo` [SharedTextureImportTextureInfo](structures/shared-texture-import-texture-info.md) - The information of the shared texture to import.
* `allReferencesReleased` Function (optional) - Called when all references in all processes are released. You should keep the imported texture valid until this callback is called.
Imports the shared texture from the given options.
> [!NOTE]
> This method is only available in the main process.
Returns [`SharedTextureImported`](structures/shared-texture-imported.md) - The imported shared texture.
### `sharedTexture.sendSharedTexture(options, ...args)` _Experimental_
* `options` Object - Options for sending shared texture.
* `frame` [WebFrameMain](web-frame-main.md) - The target frame to transfer the shared texture to. For `WebContents`, you can pass `webContents.mainFrame`. If you provide a `webFrameMain` that is not a main frame, you'll need to enable `webPreferences.nodeIntegrationInSubFrames` for this, since this feature requires [IPC](https://www.electronjs.org/docs/latest/api/web-frame-main#frameipc-readonly) between main and the frame.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments to pass to the renderer process.
Send the imported shared texture to a renderer process. You must register a receiver at renderer process before calling this method. This method has a 1000ms timeout. Ensure the receiver is set and the renderer process is alive before calling this method.
> [!NOTE]
> This method is only available in the main process.
Returns `Promise<void>` - Resolves when the transfer is complete.
### `sharedTexture.setSharedTextureReceiver(callback)` _Experimental_
* `callback` Function\<Promise\<void\>\> - The function to receive the imported shared texture.
* `receivedSharedTextureData` Object - The data received from the main process.
* `importedSharedTexture` [SharedTextureImported](structures/shared-texture-imported.md) - The imported shared texture.
* `...args` any[] - Additional arguments passed from the main process.
Set a callback to receive imported shared textures from the main process.
> [!NOTE]
> This method is only available in the renderer process.
## Properties
The `sharedTexture` module has the following properties:
### `sharedTexture.subtle` _Experimental_
A [`SharedTextureSubtle`](structures/shared-texture-subtle.md) property, provides subtle APIs for interacting with shared texture for advanced users.

View File

@@ -29,6 +29,14 @@ Show the given file in a file manager. If possible, select the file.
### `shell.openPath(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/20682
breaking-changes-header: api-changed-shellopenitem-is-now-shellopenpath
```
-->
* `path` string
Returns `Promise<string>` - Resolves with a string containing the error message corresponding to the failure if a failure occurred, otherwise "".
@@ -37,6 +45,18 @@ Open the given file in the desktop's default manner.
### `shell.openExternal(url[, options])`
<!--
```YAML history
changes:
- pr-url: https://github.com/electron/electron/pull/4508
description: "Added `activate` option."
- pr-url: https://github.com/electron/electron/pull/15065
description: "Added `workingDirectory` option."
- pr-url: https://github.com/electron/electron/pull/37139
description: "Added `logUsage` option."
```
-->
* `url` string - Max 2081 characters on Windows.
* `options` Object (optional)
* `activate` boolean (optional) _macOS_ - `true` to bring the opened application to the foreground. The default is `true`.
@@ -50,6 +70,14 @@ Open the given external protocol URL in the desktop's default manner. (For examp
### `shell.trashItem(path)`
<!--
```YAML history
added:
- pr-url: https://github.com/electron/electron/pull/25114
breaking-changes-header: deprecated-shellmoveitemtotrash
```
-->
* `path` string - path to the item to be moved to the trash.
Returns `Promise<void>` - Resolves when the operation has been completed.
@@ -58,6 +86,10 @@ Rejects if there was an error while deleting the requested item.
This moves a path to the OS-specific trash location (Trash on macOS, Recycle
Bin on Windows, and a desktop-environment-specific location on Linux).
The path must use the default path separator for the platform (backslash on
Windows). Use `path.resolve()` from the `node:path` module to ensure correct
handling on all filesystems.
### `shell.beep()`
Play the beep sound.

View File

@@ -72,6 +72,9 @@
some GTK+3 desktop environments. Default is `false`.
* `transparent` boolean (optional) - Makes the window [transparent](../../tutorial/custom-window-styles.md#transparent-windows).
Default is `false`. On Windows, does not work unless the window is frameless.
When you add a [`View`](../view.md) to a `BaseWindow`, you'll need to call
[`view.setBackgroundColor`](../view.md#viewsetbackgroundcolorcolor) with a transparent
background color on that view to make its background transparent as well.
* `type` string (optional) - The type of window, default is normal window. See more about
this below.
* `visualEffectState` string (optional) _macOS_ - Specify how the material
@@ -99,12 +102,13 @@
* `trafficLightPosition` [Point](point.md) (optional) _macOS_ -
Set a custom position for the traffic light buttons in frameless windows.
* `roundedCorners` boolean (optional) _macOS_ _Windows_ - Whether frameless window
should have rounded corners. Default is `true`. Setting this property
to `false` will prevent the window from being fullscreenable on macOS.
On Windows versions older than Windows 11 Build 22000 this property has no effect, and frameless windows will not have rounded corners.
* `thickFrame` boolean (optional) - Use `WS_THICKFRAME` style for frameless windows on
Windows, which adds standard window frame. Setting it to `false` will remove
window shadow and window animations. Default is `true`.
should have rounded corners. Default is `true`. On Windows versions older than
Windows 11 Build 22000 this property has no effect, and frameless windows will
not have rounded corners.
* `thickFrame` boolean (optional) _Windows_ - Use `WS_THICKFRAME` style for
frameless windows on Windows, which adds the standard window frame. Setting it
to `false` will remove window shadow and window animations, and disable window
resizing via dragging the window edges. Default is `true`.
* `vibrancy` string (optional) _macOS_ - Add a type of vibrancy effect to
the window, only on macOS. Can be `appearance-based`, `titlebar`, `selection`,
`menu`, `popover`, `sidebar`, `header`, `sheet`, `window`, `hud`, `fullscreen-ui`,

View File

@@ -7,7 +7,7 @@
* `depthPerComponent` number - The number of bits per color component.
* `detected` boolean - `true` if the display is detected by the system.
* `displayFrequency` number - The display refresh rate.
* `id` number - Unique identifier associated with the display. A value of of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `id` number - Unique identifier associated with the display. A value of -1 means the display is invalid or the correct `id` is not yet known, and a value of -10 means the display is a virtual display assigned to a unified desktop.
* `internal` boolean - `true` for an internal display and `false` for an external display.
* `label` string - User-friendly label, determined by the platform.
* `maximumCursorSize` [Size](size.md) - Maximum cursor size in native pixels.

View File

@@ -1,13 +1,15 @@
# NotificationAction Object
* `type` string - The type of action, can be `button`.
* `type` string - The type of action, can be `button` or `selection`. `selection` is only supported on Windows.
* `text` string (optional) - The label for the given action.
* `items` string[] (optional) _Windows_ - The list of items for the `selection` action `type`.
## Platform / Action Support
| Action Type | Platform Support | Usage of `text` | Default `text` | Limitations |
|-------------|------------------|-----------------|----------------|-------------|
| `button` | macOS | Used as the label for the button | "Show" (or a localized string by system default if first of such `button`, otherwise empty) | Only the first one is used. If multiple are provided, those beyond the first will be listed as additional actions (displayed when mouse active over the action button). Any such action also is incompatible with `hasReply` and will be ignored if `hasReply` is `true`. |
| `button` | macOS, Windows | Used as the label for the button | "Show" on macOS (localized) if first `button`, otherwise empty; Windows uses provided `text` | macOS: Only the first one is used as primary; others shown as additional actions (hover). Incompatible with `hasReply` (beyond first ignored). |
| `selection` | Windows | Used as the label for the submit button for the selection menu | "Select" | Requires an `items` array property specifying option labels. Emits the `action` event with `(index, selectedIndex)` where `selectedIndex` is the chosen option (>= 0). Ignored on platforms that do not support selection actions. |
### Button support on macOS
@@ -15,6 +17,37 @@ In order for extra notification buttons to work on macOS your app must meet the
following criteria.
* App is signed
* App has it's `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
* App has its `NSUserNotificationAlertStyle` set to `alert` in the `Info.plist`.
If either of these requirements are not met the button won't appear.
### Selection support on Windows
To add a selection (combo box) style action, include an action with `type: 'selection'`, a `text` label for the submit button, and an `items` array of strings:
```js
const { Notification, app } = require('electron')
app.whenReady().then(() => {
const items = ['One', 'Two', 'Three']
const n = new Notification({
title: 'Choose an option',
actions: [{
type: 'selection',
text: 'Apply',
items
}]
})
n.on('action', (e) => {
console.log(`User triggered action at index: ${e.actionIndex}`)
if (e.selectionIndex > 0) {
console.log(`User chose selection item '${items[e.selectionIndex]}'`)
}
})
n.show()
})
```
When the user activates the selection action, the notification's `action` event will be emitted with two parameters: `actionIndex` (the action's index in the `actions` array) and `selectedIndex` (the zero-based index of the chosen item, or `-1` if unavailable). On non-Windows platforms selection actions are ignored.

View File

@@ -1,6 +1,6 @@
# SharedTextureHandle Object
* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process.
* `ntHandle` Buffer (optional) _Windows_ - NT HANDLE holds the shared texture. Note that this NT HANDLE is local to current process. Output textures of `rgba`, `bgra`, `rgbaf16` formats don't have a keyed mutex on the texture handle, but `nv12` format texture handles do have a keyed mutex.
* `ioSurface` Buffer (optional) _macOS_ - IOSurfaceRef holds the shared texture. Note that this IOSurface is local to current process (not global).
* `nativePixmap` Object (optional) _Linux_ - Structure contains planes of shared texture.
* `planes` Object[] _Linux_ - Each plane's info of the shared texture.

View File

@@ -0,0 +1,13 @@
# SharedTextureImportTextureInfo Object
* `pixelFormat` string - The pixel format of the texture.
* `bgra` - 32bpp BGRA (byte-order), 1 plane.
* `rgba` - 32bpp RGBA (byte-order), 1 plane.
* `rgbaf16` - Half float RGBA, 1 plane.
* `nv12` - 12bpp with Y plane followed by a 2x2 interleaved UV plane.
* `p010le` - 4:2:0 10-bit YUV (little-endian), Y plane followed by a 2x2 interleaved UV plane.
* `colorSpace` [ColorSpace](color-space.md) (optional) - The color space of the texture.
* `codedSize` [Size](size.md) - The full dimensions of the shared texture.
* `visibleRect` [Rectangle](rectangle.md) (optional) - A subsection of [0, 0, codedSize.width, codedSize.height]. In common cases, it is the full section area.
* `timestamp` number (optional) - A timestamp in microseconds that will be reflected to `VideoFrame`.
* `handle` [SharedTextureHandle](shared-texture-handle.md) - The shared texture handle.

Some files were not shown because too many files have changed in this diff Show More