Compare commits

..

1120 Commits

Author SHA1 Message Date
Keeley Hammond
26437c6202 fix: discover ThinLTO cache path from GN instead of hardcoding
Addresses review feedback from @deepak1556: the hardcoded
`out\Default\thinlto-cache` path goes out of sync if upstream
changes `cache_dir` in Chromium's build/config/compiler/BUILD.gn.

Read the `/lldltocache:` flag from `gn desc` on a linked target
(`//electron:electron_app`) and pre-create whatever path GN
actually configured. Skips the pre-create entirely when ThinLTO
is disabled (non-official builds), which is the correct no-op.
2026-04-23 12:12:31 -07:00
Keeley Hammond
f038413cf9 fix: pre-create thinlto-cache dir on Windows to avoid bindflt race
Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>
2026-04-23 10:16:38 -07:00
Samuel Attard
099c5c0038 build: use 32-core Windows ARC runners for build jobs (#51256)
* build: use 32-core Windows ARC runners for build jobs

* ci: add siso patch to retry ERROR_INVALID_PARAMETER on ninja file open

The existing patch removes the redundant per-chunk re-open in
fileParser.readFile, but the single remaining os.Open per subninja can
still hit the bindflt race under the ~90k-file concurrent open burst on
the 32-core Windows runners. Layer a second patch on top that wraps that
open in a Windows-only 5-attempt retry (5-80ms backoff) so a single
transient failure no longer aborts the whole manifest load.
2026-04-23 02:23:32 -07:00
Charles Kerr
2c46abe361 test: add linux coverage for default protocol client APIs (#51253)
Add Linux-only app tests to check the default protocol handler.
This includes adding reusable XDG mock fixtures.
2026-04-23 10:10:08 +02:00
David Sanders
05e0cd085c build: drop script/run-gn-format.py (#51263) 2026-04-23 09:52:36 +02:00
Asish Kumar
7c56577639 fix: preserve return value in deprecate.removeFunction (#51028)
The wrapper returned by `deprecate.removeFunction` dropped the wrapped
function's return value because it did not `return` from `fn.apply`.
Every other function wrapper in this module (`renameFunction`,
`moveAPI`) forwards the return value, and the generic type signature
`<T extends Function>(fn: T, ...): T` promises that `T`'s return type
is preserved. Callers that relied on the return value of a function
wrapped by `removeFunction` would silently receive `undefined` from
the wrapper.

Mirror the forwarding done by `renameFunction` / `moveAPI` and extend
the existing spec to assert that the wrapper preserves both the return
value and the `this` context of the deprecated function.

Assisted-By: Claude Opus 4.6

Signed-off-by: Asish Kumar <officialasishkumar@gmail.com>
2026-04-23 00:05:30 +00:00
Robo
350de668e2 refactor: api::autoUpdater managed by cppgc (#51241) 2026-04-23 05:38:47 +09:00
Robo
111b6275ee build: track PDL files as inputs in inspector GN build (#51239)
* fix: track PDL files as inputs in inspector GN build

* chore: address review feedback
2026-04-22 13:48:44 +00:00
Charles Kerr
54eb30a642 chore: remove calls to DeprecatedLayoutImmediately (#51183)
* chore: remove calls to DeprecatedLayoutImmediately

Replace the calls to `DeprecatedLayoutImmediately` that have test
coverage.

- The docked DevTools test added last week covers the three calls in IWCV.

- api-web-contents-view-spec covers the calls from NativeWindow{Views,Mac}.

There are a couple of remaining calls that don't have test coverage yet.
I'll get to them in a followup.

* test: handle both sync or microtask layout

* refactor: add a FlushPendingRootLayout() helper
2026-04-22 12:34:07 +02:00
Charles Kerr
71e8a5ca80 build: FTBFS when pdf is disabled (#51223)
fix: FTBFS when pdf is disabled

pdf_features.h has a static_assert that pdf is enabled
2026-04-22 12:33:59 +02:00
Shelley Vohr
c74de25b01 fix: ignore draggable regions in hidden WebContentsView (#51200)
fix: ignore draggable regions in hidden WebContentsView

Hidden child WebContentsViews were still contributing their draggable
regions to the parent window's non-client hit test, so clicks in the
area where a hidden view's draggable element would render still dragged
the window. Early-return HTNOWHERE when the view is not visible.
2026-04-22 12:33:41 +02:00
Samuel Attard
44e4839580 build: update @electron/get to v5 (#51234) 2026-04-21 19:54:24 -07:00
Samuel Attard
fac0a1624b build: use Yarn JsZipImpl for node-modules link to fix arm32 OOM (#51226)
* build: use Yarn JsZipImpl for node-modules link step

Patch the vendored .yarn/releases/yarn-4.12.0.cjs so the node-modules
(and pnpm-loose) linker constructs its read-only ZipOpenFS with
customZipImplementation = JsZipImpl instead of the default WASM
LibZipImpl.

LibZipImpl loads each cache zip fully into the Emscripten WASM heap and
malloc's a WASM buffer per file read. With up to 80 zips held open, the
32-bit arm32v7 test container intermittently fails to allocate the ~9 MB
buffer for typescript/lib/typescript.js. Yarn's cross-FS copyFilePromise
swallows the real error and surfaces it as a generic
"EINVAL: invalid argument, copyfile", which has been failing ~1-in-3
linux-arm test shards at Install Dependencies since 2026-04-13.

JsZipImpl opens zips by fd, reads only the central directory, and pulls
individual entries into plain Node Buffers — no WASM heap involved.
There is no .yarnrc.yml or env knob for this, so the vendored release is
edited directly. .claude/README.md documents the patch and how to
re-apply it on Yarn upgrades.

Refs: yarnpkg/berry#3972, yarnpkg/berry#6722, yarnpkg/berry#6550

* docs: move JsZipImpl patch notes to .yarn/README.md

Relocate the patch rationale next to the vendored release it documents,
reword the intro for its new home, and update the header comment in
yarn-4.12.0.cjs to point at .yarn/README.md.
2026-04-21 17:58:46 -07:00
Robo
23d95ea9f8 refactor: api::cookies managed by cppgc (#51196)
* refactor: api::cookies managed by cppgc

* chore: remove unused header
2026-04-22 05:28:31 +09:00
Shelley Vohr
89050762c6 fix: reset printToPDF queue after a rejection (#51174)
fix: reset printToPDF queue after a rejection

The module-scoped `pendingPromise` in `webContents.printToPDF` was chained
with `.then(onFulfilled)` and never cleared. Once a call rejected (e.g.
an out-of-range `pageRanges` like `"999"`), subsequent calls chained onto
the rejected promise and short-circuited without ever invoking
`_printToPDF` — so every following call re-surfaced the original error.

Replace the shared variable with a per-`WebContents` `WeakMap` queue that
swallows prior rejections before chaining and clears its entry once the
tail drains.
2026-04-21 11:36:02 -07:00
Niklas Wenzel
b8be33814e fix: skip heap profiling tests in CI (#51209) 2026-04-21 18:26:14 +00:00
Mr.Chaofan
76a03e1010 feat: Add WebContents::Clone method (#49959) 2026-04-21 10:37:48 -07:00
Shelley Vohr
2ba6d28c09 fix: preserve transparency across setResizable toggles on Windows (#51175)
After #49428 made `NativeWindowViews::CanResize()` return `resizable_`
for frameless windows (instead of `resizable_ && thick_frame_`),
`HWNDMessageHandler::SizeConstraintsChanged()` started adding
`WS_THICKFRAME` to the window style whenever `CanResize()` reported true.
`WS_THICKFRAME` is incompatible with layered (translucent) windows and
destroys their transparency.

`SetContentSizeConstraints` already guards against this by skipping
`OnSizeConstraintsChanged()` when `!thick_frame_`. `SetResizable` did
not, so toggling resizability on a transparent window (e.g.
`setResizable(false)` then `setResizable(true)`) caused the Chromium
path to add `WS_THICKFRAME` and strip transparency.

Apply the same guard in `SetResizable`. Min/max constraints are still
enforced — Chromium reads them from the widget delegate on every
`WM_GETMINMAXINFO`, independent of `SizeConstraintsChanged()`.
2026-04-21 10:32:29 -07:00
Charles Kerr
5ed6e4bf62 test: add Linux-specific test for app.getApplicationNameForProtocol() (#51197)
* test: add Linux-specific test for getApplicationNameForProtocol()

On Linux, use XDG env vars to inject a mock that we can use
to test app.getApplicationNameForProtocol().

* fixup! test: add Linux-specific test for getApplicationNameForProtocol()

better system mocks
2026-04-21 10:16:14 -07:00
Charles Kerr
4d780c67f9 test: improve browser window layout coverage (#51189)
* test: browser window webContents viewport matches content bounds

* test: browser window webContents same after vibrancy change

* fixup! test: browser window webContents viewport matches content bounds

* refactor: extract-method helper getViewportSize()

* refactor: remove non-spec change

* chore: more accurate naming
2026-04-21 10:06:49 -07:00
Keeley Hammond
313f8955d1 fix: trigger ShipIt Mach service after SMJobSubmit to unblock on-demand-only mode (#51191)
* fix: trigger ShipIt Mach service to unblock on-demand-only mode

When a macOS system update is pending, launchd puts the user domain
into on-demand-only mode, preventing ShipIt from starting. The
MachServices endpoint in the job dictionary was registered but never
connected to (a leftover from the XPC removal in 2013).

Instead of removing MachServices, fire a lightweight XPC connection
to the Mach port after SMJobSubmit. This satisfies launchd's
on-demand trigger, starting ShipIt immediately while preserving
KeepAlive retry behavior.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix: add ResetAtClose to ShipIt MachServices to prevent standing demand

The XPC trigger message sent after SMJobSubmit sits in the Mach port's
kernel queue unread. Without ResetAtClose, this creates standing demand
that causes launchd to respawn ShipIt after a successful exit(0),
defeating KeepAlive.SuccessfulExit = NO.

Set ResetAtClose on the MachServices registration so launchd tears down
and recreates the port when ShipIt exits, flushing the stale trigger.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix: drain Mach port before exit(0) instead of using ResetAtClose

ResetAtClose blocks KeepAlive.SuccessfulExit retries in on-demand-only
mode because it removes demand when the port resets. Instead, have
ShipIt drain its own Mach service port (via bootstrap_check_in +
mach_msg) before each exit(EXIT_SUCCESS). This clears the standing
demand from the trigger message so launchd won't respawn after a
successful exit, while leaving the message in place on failure exits
so KeepAlive retries remain demand-backed.

Tested in on-demand-only mode (pending macOS update):
- exit(0) + drain: 1 run, no respawn ✓
- exit(1) + no drain: continuous respawn every 2s ✓

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch

* chore: harden ShipIt Mach trigger and simplify port drain

Scope the XPC trigger to the unprivileged path and add a send barrier
so the connection cannot be released before the message is on the wire.
Reduce drainMachServicePort to bootstrap_check_in (process exit flushes
the queue), dropping the mach_msg loop whose buffer/dealloc usage was
incorrect, and remove the no-op drain from the posix_spawn'd launch
helper. Patch filename regenerated to match the commit subject.

* fix: restore explicit mach_msg drain in drainMachServicePort

bootstrap_check_in alone does not prevent respawn: launchd tracks
outstanding demand independently of the receive right's lifetime, so the
queued trigger message must be explicitly dequeued with mach_msg before
exit(0). Verified empirically (check-in-only: 5 respawns in 10s; full
drain: 1 run). Keep the correctness fixes from the previous commit
(4K buffer, mach_msg_destroy on each receive, no mach_port_deallocate).

---------

Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-04-21 09:46:18 -07:00
Robo
1ad6173286 fix: add crash diagnostics for ARM64 power notification crash (#51198)
On ARM64 Windows, UnregisterSuspendResumeNotification (user32) forwards
to PowerUnregisterSuspendResumeNotification (powrprof), which treats the
HPOWERNOTIFY handle as a pointer and dereferences it. The user32 API
returns an opaque handle, not a pointer-backed allocation, causing an
access violation at shutdown.

Add crash keys (pm-reg-handle, pm-reg-memstate, pm-unreg-memstate) to
capture
- The handle value
- VirtualQuery memory state at both registration and unregistration

If the handle address is MEM_FREE, it confirms the handle is an opaque
index and powrprof is incorrectly dereferencing it. If MEM_COMMIT, it
would indicate a use-after-free of the underlying allocation.

Refs https://github.com/MicrosoftDocs/sdk-api/blob/docs/sdk-api-src/content/powerbase/nf-powerbase-powerunregistersuspendresumenotification.md
2026-04-21 21:20:51 +09:00
dependabot[bot]
9861250310 build(deps): bump dsanders11/project-actions from 2.0.0 to 2.0.1 (#51195)
Bumps [dsanders11/project-actions](https://github.com/dsanders11/project-actions) from 2.0.0 to 2.0.1.
- [Release notes](https://github.com/dsanders11/project-actions/releases)
- [Commits](https://github.com/dsanders11/project-actions/compare/v2.0.0...4b06452b0128cf601dac14399aa668a8eed2d684)

---
updated-dependencies:
- dependency-name: dsanders11/project-actions
  dependency-version: 2.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-21 09:10:23 +00:00
David Sanders
0396220dce ci: don't upload build stats on Windows if build fails (#51199) 2026-04-21 09:05:25 +00:00
dependabot[bot]
a0c3be5656 build(deps): bump actions/setup-node from 6.3.0 to 6.4.0 (#51193)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.3.0 to 6.4.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](53b83947a5...48b55a011b)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.4.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-21 10:46:09 +02:00
dependabot[bot]
b5c68d13d5 build(deps): bump github/codeql-action from 4.35.1 to 4.35.2 (#51194)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.35.1 to 4.35.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](c10b8064de...95e58e9a2c)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.35.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-21 10:45:59 +02:00
Samuel Attard
f7ba34064e ci: centralize build-image SHA and pre-seed node-gyp headers (#51148)
* ci: centralize build-image SHA and pre-seed node-gyp headers

- Add .github/actions/build-image-sha as the single source of truth for
  the ghcr.io/electron/build (and arch-tagged electron/test) image SHA,
  with an optional override input for workflow_dispatch.
- Refactor build.yml, apply-patches.yml, build-git-cache.yml,
  clean-src-cache.yml, clean-orphaned-cache-uploads.yml, and the three
  publish workflows to resolve the SHA via a small ubuntu-slim setup job
  instead of hardcoding it in each file.
- Bump the image to daad061f (electron/build-images#68, which pre-warms
  the node-gyp header cache in the Linux images).
- Run the build.yml setup job on ubuntu-slim instead of ubuntu-latest.
- In install-dependencies (and the inline yarn installs in
  pipeline-electron-lint and generate-types), link deps with
  --mode=skip-build first, run `node-gyp install` with up to 3 retries
  (5s backoff) to populate the header cache, then run the build phase.
  This avoids the parallel-download race that intermittently fails the
  first native-addon configure with an empty common.gypi on cold
  macOS/Windows runners.

* ci: skip node-gyp header pre-seed on Linux

* ci: invoke node-gyp via its JS entrypoint for Windows compat
2026-04-20 15:44:10 -07:00
David Sanders
61e815c28a ci: run clang-tidy on macOS and Windows (#50771)
* ci: run clang-tidy on macOS and Windows

* ci: copy framework headers for clang-tidy on macOS

* chore: exclude electron_smooth_round_rect.cc in CI

* chore: C-style casts are discouraged; use static_cast [google-readability-casting]

* chore: add extra args on Windows to clear out warnings

* ci: fix for macOS --remote-build none
2026-04-20 13:31:22 -07:00
Asish Kumar
51c0b025d8 docs: remove obsolete websql from clearStorageData storages list (#51097)
WebSQL support was removed in Electron 31 (see breaking-changes.md), and
the 'websql' key was subsequently removed from the storages lookup in
session.ClearStorageData() during the Chromium 126 bump (#41868).

The documentation for `ses.clearStorageData()` was not updated at the
time and still lists `websql` as a valid value for the `storages`
option. Passing `websql` now silently has no effect, leaving the docs
out of sync with the implementation.

Remove `websql` from the documented list of storage types so the
documentation matches the actual behavior.

Refs: #33900

Signed-off-by: Asish Kumar <officialasishkumar@gmail.com>
2026-04-20 12:45:00 -07:00
David Franco
bc8ed1808c feat: import shared texture supports nv16 (#50728) 2026-04-20 12:39:13 -07:00
Shelley Vohr
db9bcbd3e4 chore: add Phase Three (node smoke tests) to Node.js upgrade skill (#51127)
Adds test suite workflow, BoringSSL incompatibility reference table,
snapshot regeneration instructions, and commit guidelines.
2026-04-20 12:38:13 -07:00
Samuel Attard
92f0993d94 fix: ensure corsEnabled: false protocol handlers do not work across protocols (#51152)
* fix: ensure corsEnabled: false protocol handlers do not work across protocols

Subresource requests for registered custom protocols are routed to
ElectronURLLoaderFactory via the renderer's per-scheme URLLoaderFactoryBundle
entry, which bypasses the network service's CorsURLLoaderFactory. This meant a
cross-origin page could fetch() a scheme registered with {supportFetchAPI: true}
and read the response body even when {corsEnabled: true} was not set.

Replicate CorsURLLoader::StartRequest's kCorsDisabledScheme gate in
ElectronURLLoaderFactory::CreateLoaderAndStart so cross-origin mode=cors
requests to such schemes fail before the JS handler runs, and tag cross-origin
mode=no-cors responses as opaque so the body is not script-readable while <img>
and similar subresource loads continue to work.

Re-enable the long-disabled "disallows CORS and fetch requests when only
supportFetchAPI is specified" test, add coverage for the opaque/no-cors,
same-origin, handler-not-invoked, corsEnabled-unaffected and net.fetch-unaffected
cases, and migrate spec helpers that were exercising a {supportFetchAPI: true}
scheme cross-origin to a corsEnabled scheme.

* chore: oxfmt
2026-04-20 09:34:37 -07:00
Charles Kerr
bef68b6bb7 fix: dangling raw_ptr regression in DesktopCapturer (#51158)
fix: dangling raw_ptr in desktopCapturer
2026-04-20 10:26:43 -05:00
Erick Zhao
0866d39006 docs: update versioning references (#51030)
* docs: update versioning references

* fixups
2026-04-20 12:02:00 +02:00
Charles Kerr
2e17a57d49 test: increase test coverage for docked DevTools and attached WebContentsView (#51071)
* test: strengthen layout-sensitive coverage for docked DevTools and attached WebContentsView

Improve test coverage for layout-dependent behavior by asserting geometry results:

- Test that opening right-docked DevTools shrinks the inspected page
  viewport and that closing DevTools restores it.

- Test that a newly-attached WebContentsView becomes visible with a
  viewport that immediately matches the window’s content bounds.

* fixup! test: strengthen layout-sensitive coverage for docked DevTools and attached WebContentsView
2026-04-20 12:01:25 +02:00
electron-roller[bot]
0ab23201e7 chore: bump node to v24.15.0 (main) (#51091) 2026-04-20 11:52:38 +02:00
David Sanders
1bea748a45 ci: randomly assign stable prep tasks (#51131)
Assisted-by: Claude Opus 4.6
2026-04-20 11:52:11 +02:00
Samuel Attard
09361b6d7b build: update ANGLE repository URL to GitHub mirror (#51156)
Clone angle from github.com/google/angle in fix-sync action

Co-authored-by: Claude <noreply@anthropic.com>
2026-04-20 11:51:39 +02:00
Samuel Attard
a98d19a3ba build: resolve electron_version from git when building in a worktree (#51146)
BUILD.gn previously hard-coded read_file(".git/packed-refs", ...) and
".git/HEAD" to derive electron_version. In a `git worktree` checkout
.git is a file containing a gitdir: pointer, not a directory, so GN's
read_file() fails and gn gen aborts unless override_electron_version is
set manually.

Ask git itself for the real locations via `git rev-parse --git-dir` /
`--git-common-dir` in a small helper script, and feed those resolved
paths to read_file() and the exec_script dependency list. Behaviour in
a plain clone is unchanged (both resolve to electron/.git/...), and the
tarball case still fails loudly with a pointer to
override_electron_version.
2026-04-20 00:54:14 -07:00
Niklas Wenzel
e2143f5e8e feat: support heap profiling in contentTracing (#50826)
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-04-20 15:01:13 +09:00
Charles Kerr
a1d28e6764 fix: do not block indefinitely on thumbnails in desktopCapturer (#51128)
* fix: do not block indefinitely on thumbnails in desktopCapturer

fixes dad4ab6 regression

* fix: build error

* fixup! fix: do not block indefinitely on thumbnails in desktopCapturer

chore: remove unnecessary code

* Update shell/browser/api/electron_api_desktop_capturer.cc

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-04-19 13:48:38 -05:00
Charles Kerr
72a168f653 fix: linux test shutdown error "AttributeError: type object 'DBusTestCase' has no attribute 'stop_dbus'" (#51129)
stop_dbus() was removed on 2025-09-14 by
99c4800e9e

I think CI isn't seeing this yet because its image has an older version.

This patched script should work on old & new versions of python-dbusmock.
2026-04-18 17:30:53 -07:00
Niklas Wenzel
f6f71fa787 build: remove maintainer issue template (#51142) 2026-04-18 16:59:12 -07:00
Robo
9d77099a8c build: update rules for chrome-release-cls skill (#51140) 2026-04-18 07:43:22 +00:00
Samuel Attard
85be1a05e1 build: add chrome-release-verify and chrome-release-cls skills (#51138)
* build: add chrome-release-verify and chrome-release-cls skills

Adds two project skills under .claude/skills/ for security backports:

* chrome-release-cls — given a Chrome Releases blog post URL, extract
  every CVE/bug and locate the underlying Gerrit CL by searching the
  local Chromium checkout and sub-repos.
* chrome-release-verify — end-to-end backport flow for a release
  branch: maps CVEs→CLs, verifies which fixes are already in the synced
  source tree, writes the cherry-pick patches locally, validates with
  `e sync --3` + `lint --patches` (with the export→lint→re-apply loop),
  then opens a single PR with the linked-CL/crbug/CVE body format.

* ci: skip platform builds for .claude/** changes
2026-04-17 20:28:36 -07:00
Charles Kerr
2f749e24ed fix: intermittent CI failure is-not-alwaysOnTop (#51110)
* fix: intermittent CI failure is-not-alwaysOnTop

Ensure that the `always-on-top-changed` event always fires with the
right 'alwaysOnTop' boolean, regardless of interaction between
SetZOrderLevel() and MoveBehindTaskBarIfNeeded(). We know what the
value will be when all of the HWND events settle, so use that value.

* test: temporary commit to torture-test the new change with 1000 iterations

* test: keep eventually-becomes-consistent test but do not loop 1000 times
2026-04-17 19:03:16 -05:00
David Sanders
15ed78d807 build: don't use //third_party/depot_tools in lint.js (#51034)
* build: don't use //third_party/depot_tools in lint.js

* chore: also run python3 through depot tools
2026-04-17 12:20:27 +02:00
Keeley Hammond
2fbd11d978 feat: add Notification.getHistory() for macOS (#50325)
* feat: add `Notification.getHistory()` static method (macOS)

Add `Notification.getHistory()` which returns a `Promise<Notification[]>`
of all delivered notifications still present in Notification Center.

Each returned Notification is a live object connected to the corresponding
delivered notification — interaction events (click, reply, action, close)
will fire on these objects, enabling apps to re-attach event handlers after
a restart.

Key implementation details:
- Queries UNUserNotificationCenter's getDeliveredNotifications API
- Creates live Notification objects with populated id, groupId, title,
  subtitle, and body properties from what macOS provides
- Registers each object with the presenter via Restore() so the
  NotificationCenterDelegate routes events correctly
- Restored notifications use is_restored_ flag to prevent removal from
  Notification Center when the JS object is garbage collected
- Requires code-signed builds (unsigned builds resolve with empty array)

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* test: fix typecheck

* fix: avoid dangling presenter pointer in GetHistory callback

* fix: document show() behavior

Notifications returned by getHistory() now set is_restored_ so that Dismiss() skips removal from Notification Center on GC. Calling show() on a restored notification removes the original from NC and posts a new one.

* fix: address code review feedback

* test: fix oxfmt linting

* docs: update docs/api/notification.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-04-16 16:49:10 -07:00
Keeley Hammond
d813618538 fix: remove vestigial MachServices from ShipIt launchd job (#51070) 2026-04-16 15:12:38 -07:00
Keeley Hammond
99e8170f3f fix: fix types in devtools console for release (#51104) 2026-04-16 13:28:18 -07:00
Shelley Vohr
02d90a5ba3 chore: add Node.js skill to settings (#51092) 2026-04-16 15:28:45 -04:00
Niklas Wenzel
3c826c7503 fix: linter issue (#51105) 2026-04-16 12:07:16 -07:00
Charles Kerr
f35122b21e test: add tab source ID tests for media handler (#51068)
* test: add getMediaSourceId tab source coverage

* chore: move captureWithTabSourceId() to a shared helper

* test: improve "webContents module getMediaSourceId()" testing
2026-04-16 13:13:10 -04:00
Samuel Attard
5523130c92 ci: build a patched siso for Windows builds (#51077)
* ci: build a patched siso for Windows builds

The Windows Chromium builds intermittently fail during manifest load
with 'The parameter is incorrect.' (ERROR_INVALID_PARAMETER) out of
bindflt.sys. Root cause is a handle-relative NtCreateFile race in
siso/toolsupport/ninjautil/file_parser.go, which opens each subninja
twice — once in the outer goroutine and once more per chunk for
ReadAt. (*os.File).ReadAt is documented as safe for concurrent use,
so the extra open is redundant and removing it both halves the
CreateFileW calls per subninja and sidesteps the race.

Add a new build-siso-windows job on ubuntu-latest (runs in parallel
with checkout-windows) that:

- reads chromium_version from DEPS and pulls the matching siso_version
  SHA from the Chromium mirror's DEPS at that ref
- shallow-clones chromium.googlesource.com/build at that SHA
- applies the in-tree patches under .github/siso-patches/ via git am
- cross-compiles siso.exe for windows/amd64
- caches the binary keyed on siso SHA + sha256 of the patches, so
  subsequent runs hit the cache and skip the clone/patch/build steps
- uploads the result as a siso-windows-amd64 artifact

The Windows build jobs now depend on build-siso-windows, download the
artifact into $RUNNER_TEMP/siso, and export SISO_PATH, which
depot_tools/siso.py already honors. Mirrored into windows-publish.yml
and the regenerated pipeline-segment-electron-publish.yml so release
builds pick it up too.

Notes: none

* ci: extract siso build into a reusable workflow segment

Move the build-siso-windows job body into
pipeline-segment-build-siso-windows.yml and call it from both build.yml
and windows-publish.yml via workflow_call. Also pin actions/cache to
v5.0.5 and add version comments next to the action SHAs introduced by
this change.
2026-04-16 12:40:33 -04:00
Samuel Attard
abffba4548 fix: use CreateDataProperty when copying objects across contextBridge (#50900) 2026-04-16 12:39:53 +02:00
Shelley Vohr
d164b7af01 fix: prevent uaf when destroying guest WebContents during event emission (#50833)
fix: prevent use-after-free when destroying guest WebContents during event emission

Multiple event emission sites in WebContents destroy the underlying C++
object via a JavaScript event handler calling webContents.destroy(), then
continue to dereference the freed `this` pointer. This is exploitable
through <webview> guest WebContents because Destroy() calls `delete this`
synchronously for guests, unlike non-guests which safely defer deletion.

The fix has two layers:

1. A new `is_emitting_event_` flag is checked in Destroy() — when true,
   guest deletion is deferred to a posted task instead of executing
   synchronously. This is separate from `is_safe_to_delete_` (which
   gates LoadURL re-entrancy) to avoid rejecting legitimate loadURL
   calls from event handlers.

2. AutoReset<bool> guards on `is_emitting_event_` are added to
   CloseContents, RenderViewDeleted, DidFinishNavigation, and
   SetContentsBounds, preventing synchronous destruction while their
   Emit() calls are on the stack.

Destroy() now requires both `is_safe_to_delete_` (navigation re-entrancy)
and `!is_emitting_event_` (event emission) to allow synchronous guest
deletion. The existing AutoReset guards on `is_safe_to_delete_` in
DidStartNavigation, DidRedirectNavigation, and ReadyToCommitNavigation
are also now effective for guests.
2026-04-16 12:26:55 +02:00
Fedor Indutny
2434c5a73c fix: show 'Electron Isolated Context' in Dev Tools (#51062)
Because of a bug after the [upstream refactor][0] Dev Tools stopped
showing 'Electron Isolated Context' in the execution context selector.
'Electron Isolated Context' runs with origin set to `file://`. Since
domain name is empty for the origin the respective UI item in the
context selector is created with an empty `subtitle`. However, with the
upstream change items with either of `title` or `subtitle` are omitted
from rendering.

Here we float an [in-review patch][1] until it is fixed upstream.

[0]: dbb61cf4b2
[1]: https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7761316
2026-04-16 11:48:09 +02:00
Charles Kerr
cc738f2a6c refactor: avoid unnecessary extends EventEmitter in lib (#51058)
* refactor: MessageChannel does not need to extend EventEmitter

Added in f66d4c7 but never used.

Apparently added as a copy-paste side effect when adding better interface
info into the lib types, eg extends/implements.

* refactor: ShareMenu does not need to extend EventEmitter

Added in f66d4c7 but never used.

Apparently added as a copy-paste side effect when adding better interface
info into the lib types, eg extends/implements.
2026-04-15 23:24:15 -05:00
Charles Kerr
9569c48bfe refactor: SafeStorage never emits, so do not inherit from EventEmitter (#51057) 2026-04-15 23:24:00 -05:00
Charles Kerr
0a80d4d879 fix: UAF in api::UtilityProcessWrapper (#51069)
* fix: UAF in api::UtilityProcessWrapper

Detach the wrapper from ServiceProcessHost during termination instead
of waiting for destruction. Add a regression test that forces GC.

This fixes a UAF error reported by ASAN: the wrapper lost its last JS
reference and become collectible after emitting exit *but* before it
had been removed from the global observer list.

UtilityProcessWrapper is now cppgc-managed as of b9e462f397, but its
ServiceProcessHost observer cleanup still depended on destructor-time
teardown.

* fixup! fix: UAF in api::UtilityProcessWrapper

fix: much better cleanup from Deepak code review
2026-04-15 16:56:57 -07:00
Shelley Vohr
0227bcfb9f fix: allow PDF viewer to show save file picker (#51042)
The PDF viewer's "save with changes" feature uses
`window.showSaveFilePicker()`, but the PDF extension runs in a
cross-origin iframe (chrome-extension:// inside the app's origin).
Chromium's File System Access API blocks cross-origin subframes from
showing file pickers unless the embedder explicitly allows them via
`ContentClient::IsFilePickerAllowedForCrossOriginSubframe()`.

Chrome overrides this in `ChromeContentClient` to allowlist the PDF
extension origin, but Electron never did — so the picker was always
blocked with a SecurityError.

This adds the same override to `ElectronContentClient`, allowing the
built-in PDF extension origin to bypass the cross-origin check.
2026-04-15 18:04:24 -05:00
Anirudh Sevugan
0ad0d44b3d docs: add ELECTRON_INSTALL env vars and remove ELECTRON_SKIP_BINARY_D… (#50979)
docs: add ELECTRON_INSTALL env vars and remove ELECTRON_SKIP_BINARY_DOWNLOAD

these were added recently in a commit but no docs were there for them

also, ELECTRON_SKIP_BINARY_DOWNLOAD was deprecated in electron v42, so that is removed as well
2026-04-15 11:35:35 -05:00
Samuel Attard
04b9b7bc22 build: fail gha-done check when required job fails (#50959)
fix: fail gha-done when any required job failed

Previously, the `gha-done` gate job used an `if:` expression that
evaluated to false whenever any needed job reported a failure, which
caused the job to be *skipped* rather than *failed*. GitHub branch
protection treats skipped required checks as non-blocking, so a PR
could be marked mergeable even though one of its test jobs had failed.

Keep the job always running and move the failure check into a step
that explicitly exits 1 when any dependency failed or was cancelled,
so the "GitHub Actions Completed" required check actually blocks the
merge in that case.

Notes: none
2026-04-15 16:12:13 +02:00
Samuel Attard
22f15ec476 build: authenticate sudowoodo /token exchange via Actions OIDC (#51051) 2026-04-14 15:54:45 -07:00
Charles Kerr
53bf94fdf4 refactor: move electron::api::GlobalShortcut to cppgc (#50192)
* refactor: migrate electron::api::GlobalShortcut to cppgc

* refactor: lazy-create electron::api::GlobalShortcut

copy the lazy-create idom used by electron::api::Screen

* refactor: use gin::WeakCellFactory in GlobalCallbacks

* fix: make a copy of `callback` before running it

safeguard against the callback changing the map, invalidating `cb`

* chore: reduce unnecessary diffs with main

* fixup! refactor: use gin::WeakCellFactory in GlobalCallbacks

fix: must Trace() the weak cell factory

* fix: destruction order

- Setup isolate dispose observer to run destruction sequences
and remove self persistent reference
- Skip NOTREACHED check during destruction, it can happen
as a result of plaform listeners scheduling callbacks when Unregister is invoked.
- Fix the order of unregistration in GlobalShortcut::Unregister
- Add GlobalShortcut::UnregisterAllInternal to avoid any callsites
that can re-enter V8

* fix: crash during gc from incorrect cppgc object headers

* chore: update patches

* chore: cleanup

* chore: fix lint

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-04-14 15:52:13 -04:00
Michaela Laurencin
21c5e25f04 ci: allow manual backports to pass template check (#50916)
* ci: allow manual backports to pass template check

Co-Authored-By: Claude <noreply@anthropic.com>
Generated-By: GitHub Copilot

* Update .github/workflows/pr-template-check.yml

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-04-14 12:15:35 -07:00
Erick Zhao
cf2cc4d80f docs: mention pre-release installation (#51020)
* docs: pre-release installation

* Update installation.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-04-14 09:23:46 -07:00
Charles Kerr
8ea3d16ce9 chore: remove unused parts of chore_provide_iswebcontentscreationoverridden_with_full_params.patch (#51025)
chore: remove dead patches from chore_provide_iswebcontentscreationoverridden_with_full_params.patch
2026-04-14 09:23:43 -07:00
Charles Kerr
c30655785b refactor: remove FramelessView::Init() (#51008)
* refactor: remove FramelessView::Init()

move to constructor instead

* refactor: make FramelessView::window_ const

refactor: make FramelessView::frame_ const

* refactor: simplify NativeWindowViews::CreateFrameView() logic branches
2026-04-14 16:06:07 +02:00
David Sanders
d223ad67ea build: allow non-zero exit codes locally when linting Chromium rolls (#51031) 2026-04-14 09:04:09 -05:00
Charles Kerr
dad4ab658a fix: timing issue DCHECK crash in DesktopCapturer on macOS (#50960)
refactor: use StartUpdating in desktopCapturer

Replace the one-shot Update() callback model with the continuous
StartUpdating() observer model for NativeDesktopMediaList.

Fixes a macOS DCHECK(can_refresh()) crash in UpdateSourceThumbnail(),
where ScreenCaptureKit's recurrent thumbnail capturer would post
UpdateSourceThumbnail callbacks after the one-shot refresh_callback_
had been consumed. Now, can_refresh() is always true because
refresh_callback_ is repopulated via ScheduleNextRefresh().

Each capturer (window, screen) gets its own ListObserver that tracks
readiness via OnSourceAdded and OnSourceThumbnailChanged events.
Once a list has both sources and thumbnails (or thumbnails aren't
requested), its data is snapshotted and the capturer checks if all
requested types are ready before resolving to JS.

Also remove the "skip_next_refresh_" Chromium patch, which was a
workaround for the timing mismatch between the one-shot Update()
model and ScreenCaptureKit's asynchronous thumbnail delivery.

refactor: simplify state logic in DesktopCapturer
2026-04-14 09:03:18 -05:00
dependabot[bot]
9b85b9c0bc build(deps): bump actions/upload-artifact from 7.0.0 to 7.0.1 (#51032)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 7.0.0 to 7.0.1.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](bbbca2ddaa...043fb46d1a)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 7.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-14 12:44:07 +02:00
John Kleinschmidt
abd29a397e ci: don't login to RBE for clang-tidy and gn-check (#51022)
* ci: don't login to RBE for clang-tidy

* ci: don't login to RBE for gn check
2026-04-14 12:33:34 +02:00
John Kleinschmidt
604e7e82f2 test: fixup autoupdater tests failures (#51024) 2026-04-14 12:33:28 +02:00
Shelley Vohr
2e3da1d079 fix: crash when closing devtools after focus (#47435) 2026-04-14 12:32:19 +02:00
dependabot[bot]
edbff16029 build(deps): bump actions/github-script from 8.0.0 to 9.0.0 (#51033)
Bumps [actions/github-script](https://github.com/actions/github-script) from 8.0.0 to 9.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](ed597411d8...3a2844b7e9)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 9.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-14 11:22:02 +02:00
John Kleinschmidt
b5fbbed4db ci: only move items to Needs Review when appropriate (#51023) 2026-04-14 11:02:09 +02:00
Niklas Wenzel
663773a677 fix: linter issue (#51009) 2026-04-13 08:14:34 -07:00
Niklas Wenzel
351f35da8c fix: include missing metadata in trace files (#50892) 2026-04-13 09:36:06 -04:00
Robo
b9e462f397 refactor: api::utilityProcessWrapper managed by cppgc (#50955)
* refactor: api::utilityProcessWrapper managed by cppgc

* chore: fix lint
2026-04-13 10:46:51 +02:00
Shelley Vohr
a39108c5a4 fix: nodeIntegrationInWorker not working in AudioWorklet (#47244)
* fix: nodeIntegrationInWorker not working in AudioWorklet

* fix: deadlock on Windows when destroying non-AudioWorklet worker contexts

The previous change kept the WebWorkerObserver alive across
ContextWillDestroy so the worker thread could be reused for the next
context (AudioWorklet thread pooling, Chromium CL:5270028). This is
correct for AudioWorklet but wrong for PaintWorklet and other worker
types, which Blink does not pool — each teardown destroys the thread.

For those worker types, ~NodeBindings was deferred to the thread-exit
TLS callback. By that point set_uv_env(nullptr) had already run, so on
Windows the embed thread was parked in GetQueuedCompletionStatus with a
stale async_sent latch that swallowed the eventual WakeupEmbedThread()
from ~NodeBindings. uv_thread_join then blocked forever, deadlocking
renderer navigation. The worker-multiple-destroy crash case timed out
on win-x64/x86/arm64 as a result. macOS/Linux (epoll/kqueue) don't have
the latch and were unaffected.

Plumb is_audio_worklet from WillDestroyWorkerContextOnWorkerThread into
ContextWillDestroy. For non-AudioWorklet contexts, restore the
pre-existing behavior of calling lazy_tls->Set(nullptr) at the end of
the last-context cleanup so ~NodeBindings runs while the worker thread
is still healthy. AudioWorklet continues to keep the observer alive so
the next pooled context can share NodeBindings.

* chore: address review feedback

* fix: stop embed thread before destroying environments in worker teardown

FreeEnvironment (called via environments_.clear()) runs uv_run to drain
handle close callbacks. On Windows, both that uv_run and the embed
thread's PollEvents call GetQueuedCompletionStatus on the same IOCP
handle. IOCP completions are consumed by exactly one waiter, so the
embed thread can steal completions that FreeEnvironment needs, causing
uv_run to block indefinitely. On Linux/Mac epoll_wait/kevent can wake
multiple waiters for the same event so the race doesn't manifest.

Add NodeBindings::StopPolling() which cleanly joins the embed thread
without destroying handles or the loop, and allows PrepareEmbedThread +
StartPolling to restart it later. Call StopPolling() in
WebWorkerObserver::ContextWillDestroy before environments_.clear() so
FreeEnvironment's uv_run is the only thread touching the IOCP.

Split PrepareEmbedThread's handle initialization (uv_async_init,
uv_sem_init) from thread creation via a new embed_thread_prepared_ flag
so the handles survive across stop/restart cycles for pooled worklets
while the embed thread itself can be recreated.

* chore: address outstanding feedback
2026-04-13 10:27:30 +02:00
Kunal Dubey
04d9de6f73 fix: avoid window drag during corner resize in MAS build (#50637)
* fix: avoid window drag during corner resize in MAS build

* chore: update chromium patch offsets
2026-04-13 09:54:27 +02:00
Charles Kerr
b8dbe21b38 chore: do not patch fake_desktop_media_list.cc (#50953)
chore: do not patch files we do not use

do not patch fake_desktop_media_list.cc, .h
2026-04-13 09:27:32 +02:00
Samuel Attard
a57dbb55cc ci: split macos-x64 tests into 3 shards (#50968) 2026-04-13 09:26:19 +02:00
David Sanders
860a544534 ci: capture fatal errors in clang problem matcher (#50984) 2026-04-13 09:25:43 +02:00
David Sanders
e31cd64fe5 ci: ignore canceled jobs in audit (#50981)
* ci: ignore canceled jobs in audit

* chore: add another variation
2026-04-13 09:25:26 +02:00
Samuel Attard
10eb512d1d test: run oxfmt on simpleFullScreen test (#50990)
chore: fix oxfmt formatting in api-browser-window-spec

Co-authored-by: Claude <noreply@anthropic.com>
2026-04-12 19:58:02 -07:00
Calvin
052efc9727 chore: add AI tool policy to CONTRIBUTING.md & update PR template (#50451)
* chore: update PR template and add AI tool policy to CONTRIBUTING.md

* sentencesmithing
2026-04-12 19:10:42 -05:00
Shelley Vohr
a007bafaf1 fix: simpleFullScreen exits when web content calls requestFullscreen (#50874)
fix: simpleFullScreen exits when web content calls requestFullscreen

SetHtmlApiFullscreen only checked IsFullscreen() to detect that the
window was already fullscreen, missing the simple-fullscreen case on
macOS. When web content triggered requestFullscreen the code fell
through to SetFullScreen(true) which toggled simple fullscreen off.

Include IsSimpleFullScreen() in the guard so the HTML-API fullscreen
state is updated without touching the window's fullscreen mode.
2026-04-12 19:06:07 -05:00
Robo
ea757689b3 refactor: rm chore_add_electron_objects_to_wrappablepointertag.patch (#50957) 2026-04-12 19:02:40 -05:00
Samuel Attard
2c94aac330 build: add oxfmt for JS/TS formatting and import sorting (#50692)
* build: add oxfmt for code formatting and import sorting

Adds oxfmt as a devDependency alongside oxlint and wires it into the
lint pipeline. The .oxfmtrc.json config matches Electron's current JS
style (single quotes, semicolons, 2-space indent, trailing commas off,
printWidth 100) and configures sortImports with custom groups that
mirror the import/order pathGroups previously enforced by ESLint:
@electron/internal, @electron/*, and {electron,electron/**} each get
their own ordered group ahead of external modules.

- `yarn lint:fmt` runs `oxfmt --check` over JS/TS sources and is
  chained into `yarn lint` so CI enforces it automatically.
- `yarn format` runs `oxfmt --write` for local fix-up.
- lint-staged invokes `oxfmt --write` on staged .js/.ts/.mjs/.cjs
  files before oxlint, so formatting is applied at commit time.

The next commit applies the formatter to the existing codebase so the
check actually passes.

* chore: apply oxfmt formatting to JS and TS sources

Runs `yarn format` across lib/, spec/, script/, build/, default_app/,
and npm/ to bring the codebase in line with the .oxfmtrc.json settings
added in the previous commit. This is a pure formatting pass: import
statements are sorted into the groups defined by the config, method
chains longer than printWidth are broken, single-quoted strings
containing apostrophes are switched to double quotes, and a handful of
single-statement `if` bodies are re-wrapped and get braces added by
`oxlint --fix` to satisfy the `curly: multi-line` rule.

No behavior changes.
2026-04-12 02:03:04 -07:00
Shelley Vohr
dcb844c201 chore: add Claude Code skill for Node.js upgrades (#50910)
Adds a new skill mirroring the Chromium upgrade skill, adapted for
Node.js rolls. Covers patch conflict resolution, build fix workflow,
commit guidelines, and documents high-churn patches and major version
upgrade patterns (V8 bridge patch deletions, BoringSSL complexity).
2026-04-11 20:11:49 -07:00
Charles Kerr
9bc55a255c chore: remove some unnecessary diffs in refactor_expose_file_system_access_blocklist.patch (#50909)
chore: remove some unnecessary diffs in refactor_expose_file_system_access_blocklist.patch
2026-04-11 16:48:47 -05:00
Samuel Attard
12b74eac26 fix: respect iframe sandbox flags for external protocol navigation (#50901) 2026-04-11 16:16:23 -04:00
Charles Kerr
6e7938af1d refactor: migrate api::Extensions to cppgc (#50932)
* refactor: migrate api::Extensions to cppgc

* chore: update patch indices
2026-04-12 01:59:54 +09:00
Charles Kerr
5fded05add fix: dangling raw_ptr api::Protocol::protocol_registry_ (#50829) 2026-04-11 08:53:53 -05:00
Charles Kerr
1879998865 refactor: migrate api::ServiceWorkerContext to cppgc (#50931)
refactor: migrate api::ServiceWorkerContext to cppgc
2026-04-11 18:56:31 +09:00
Samuel Attard
b1b02d9123 fix: restrict window.open features to allowlisted BrowserWindow options (#50902) 2026-04-11 03:43:55 -04:00
Samuel Attard
3f140e1b4b fix: clamp autofill popup bounds to the requesting frame viewport (#50903) 2026-04-11 03:43:43 -04:00
Samuel Attard
3ff923990d fix: validate OSR frame geometry against shared-memory mapping size (#50904) 2026-04-11 03:43:24 -04:00
Samuel Attard
b4e14a9004 fix: use ShowItemInFolder for devtools showItemInFolder embedder message (#50905) 2026-04-11 03:43:14 -04:00
Samuel Attard
61bb03ca75 fix: use audit token instead of PID for parent code-signature check (#50907) 2026-04-11 03:42:52 -04:00
Samuel Attard
1a2029c3a2 fix: apply IsSafeRedirectTarget to net module redirects (#50869) 2026-04-10 19:19:51 -07:00
Samuel Attard
bfa5c93332 refactor: attach translator holder via v8::Function data slot (#50867) 2026-04-10 19:19:34 -07:00
Samuel Attard
f36def6601 fix: scope extension tab-ID resolution to the calling BrowserContext (#50906) 2026-04-10 19:16:21 -07:00
David Sanders
97347c4223 chore: clean up clang-tidy warnings (#50862)
* chore: use emplace and use it correctly

* chore: redundant cast to the same type [google-readability-casting]

* chore: do not create objects with +new [google-objc-avoid-nsobject-new]

* chore: default arguments on virtual or override methods are prohibited [google-default-arguments]

* chore: warning: C-style casts are discouraged; use static_cast [google-readability-casting]

CFLocaleGetValue already returns CFTypeRef so that redundant static_cast was removed

* chore: refactor block to avoid use after move warning from clang-tidy

Looks like clang-tidy couldn't tell these were two mutually exclusive
branches so there was no actual issue, but refactoring is cleaner
anyway since it makes it more DRY.

* chore: C-style casts are discouraged; use static_cast [google-readability-casting]

No cast needed here, everything is already the correct type

* chore: C-style casts are discouraged; use static_cast/const_cast/reinterpret_cast [google-readability-casting]

* chore: use '= default' to define a trivial destructor [modernize-use-equals-default]

* chore: use range-based for loop instead [modernize-loop-convert]

* chore: redundant void argument list [modernize-redundant-void-arg]

* chore: address code review feedback

* chore: use auto

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-04-10 16:37:57 -07:00
Alexey
8d8847d478 feat: capture JS stack trace on renderer OOM (#50043)
* feat: capture JS stack trace on renderer OOM

When a renderer process approaches its V8 heap limit, capture the
JavaScript stack trace and write it to both a Crashpad crash key
("js-oom-stack") and stderr.

The stack trace is captured via RequestInterrupt rather than directly
inside the NearHeapLimitCallback because CurrentStackTrace is unsafe
to call during OOM — V8 FATALs on optimized (TurboFan) frames that
have had their deoptimization data garbage-collected. RequestInterrupt
defers the capture to the next V8 safe point, where all frames are
guaranteed to have deopt data available. This matches Node.js's
approach of never capturing JS stacks inside the heap limit callback.

The callback is registered once per isolate via an atomic guard in
RendererClientBase::DidCreateScriptContext, preventing the CHECK
failure V8 raises on duplicate AddNearHeapLimitCallback registrations
(which would otherwise occur on page navigations or multiple contexts).

Refs: #46078
Made-with: Cursor

* Update shell/renderer/oom_stack_trace.cc

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update shell/renderer/oom_stack_trace.cc

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* test: add crash reporter test for OOM JS stack trace

Add a test that verifies the `electron.v8-oom.stack` crash key contains
the JS stack trace (including function names) when a renderer process
runs out of memory. Also deduplicate the heap info formatting in
oom_stack_trace.cc.

Refs: #46078
Made-with: Cursor

* fix: lint formatting in oom_stack_trace.cc

Made-with: Cursor

* fix: use proper logger API instead of cstdio

* fix: check heap headroom before capturing OOM stack trace

deepak1556: "Should there be check for available heap size [for]
CurrentStackTrace and formatting"

CurrentStackTrace allocates StackTraceInfo + StackFrameInfo on the V8
heap. If the 20 MB bump is partially consumed by the time the interrupt
fires, these allocations trigger a secondary OOM. Guard with a 2 MB
headroom check.

Made-with: Cursor

* fix: handle V8 cage limit when bumping heap for OOM stack capture

deepak1556: "Does this bumping work when we are at the cage limit of
4GB"

V8's pointer compression cage caps the heap at ~4 GB. When
current_heap_limit is already near the ceiling, our 20 MB bump gets
clamped to zero and the interrupt never fires. Detect this and record
heap info as the final crash key instead of waiting for a stack trace
that won't arrive.

Made-with: Cursor

* feat: add V8 heap statistics as OOM crash keys

deepak1556: "V8 seems to capture heap stats as crash keys but it gets
missed today due to the OOM callback override... wonder if we can
include that to get some more heuristics in the dump."

Record heap used/total/limit/available, per-space stats for old_space
and large_object_space, native/detached context counts, and utilization
percentage as crash keys. Also add heap stats in the V8OOMErrorCallback
in node_bindings.cc for the final OOM crash report.

Made-with: Cursor

* feat: support worker thread isolates for OOM stack trace

deepak1556: "You need a separate registration for worker threads via
WorkerScriptReadyForEvaluationOnWorkerThread but that also means the
process global g_registered_isolate would break."

Chromium has one V8 isolate per thread (main + one per web worker), so
thread_local is equivalent to per-isolate storage. Replace the global
atomic + mutex/set with a constinit thread_local OomState* that holds
the isolate pointer and per-isolate is_in_oom flag. The void* data
parameter on AddNearHeapLimitCallback delivers OomState* directly into
callbacks, so the hot path needs no TLS lookup.

Add WorkerScriptReadyForEvaluationOnWorkerThread and
WillDestroyWorkerContextOnWorkerThread overrides to RendererClientBase
so both ElectronRendererClient and ElectronSandboxedRendererClient get
worker OOM registration. Update ElectronRendererClient to call the base
class in both worker lifecycle methods.

Add a web worker OOM test that spawns a dedicated Worker with a memory
leak and verifies the stack trace captures the worker function name.

Made-with: Cursor

* fix: register OOM callback for all script contexts

When context isolation is enabled, ShouldNotifyClient skips
DidCreateScriptContext for the main world, but user JS still runs there
and can OOM. Register in DidInstallConditionalFeatures which fires for
every script context. The TLS dedup guard prevents double-registration
on the same isolate.

Made-with: Cursor

* fix: guard against division by zero and cage size changes in OOM handler

Add a zero-guard on heap_size_limit before computing utilization
percentage — maximizes robustness in an OOM code path.

Add static_assert on kPtrComprCageReservationSize to catch any
upstream V8 change to the cage size at compile time.

Made-with: Cursor

* fix: address review feedback on OOM stack trace PR

- Remove redundant RegisterOomStackTraceCallback from
  electron_render_frame_observer.cc; DidCreateScriptContext is sufficient
  since main world and isolated world share the same isolate
- Replace thread_local OomState* with base::ThreadLocalOwnedPointer
  wrapped in base::NoDestructor per Chromium style for non-trivially
  destructible types
- Change heap-headroom and cage-limit logs from ERROR to INFO since
  users cannot act on these diagnostics
- Add comment explaining why base class is called last in
  WillDestroyWorkerContextOnWorkerThread (OOM deregistration ordering)

Made-with: Cursor

* fix: skip OOM stack trace registration for worklet contexts

Worklets can share a thread and isolate via WorkletThreadHolder's
per-process singleton pattern. With per-thread OOM state, the first
worklet to be destroyed would prematurely remove the callback for
any remaining worklets on the same thread. Skip worklets entirely
to avoid this; can be revisited with ref-counting if needed.

Made-with: Cursor

* fix: prevent dangling raw_ptr<v8::Isolate> in OOM state

The OomState held a raw_ptr<v8::Isolate> that outlived the isolate on
the main thread: gin::IsolateHolder destroyed the isolate during
shutdown, but the OomState (stored in thread-local storage) was only
released later in JavascriptEnvironment::~JavascriptEnvironment. This
triggers a dangling pointer check when building with
enable_dangling_raw_ptr_checks.

Register OomState as a gin::PerIsolateData::DisposeObserver so it
clears the raw_ptr and removes the NearHeapLimitCallback before the
isolate is destroyed, regardless of destructor ordering.

Suggested-by: Deepak Mohan
Made-with: Cursor

* test: verify OOM crash keys end-to-end via crash reporter

Replace stderr-based OOM tests with end-to-end crash dump validation.
Instead of parsing log output, start a crash reporter server, trigger
renderer OOM, and verify the uploaded crash dump contains the expected
`electron.v8-oom.*` annotations — the same code path production crash
reports take.

Consolidate all OOM test scenarios (basic heap leak, JSON.stringify,
web worker) into a single `describe('OOM crash keys')` block inside
api-crash-reporter-spec using the existing crash fixture app with new
renderer-oom-json and renderer-oom-worker crash types.

The web worker test verifies that OOM crash keys are present but does
not assert on the JS function name: the 20 MB heap bump may be
exhausted before V8 reaches a safe point to fire the stack-capture
interrupt, leaving the crash key at "(stack pending)". Increasing the
bump or switching to a synchronous capture strategy would fix this but
is left for a follow-up.

Remove the standalone oom-stack-trace-spec.ts and its fixture app.

Made-with: Cursor

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2026-04-10 15:13:16 -04:00
Niklas Wenzel
b9825ba835 fix: preference initialization with app.setPath('sessionData') (#50891)
fix: preference initialization with app.setPath('sessionData')
2026-04-11 03:22:09 +09:00
Robo
9be03cbe54 fix: enable blink gc plugin (#50465)
chore: address blink gc plugin errors

Key fixes:
- Replace `base::WeakPtrFactory` with `gin::WeakCellFactory` in
  MenuMac, MenuViews, and NetLog, since weak pointers to cppgc-managed
  objects must go through weak cells
- Replace `v8::Global<v8::Value>` with `cppgc::Persistent<Menu>` for
  the menu reference in BaseWindow
- Stop using `gin_helper::Handle<T>` with cppgc types; use raw `T*`
  and add a `static_assert` to prevent future misuse
- Add proper `Trace()` overrides for Menu, MenuMac, MenuViews, and
  NetLog to ensure cppgc members are visited during garbage collection
- Replace `SelfKeepAlive` prevent-GC mechanism in Menu with a
  `cppgc::Persistent` prevent-GC captured in `BindSelfToClosure`
- Introduce `GC_PLUGIN_IGNORE` macro to suppress
  known-safe violations: mojo::Remote fields, ObjC bridging pointers,
  and intentional persistent self-references
- Mark `ArgumentHolder` as `CPPGC_STACK_ALLOCATED()` in both Electron's
  and gin's function_template.h to silence raw-pointer-to-GC-type
  warnings
2026-04-11 03:21:39 +09:00
Michaela Laurencin
861ef95598 fix: remove decorateURL from default_app (#50852)
remove decorateURL from default_app

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-04-10 13:18:26 -05:00
Jan Hannemann
20ed34a2fd feat: add id, groupId, and groupTitle support for Windows notifications (#50328)
* feat: allow to set id and groupId

* feat: use Id's without hash but check length

* feat: adds visual grouping via groupTitle

* test: tests added for id, groupId and groupTitle

* fix: unused vars on Mac and Linux

* fix: remove redundant parameter

* fix: add doc links for id and group

* fix: throw if groupId is missing

* fix: test
2026-04-10 11:01:57 -07:00
David Sanders
82aa603698 build: don't use //third_party/depot_tools in gn build scripts (#50858) 2026-04-10 13:43:25 -04:00
Charles Kerr
b4f725a763 test: guard permission handlers in File System API tests (#50890)
fix: guard permission handlers in File System API tests

Manual port of #50865 for `main` due to code shear.

1. Chromium can fire unrelated permission checks (e.g. 'background-sync')
on the default session. Copy a safeguard `permission === 'fileSystem'` from
"calls twice when trying to query a read/write file handle permissions".

2. add afterEach cleanup, reset setPermissionCheckHandler(null).
2026-04-10 18:43:04 +02:00
Robo
05f1cb553d fix: shutdown crash when unregistering power notification on windows (#50878)
* fix: crash on shutdown when unregistering power notification

Refs https://learn.microsoft.com/en-us/windows/win32/api/winuser/nf-winuser-unregistersuspendresumenotification
the handle should be the return value of registeration api
not the window handle.

* chore: remove redundant selfkeepalive

Followup to 7c0cb61b3c

* chore: fix lint

* chore: address review feedback
2026-04-11 00:47:05 +09:00
Robo
c0f187f90d feat: capture Node.js trace categories via Perfetto (#50591)
* feat: capture Node.js trace categories via Perfetto

* fix: crash in ELECTRON_RUN_AS_NODE

* chore: cleanup macro usage

* chore: update patches
2026-04-10 08:12:46 -04:00
Robo
5f820b7f69 test: add cppgc backed menu leak regression test (#50879)
* spec: add menu leak regression test

* spec: reduce menu count to remove CI flakiness
2026-04-10 20:48:28 +09:00
Calvin
8b7e7de208 fix: return numeric blksize and blocks from asar fs.stat (#50825)
fix: return numeric `blksize` and `blocks` from asar `fs.stat`

Previously, `fs.stat` on files inside `.asar` archives returned
`undefined` for `blksize` and `blocks`, violating the Node.js API
contract where these fields must be `number | bigint`.

Use `4096` for `blksize` (matching the convention used by `memfs` and
the proposed `node:vfs` module in nodejs/node#61478) and compute
`blocks` as `ceil(size / 512)` (standard 512-byte block units).

Fixes #42686

Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-04-10 10:19:09 +02:00
Shelley Vohr
b59f573097 fix: pass root_gen_dir from GN to generate_node_headers.py (#50847)
fix: pass root_gen_dir from GN to generate_node_headers.py

PR #50828 replaced a local get_out_dir() (defaulting to 'Testing') with
the shared one from script/lib/util.py (defaulting to 'Default').
Neither default is correct because the actual output directory depends
on the active build config. Pass $root_gen_dir from the GN action so
the script always uses the correct path.
2026-04-10 09:41:45 +02:00
Charles Kerr
b417696d6b refactor: migrate electron::api::Protocol to cppgc (#50857)
refactor: migrate api::Protocol to cppgc
2026-04-10 15:58:33 +09:00
Mitchell Cohen
4203d7688f fix: external resize hit targets for frameless windows on Windows (#50706) 2026-04-09 18:13:13 -05:00
Zeenat Lawal
62e637275a fix: move Electron help menu links to default app only (#50629)
* fix: remove Electron links from default help menu

* fix: remove help menu entirely from default menu

* fix: move Electron help menu links to default app

* docs: update default menu items list in menu.md
2026-04-09 12:14:22 -07:00
Shelley Vohr
28c0eb29df fix: webContents.print() ignoring mediaSize when silent (#50808)
fix: webContents.print() ignoring mediaSize when silent

PR #49523 moved the default media size fallback into OnGetDeviceNameToUse,
but the new code unconditionally writes kSettingMediaSize — clobbering
any mediaSize the caller had already set in WebContents::Print() from
options.mediaSize / pageSize. As a result, silent prints with an
explicit pageSize (e.g. "Letter") fell back to A4 with tiny content.

Only populate the default/printer media size when the caller hasn't
already supplied one, preserving the precedence:
  1. user-supplied mediaSize / pageSize
  2. printer default (when usePrinterDefaultPageSize is true)
  3. A4 fallback
2026-04-09 12:16:40 -05:00
Charles Kerr
8a730e2aec fix: remove dangling raw_ptr api::WebContents::zoom_controller_ (#50812)
fix: remove dangling raw_ptr api::WebContents::zoom_controller_
2026-04-09 12:16:17 -05:00
Shelley Vohr
044be7ce40 fix: avoid crash in window.print() when prefilling native print dialog (#50843)
fix: avoid crash in window.print() when prefilling native print dialog

When UpdatePrinterSettings() fails (e.g. the printer rejects the
requested resolution), OnError() nullifies print_info_ via
ReleaseContext(). The return value was not checked, so
AskUserForSettings() passed nil to [NSPrintPanel runModalWithPrintInfo:],
crashing in PJCSessionHasApplicationSetPrinter with a null PMPrintSession.

Check the return value and fall back to UseDefaultSettings() on failure
so the dialog opens with defaults instead of crashing.
2026-04-09 13:14:36 -04:00
Shelley Vohr
7245c6a3f0 ci: re-check signed commits on every PR synchronize (#50811)
The needs-signed-commits label was previously added by the lightweight
synchronize workflow but only removed by a job in build.yml gated on
`gha-done`, which requires every macOS/Linux/Windows build to finish
green. That made label removal both slow (waits on the full pipeline)
and fragile (any unrelated build failure leaves the label pinned even
after commits are properly signed).

Drop the `if` guard on the synchronize job so it re-evaluates signing
on every push, and add a removal step that runs on success when the
label is present. Force-pushing signed commits now clears the label as
soon as the check completes, with no dependency on the build pipeline.
2026-04-09 11:02:01 -04:00
Charles Kerr
b484b0bde9 fix: fix inset and stop using gfx::ToFlooredRectDeprecated() (#50809)
fix: fix inset and stop using ToFlooredRectDeprecated()
2026-04-09 09:55:11 -05:00
Charles Kerr
6c8a910232 refactor: remove unnecessary raw_ptr SavePageHandler::web_contents_ (#50810)
refactor: remove unnecessary field raw_ptr<content::WebContents> SavePageHandler::web_contents_
2026-04-09 09:54:44 -05:00
Noah Gregory
cc3d4f5f58 fix: PDF support when site isolation trials disabled (#50689)
* fix: use proper OOPIF PDF check in `StreamsPrivateAPI`

* fix: add `ShouldEnableSubframeZoom` override to `ElectronBrowserClient` for upstream parity

* fix: add `MaybeOverrideLocalURLCrossOriginEmbedderPolicy` override to `ElectronBrowserClient` for upstream parity

* fix: add `DoesSiteRequireDedicatedProcess` override to `ElectronBrowserClient` for upstream parity

* style: move `DoesSiteRequireDedicatedProcess` to correct override section
2026-04-09 15:35:26 +02:00
Shelley Vohr
b711ce7b04 chore: remove window enlargement revert patch (#50612)
* chore: remove window enlargement revert patch

Chromium removed the `window_enlargement_` system from
DesktopWindowTreeHostWin (1771dbae), which was a workaround for an AMD
driver bug from 2013 (crbug.com/286609) where translucent HWNDs smaller
than 64x64 caused graphical glitches. Chromium confirmed this is no
longer needed and shipped the removal.

This removes the revert patch and all Electron-side code that depended
on the `kEnableTransparentHwndEnlargement` feature flag, including the
`GetExpandedWindowSize` helper and max size constraint expansion in
`NativeWindow::GetContentMaximumSize`.

* test: remove obsolete <64x64 transparent window test

The test was added in 2018 (#12904) to verify the AMD driver
workaround that artificially enlarged translucent HWNDs smaller than
64x64 (crbug.com/286609). The workaround set the real HWND to 64x64
and subtracted a stored window_enlargement_ from every client/window
bounds query, so getContentSize() reported the originally-requested
size even though the actual HWND was larger.

With both the Chromium window_enlargement_ system and Electron's
GetExpandedWindowSize gone, setContentSize on a transparent
thickFrame window calls SetWindowPos directly. WS_THICKFRAME windows
are subject to DefWindowProc's MINMAXINFO.ptMinTrackSize clamp on
programmatic resizes (Chromium's OnGetMinMaxInfo ends with
SetMsgHandled(FALSE), so DefWindowProc overwrites the zeroed
min-track with system defaults), which on Windows Server 2025
floors at 32x39 — hence the failing [32, 39] vs [30, 30].

The removed feature_list.cc comment explicitly flagged this test as
the blocker for retiring kEnableTransparentHwndEnlargement, so
delete it alongside the workaround it was validating.
2026-04-09 15:34:10 +02:00
Alexey
adf9a6e303 fix: restore std::deque for dynamic crash key storage (#50795)
#47171 migrated `std::deque` to `base::circular_deque` in
`shell/common/crash_keys.cc`. However, `CrashKeyString` wraps a
`crashpad::Annotation` that holds self-referential pointers and
registers itself in a process-global linked list. `circular_deque`
relocates elements on growth (via `VectorBuffer::MoveConstructRange`),
leaving those pointers dangling — causing missing crash keys or a hung
crashpad handler (especially on macOS). The `base/containers/README.md`
warns: "Since `base::deque` does not have stable iterators and it will
move the objects it contains, it may not be appropriate for all uses."

Reverts to `std::deque`, whose block-based layout never relocates
existing elements. Adds a regression test that registers 50 dynamic
crash keys and verifies they all survive a renderer crash.

Notes: Fixed crash keys being lost and the crash reporter hanging on
macOS when many dynamic crash keys were registered.

Made-with: Cursor
2026-04-09 10:50:32 +02:00
Calvin
6744293e96 fix: account for extraSize in aspect ratio min/max clamping on macOS (#50794)
Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-04-09 10:50:17 +02:00
dependabot[bot]
0d3342debf build(deps-dev): bump @xmldom/xmldom from 0.8.11 to 0.8.12 in the npm_and_yarn group across 1 directory (#50824)
build(deps-dev): bump @xmldom/xmldom

Bumps the npm_and_yarn group with 1 update in the / directory: [@xmldom/xmldom](https://github.com/xmldom/xmldom).


Updates `@xmldom/xmldom` from 0.8.11 to 0.8.12
- [Release notes](https://github.com/xmldom/xmldom/releases)
- [Changelog](https://github.com/xmldom/xmldom/blob/master/CHANGELOG.md)
- [Commits](https://github.com/xmldom/xmldom/compare/0.8.11...0.8.12)

---
updated-dependencies:
- dependency-name: "@xmldom/xmldom"
  dependency-version: 0.8.12
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-09 09:54:13 +02:00
Calvin
157cdac4b9 test: use shared get_out_dir() in generate_node_headers.py (#50828)
The local get_out_dir() defaulted to 'Testing' instead of 'Default',
causing e test to fail when using a non-Testing build config. Replace
it with the canonical version from script/lib/util.py.
2026-04-09 09:52:14 +02:00
Shelley Vohr
4dfada86ce fix: menu items not cleaned up after rebuild (#50806)
Menu was holding a SelfKeepAlive to itself from construction, so any
Menu that was never opened (e.g. an application menu replaced before
being shown) stayed pinned in cppgc forever. Repeated calls to
Menu.setApplicationMenu leaked every prior Menu along with its model
and items.

Restore the original Pin/Unpin lifecycle: start keep_alive_ empty and
only assign `this` in OnMenuWillShow. OnMenuWillClose already clears
it.
2026-04-09 11:56:39 +09:00
Kanishk Ranjan
df81a1d4ac test: add desktopCapturer icon validation (#50261)
* chore: testing of desktopCapturer can run on arm

* fix: DesktopMediaListCaptureThread crash

Fixed a crash when Windows calls ::CoCreateInstance() in the
DesktopMediaListCaptureThread before COM is initialized.

* test: added test for desktopCapturer fetchWindowIcons

* chore: updating Chromium patch hash

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-04-08 14:56:27 -04:00
Shelley Vohr
c3e3958668 fix: devtools re-attaches on open when previously detached (#50807)
PR #50646 added a dock state allowlist in SetDockState() that collapsed any
non-matching value to "right". WebContents::OpenDevTools passes an empty
string when no `mode` option is given, which is the sentinel LoadCompleted()
uses to restore `currentDockState` from prefs. The allowlist clobbered that
sentinel to "right", so previously-undocked devtools would flash detached
and then snap back to the right dock.

Preserve the empty string through SetDockState() so the pref-restore path
runs; still reject any non-empty invalid value to keep the JS-injection
guard from #50646 intact.
2026-04-08 13:36:47 -04:00
electron-roller[bot]
afd5fb4a60 chore: bump chromium to 148.0.7778.0 (main) (#50769)
* chore: bump chromium in DEPS to 148.0.7776.0

* chore: bump chromium in DEPS to 148.0.7778.0

* fix(patch): buffered_data_source_host_impl include added upstream

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7712714

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch): ASan process info callback added upstream

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7724018

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch): ServiceProcessHost per-instance observer migration

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7700794

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch): FSA BlockPath factory method refactor

Upstream refactored BlockPath initialization to use factory methods
(CreateRelative, CreateAbsolute, CreateSuffix) and a switch statement.
Updated the exposed code in the header to match.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7665590

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch): service process tracker per-instance observer refactor

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7700794

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patches (trivial only)

* 7723958: Rename blink::WebString::FromUTF16() to FromUtf16()

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7723958

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fixup! fix(patch): ASan process info callback added upstream

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
2026-04-08 13:34:24 -04:00
Charles Kerr
8679522922 chore: iwyu commonly-included headers in shell/ (#50778)
* chore: iwyu in shell/browser/api/electron_api_web_contents.h

* chore: iwyu in shell/browser/browser.h

* chore: iwyu in shell/browser/javascript_environment.h

* chore: iwyu in shell/common/gin_hhelper/function_template.h

* chore: do not include node_includes.h if we are not using it

* chore: fix transitive include
2026-04-08 09:33:42 -05:00
David Sanders
0828de3ccd ci: include .obj checksums when calculating object change rate (#50772) 2026-04-08 14:57:40 +02:00
Michaela Laurencin
6b5a4ff66c ci: allow ai-pr label without comment (#50792) 2026-04-08 13:09:23 +02:00
Charles Kerr
ca28023d4d chore: remove unused enum classes (#50782)
chore: remove unused FileSystemAccessPermissionContext::Access enum class

chore: remove unused FileSystemAccessPermissionContext::RequestType enum class

declared in 344aba08 but never used
2026-04-08 09:41:38 +02:00
Samuel Attard
e60441ad60 build: update build-tools to latest (#50786) 2026-04-08 09:31:12 +02:00
Charles Kerr
a189425373 fix: dangling raw_ptr api::Session::browser_context_ (#50784)
* fix: dangling raw_ptr api::Session::browser_context_

* fix: address code review feedback
2026-04-08 15:04:29 +09:00
Charles Kerr
7eccea1315 refactor: remove use of deprecated class base::MemoryPressureListener (#50763) 2026-04-07 20:11:02 -05:00
Shelley Vohr
2e74ad2c68 feat: add setSuspended and isSuspended to globalShortcut (#50425)
Adds the ability to temporarily suspend and resume global shortcut
handling via `globalShortcut.setSuspended()` and query the current
state via `globalShortcut.isSuspended()`. When suspended, registered
shortcuts stop listening and new registrations are rejected. When
resumed, previously registered shortcuts are automatically restored.
2026-04-07 15:21:43 +02:00
dependabot[bot]
9ba299afff build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.1 (#50759)
Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.2 to 22.0.1.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.2...v22.0.1)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-07 12:52:52 +02:00
Charles Kerr
6df2228ea0 refactor: remove more unused menu api (#50661)
* chore: do not expose menu.isItemCheckedAt() to JS

Not used, documented, or typed. Added in dae98fa43f.

* chore: do not expose menu.isEnabledAt() to JS

Nto used, documented, or typed. Added in dae98fa43f.

* chore: do not expose menu.isVisibleAt() to JS

Not used, documented, or typed. Added in dae98fa43f.

* chore: remove unused undocumented API `getOjectHash`

Not used, documented, or typed. Added in ddad3e4846.

Appears to never have been used.
2026-04-07 10:05:12 +02:00
Charles Kerr
a29674e4cf fix: dangling raw_ptr JavascriptEnvironment::isolate_ (#50738) 2026-04-07 10:03:11 +02:00
David Sanders
81dd0f42e1 ci: don't set needs review status on PR that isn't open (#50762) 2026-04-06 23:12:53 -07:00
electron-roller[bot]
6aaf490aa5 chore: bump chromium to 148.0.7768.0 (main) (#50599)
* chore: bump chromium in DEPS to 148.0.7765.0

* chore: bump chromium in DEPS to 148.0.7766.0

* fix(patch-conflict): update packed_resources dep name after upstream rename

Upstream renamed //chrome:packed_resources_integrity_header to
//chrome:packed_resources. Updated the patch to guard the new dependency
name with !is_electron_build while preserving the same intent.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7714543

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-conflict): update code_cache_host_impl.cc for upstream includes and TODO

Upstream added #include <stdint.h> and a TODO comment in
code_cache_host_impl.cc which conflicted with the Electron code cache
custom schemes patch. Resolved by keeping both upstream additions and
the Electron ProcessLockURLIsCodeCacheScheme function.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7615151

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* 7700837: update RecordContentToVisibleTimeRequest from mojom to native struct

Upstream typemapped RecordContentToVisibleTimeRequest from a Mojo
struct to a native C++ struct. Updated OSR virtual method signatures
from blink::mojom::RecordContentToVisibleTimeRequestPtr to
std::optional<blink::RecordContentToVisibleTimeRequest> and
blink::RecordContentToVisibleTimeRequest to match.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7700837

Co-Authored-By: Claude <noreply@anthropic.com>

* 7714579: update WebString::FromASCII to FromUTF8

Upstream renamed blink::WebString::FromASCII to FromAscii. Updated
Electron's usage to FromUTF8 which is equivalent for ASCII scheme
strings and avoids a dependency on the renamed method. Also fixed
blink::String::FromUTF8 to use the String constructor directly.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7714579

Co-Authored-By: Claude <noreply@anthropic.com>

* 7696480: add stream_info dep after StreamInfo extraction

Upstream extracted extensions::StreamInfo from PdfViewerStreamManager
to a standalone class in extensions/browser/mime_handler/stream_info.h.
Added the new target as a dependency since Electron's streams_private
and pdf_viewer_private APIs use PdfViewerStreamManager which now
depends on the separate StreamInfo target.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7696480

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: bump chromium in DEPS to 148.0.7768.0

* fix(patch-conflict): update PiP patch for new toggle_mute_button in overlay window

Upstream added a toggle_mute_button to the live caption dialog controls
in VideoOverlayWindowViews::SetLiveCaptionDialogVisibility. Extended the
existing #if 0 guard to include the new button handling since Electron
disables live caption dialog functionality.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7682308

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-conflict): update packed_resource_integrity patch after upstream dep removal

Upstream removed the deps += [ "//chrome:packed_resources" ] line from
the if (!is_win) block in chrome/browser/BUILD.gn. The Electron patch
no longer needs to guard this dep with !is_electron_build in this
location since the dep was already relocated by an earlier upstream CL.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7714543

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-conflict): update WebSocket throttling revert for DisconnectWebSocketOnBFCache guard

Upstream added a DisconnectWebSocketOnBFCacheEnabled() runtime feature
check that wraps the WebSocket BFCache feature registration. Updated the
Electron revert patch to place the kAllowAggressiveThrottlingWithWebSocket
ternary inside the new conditional guard.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7698838

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-conflict): update SCContentSharingPicker patch for upstream native picker refactor

Upstream added is_native_picker and filter_ based native picker session
validation to ScreenCaptureKitDeviceMac. Electron's patch uses its own
native picker approach (active_streams_ counter + direct SCContentSharingPicker
API), so marked the new upstream parameters as [[maybe_unused]] and kept
Electron's implementation.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7713560

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* 7708800: update StartDragging signature to use RenderFrameHost

Upstream refactored StartDragging to take a RenderFrameHost& instead of
separate source_origin and source_rwh parameters. Updated
OffScreenWebContentsView to match the new signature and derive the
RenderWidgetHostImpl from the RenderFrameHost internally.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7708800

Co-Authored-By: Claude <noreply@anthropic.com>

* 7682308: add toggle_mute_button to chromium_src build sources

Upstream added a ToggleMuteButton to the PiP overlay window controls.
Added the new toggle_mute_button.cc/h source files to Electron's
chromium_src/BUILD.gn to resolve linker errors.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7682308

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patches after main rebase

* fixup! 7708800: update StartDragging signature to use RenderFrameHost

fix linting

* 7705541: [trap-handler] Track individual Wasm memories | https://chromium-review.googlesource.com/c/v8/v8/+/7705541

Moved the SetUpWebAssemblyTrapHandler() call to before the V8 isolate is created

* fixup! fix utility process tests

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-04-06 20:38:46 -07:00
Samuel Attard
b8f25c4ced fix: resolve target bundle path once at start of install (#50745)
Resolve the Squirrel.Mac target bundle URL to a canonical path once at the
top of -[SQRLInstaller installRequest:] and use it for every step of the
install chain, rejecting requests whose path is not already canonical. When
running with elevated privileges, additionally require the target to be the
application bundle that contains the installer. SQRLUpdater now writes the
resolved bundle URL so the serialized request is canonical by construction.
2026-04-06 22:10:52 -04:00
Samuel Attard
9fafc81e88 ci: use hermetic mac SDK for the release ffmpeg build (#50746)
* ci: use hermetic mac SDK for the release ffmpeg build

gn gen out/ffmpeg runs as a raw gn invocation, so it never receives the
mac_sdk_path arg that e build injects for out/Default. On macOS runners
that means out/Default builds against the hermetic build-tools SDK while
out/ffmpeg falls through to the runner's system Xcode SDK. Reuse the
value e build already wrote so both builds share the same sysroot.

* ci: copy hermetic SDK symlink into out/ffmpeg and rewrite path

mac_sdk_path must live under root_build_dir, so pointing out/ffmpeg at
//out/Default/... doesn't work. Copy the xcode_links symlink tree into
out/ffmpeg and rewrite the path. Gate on Darwin so Windows/Linux don't
run the sed/cp at all.
2026-04-06 18:26:38 -04:00
Mitchell Cohen
4d05010945 fix: enforce size constraints on window creation on Windows and Linux (#49906)
* enforce size constraints on window creation

* set constraints after resizing on init

* restore conditional centering
2026-04-06 16:38:23 -04:00
LiRongWan
c3189e9886 docs: link menu type references (#50414)
* docs: link menu type references

* docs: trigger CI re-run for signed commits verification
2026-04-06 16:36:06 -04:00
Samuel Attard
983ebdd6de ci: make src-cache upload atomic (#50743)
ci: make src-cache upload atomic and sweep orphaned temp files

The checkout action's cp of the ~6GB zstd archive directly to the final
path on the cache share is non-atomic; an interrupted copy or a
concurrent reader produces zstd "Read error (39): premature end" on
restore, and the truncated file then satisfies the existence check so
no later run repairs it.

Upload to a run-unique *.tar.upload-<run_id>-<attempt> temp name on the
share and mv to the final path, discarding our temp if a concurrent run
got there first. A new clean-orphaned-cache-uploads workflow removes
temp files older than 4h every 4 hours.
2026-04-06 16:04:49 -04:00
dependabot[bot]
b9c08ef9c2 build(deps): bump @electron/get from 2.0.3 to 4.0.3 in /npm (#50553)
Bumps [@electron/get](https://github.com/electron/get) from 2.0.3 to 4.0.3.
- [Release notes](https://github.com/electron/get/releases)
- [Commits](https://github.com/electron/get/compare/v2.0.3...v4.0.3)

---
updated-dependencies:
- dependency-name: "@electron/get"
  dependency-version: 4.0.3
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-04-06 10:32:35 -07:00
Samuel Attard
9f3cc9122c build: derive patches upstream-head ref from script path (#50727)
* build: derive patches upstream-head ref from script path

gclient-new-workdir.py symlinks each repo's .git/refs back to the source
checkout, so the fixed refs/patches/upstream-head was shared across all
worktrees. Parallel `e sync` runs in different worktrees clobbered each
other's upstream-head, breaking `e patches` and check-patch-diff.

Suffix the ref with an md5 of the script directory so each worktree writes
a distinct ref into the shared refs dir. Fall back to the legacy ref name
in guess_base_commit so existing checkouts keep working until next sync.

* fixup: also write legacy upstream-head ref and note it in docs
2026-04-06 09:42:08 -07:00
John Kleinschmidt
e66e4ca02c ci: use github mirror to get lint dependency versions (#50733) 2026-04-06 09:14:01 -07:00
Samuel Attard
6ed3198ba8 build: migrate from eslint to oxlint (#50691)
Consolidates the root .eslintrc.json and five nested configs (build,
script, docs, default_app, spec) into a single .oxlintrc.json at the
repo root. script/lint.js now shells out to the oxlint binary from
node_modules/.bin instead of using the ESLint Node API, and emits
GitHub Actions annotations directly via --format=github in CI
(replacing the deleted eslint-stylish problem matcher).

Oxlint has no markdown processor, so the ESLint-based lint of JS code
blocks in docs/**/*.md is replaced with an inline regex check for bare
Node.js builtin imports. This preserves the rule docs/.eslintrc.json
was originally added for in #42113; the rest of the standard ruleset on
docs code blocks was already being enforced in parallel by
lint-roller-markdown-standard.
2026-04-06 09:05:13 -07:00
Samuel Attard
903e65e048 ci: fetch clang-tidy package in fix-sync (#50704)
fix-sync re-downloads llvm-build on macOS/Windows with the base clang
and objdump packages, but not clang-tidy. A local gclient sync pulls
clang-tidy (checkout_clang_tidy=True in DEPS), so CI's llvm-build tree
diverges from a local one. siso hashes the toolchain as action input,
so cache-only local runs against the CI-populated RBE cache miss.
2026-04-05 22:31:30 -07:00
Samuel Attard
fef2fd2941 ci: zstd-compress the src cache and drop the doubled win_toolchain (#50702)
* ci: shrink src cache and fix Windows tar cleanup

- Exclude platform-specific toolchains (llvm-build, rust-toolchain) from
  the src cache; all platforms now fetch them via fix-sync post-restore
- Exclude unused test data and benchmarks: blink/web_tests, jetstream,
  speedometer, catapult/tracing/test_data, swiftshader/tests/regres
- Fix Windows restore leaving the tarball on disk after extraction
  ($src_cache was scoped to the previous PowerShell step)
- Bump src-cache key v1 -> v2

* ci: fetch llvm/rust toolchains in gn-check and clang-tidy

These workflows restore the src cache but don't run fix-sync. Now that
llvm-build and rust-toolchain are excluded from the cache, they need to
download them directly — gn gen read_file()s both, and clang-tidy runs
the binary from llvm-build.

* ci: fetch clang-tidy package explicitly

update.py's default 'clang' package doesn't include the clang-tidy
binary; it ships as a separate package.

* ci: preserve blink/web_tests/BUILD.gn when stripping test data

//BUILD.gn references //third_party/blink/web_tests:wpt_tests as a
target label, so the BUILD.gn must exist for gn gen. The data = [...]
entries it declares are runtime-only and not existence-checked at gen
time, so the actual test directories can still be removed.

* ci: compress src cache with zstd and drop gclient sync -vv

The src cache was an uncompressed tar (~16GB after exclusions). Switch
to zstd -T0 --long=30 for ~4x smaller transfer and multi-threaded
compression. Decompress on restore:
- Linux/macOS: zstd -d -c | tar -xf -
- Windows: zstd -d to an intermediate .tar, then the existing 7z
  -snld20 extraction (preserves symlink handling)

All filename references updated .tar -> .tar.zst. -f added to the two
-o invocations so re-runs overwrite instead of failing.

Also drop -vv from gclient sync; default verbosity is sufficient.

* ci: keep .tar extension for src cache (zstd content inside)

The sas-sidecar that issues Azure SAS tokens validates filenames against
/^v[0-9]+-[a-z\-]+-[a-f0-9]+\.(tar|tgz)$/ and is not easily redeployed,
so keep the .tar extension and decode zstd on restore. Windows
decompresses to a distinct intermediate (src_cache.tar) so input and
output don't collide.

* ci: log NTFS 8.3/lastaccess/Defender state before Windows cache extract

Temporary diagnostics to see whether 8.3 short-name generation is the
cause of the ~20 min tar extraction.

* ci: revert src-cache exclusion additions

The new exclusions (web_tests contents, jetstream, speedometer,
catapult test_data, regres, llvm-build, rust-toolchain) caused siso/RBE
cache misses — even data-only deps are part of action input hashes.
Revert to the original exclusion list and drop the corresponding
toolchain-fetch plumbing. zstd compression, the Windows tar cleanup,
and the -vv removal remain.

* ci: drop win_toolchain from src cache; remove NTFS diagnostics

The Windows src cache includes 14.6GB of depot_tools/win_toolchain —
7.3GB of MSVC/SDK doubled because tar captures both the vs_files.ciopfs
backing store and the live ciopfs mount at vs_files/. Every Windows
cache consumer already re-fetches this via vs_toolchain.py update
--force (fix-sync for build/publish, inline for gn-check/clang-tidy),
so the cached copy is never used.

Diagnostics removed — CI confirmed 8dot3, last-access, and Defender are
all already off on the AKS Windows nodes.

* ci: unmount ciopfs vs_files before removing win_toolchain

vs_files is a live ciopfs mount during the win-targeted checkout; rm -rf
fails with EBUSY until it's unmounted.

* ci: skip win_toolchain download during checkout instead of removing after

fusermount isn't on the checkout container, so the ciopfs mount can't be
torn down before rm. Setting DEPOT_TOOLS_WIN_TOOLCHAIN=0 makes the
win_toolchain hook a no-op (vs_toolchain.py:525-527), so there's no
download and no mount. All Windows consumers re-fetch it post-restore
anyway. The rm -rf stays as a safety net.

* ci: also set ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=0 for checkout sync

build.yml sets ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=1 at the job level for
the Windows checkout, which makes e d inject DEPOT_TOOLS_WIN_TOOLCHAIN=1
and override the inline =0. Need both: the ELECTRON_ var stops e d from
overriding, the plain one stops vs_toolchain.py from defaulting to 1.

* ci: extract Windows src cache with piped tar instead of 7z

7z takes ~20 min to extract the ~1.1M-entry tar regardless of size —
~1ms per entry of header parsing and path handling, single-threaded,
well under the 75k IOPS / 1000 MBps the ephemeral disk can do. Switch
to the same zstd -d | tar -xf - pipe used on Linux/macOS (via Git Bash
tar). No intermediate src_cache.tar, download deleted after extract.

The -snld20 flag was working around 7z's own "dangerous symlink"
refusal; GNU tar extracts symlinks as-is so it shouldn't be needed.

* ci: keep depot_tools/win_toolchain scripts in src cache

The rm -rf removed get_toolchain_if_necessary.py (a depot_tools source
file), breaking vs_toolchain.py update --force on restore.
DEPOT_TOOLS_WIN_TOOLCHAIN=0 on the sync already prevents the vs_files
download, so the rm was only removing scripts.

* ci: split src cache into 4 parallel-extractable shards

Windows tar extraction is ~1ms/entry for ~1.2M entries (~20 min)
regardless of tool, well under the 75k IOPS / 1000 MBps the D16lds_v5
ephemeral disk can do. Tar is a sequential stream so the only way to
parallelize is to split at creation time.

Shards (balanced by entry count, ~220-360k each):
  a: src/third_party/blink
  b: src/third_party/{dawn,electron_node,tflite,devtools-frontend}
  c: src/third_party (rest)
  d: src (excluding third_party)

DEPSHASH is now the raw hash; shard files are
v2-src-cache-shard-{a..d}-${DEPSHASH}.tar (all pass the sas-sidecar
filename regex). sas-token is now a JSON keyed by shard letter. All
restore paths extract the four shards in parallel with per-PID wait so
a failed shard aborts the step.

* Revert "ci: split src cache into 4 parallel-extractable shards"

This reverts commit 970574998b.
2026-04-05 17:56:03 -07:00
Charles Kerr
4d8fd31e5f refactor: replace calls to NotifyAccessibilityEventDeprecated() (#50662) 2026-04-05 10:41:57 -05:00
Charles Kerr
96486a4102 refactor: remove raw_ptr<content::StoragePartition> from ServiceWorkerContext and ServiceWorkerKey (#50663)
This removes two `raw_ptr<context::StoragePartition>` instances.

These pointers were used to build a ServiceWorkerMain* lookup key.
The key was built from [version_id, raw_ptr<StoragePartition>].
Unfortunately these keys could be dangling on shutdown.

This PR now uses stable, immutable fields for building the key:
[version_id, BrowserContext::UniqueId(), context::StoragePartitionConfig].
context::StoragePartitionConfig is a unique lookup key for StoragePartition
within a BrowserContext.
2026-04-05 10:41:35 -05:00
Samuel Attard
3f8238b92c fix: defer Wrappable destruction in SecondWeakCallback to a posted task (#50688)
V8's second-pass weak callbacks run inside a
DisallowJavascriptExecutionScope: they may touch the V8 API but must
not invoke JS, directly or indirectly. Several Electron Wrappables
(WebContents in particular) emit JS events from their destructors,
so deleting synchronously inside SecondWeakCallback can crash with
"Invoke in DisallowJavascriptExecutionScope" when GC happens to
collect the JS wrapper during a foreground GC task — typically during
shutdown's uv_run drain after a leaked WebContentsView.

This was previously latent and timing-dependent (electron/electron#47420,
electron/electron#45416, podman-desktop/podman-desktop#12409). The
esbuild migration's keepNames option (which wraps every function/class
with an Object.defineProperty call) shifted heap layout enough to make
the spec/fixtures/crash-cases/webcontentsview-create-leak-exit case
reliably reproduce it on every run, giving a clean signal for the fix.

Both WrappableBase and DeprecatedWrappableBase SecondWeakCallback now
post the deletion via base::SequencedTaskRunner::GetCurrentDefault()
so the destructor (and any Emit it does) runs once V8 has left the GC
scope. Falls back to synchronous deletion if no task runner is
available (early/late process lifetime).

Fixes electron/electron#47420.
2026-04-05 07:38:08 +00:00
Charles Kerr
64c5440eec fix: dangling raw_ptr MicrotasksRunner::isolate_ (#50676) 2026-04-04 23:03:14 -05:00
Samuel Attard
30cf60a935 fix: propagate requesting frame through sync permission checks (#50679)
WebContentsPermissionHelper::CheckPermission was hardcoding
GetPrimaryMainFrame() and deriving the requesting origin from
web_contents_->GetLastCommittedURL(), so the setPermissionCheckHandler
callback always received the top frame's origin and
details.isMainFrame/details.requestingUrl always reflected the main
frame, even when a cross-origin subframe with allow="serial" or
allow="camera; microphone" triggered the check.

Thread the requesting RenderFrameHost through CheckPermission,
CheckSerialAccessPermission, and CheckMediaAccessPermission so the
permission manager receives the real requesting frame. Update the
serial delegate and WebContents::CheckMediaAccessPermission callers to
pass the frame they already have.

Adds a regression test that loads a cross-origin iframe with
allow="camera; microphone", calls enumerateDevices() from within the
iframe, and asserts the permission check handler receives the iframe
origin for requestingOrigin, isMainFrame, and requestingUrl.
2026-04-04 15:59:25 -07:00
Charles Kerr
ec30e4cdae refactor: remove unused field ServiceWorkerMain.start_worker_promise_ (#50674)
added in a467d068 but never used.
2026-04-04 14:22:48 -05:00
Samuel Attard
40033db422 chore: resolve dependabot security alerts (#50680) 2026-04-04 11:56:48 -07:00
Samuel Attard
c3d441cf7d ci: add Datadog metrics to clean-src-cache job (#50642)
* ci: add Datadog metrics to clean-src-cache job

Report free space (before/after cleanup), space freed, and total space
for both cross-instance-cache and win-cache volumes to Datadog, matching
the pattern used in the macOS disk cleanup workflow.

https://claude.ai/code/session_013bpDsZLrFDpWMiARNFH4z9

* ci: use awk instead of bc, add workflow_dispatch trigger

- Replace bc with awk for KB-to-GB conversion since bc may not be
  available in the container image
- Add workflow_dispatch trigger for manual testing

https://claude.ai/code/session_013bpDsZLrFDpWMiARNFH4z9

* ci: remove workflow_dispatch, handled in another PR

https://claude.ai/code/session_013bpDsZLrFDpWMiARNFH4z9

* ci: move DD_API_KEY to job-level env for if-condition

The step-level env is not available when GitHub evaluates the step's
if expression, so env.DD_API_KEY was always empty. Move it to
job-level env so the conditional works correctly.

https://claude.ai/code/session_013bpDsZLrFDpWMiARNFH4z9

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-04-03 22:17:29 -07:00
Charles Kerr
14583d22e6 refactor: remove use of deprecated API base::GetProc() (#50650)
* refactor: replace deprecated API base::GetProcId() in web_frame_main

* refactor: replace deprecated API base::GetProcId() in web_contents

* refactor: replace deprecated API base::GetProcId() in a11y ui

* refactor: frame.osProcessId now returns 0 instead of -1 for invalid processes.

This is consistent with WebContents.getOSProcessId
2026-04-03 15:48:41 -05:00
Charles Kerr
68bfe49120 refactor: remove never-used JS API (#50649)
* chore: do not expose v8Util.getObjectHash() to JS

Not used, documented, or typed. Added in ddad3e4846.

* chore: do not expose DownloadItem.isDone() to JS

Not used, documented, or typed. Added in dcad25c98c.

* chore: do not expose BrowserWindow.isWebViewFocused() to JS

Not used, documented, or typed. Added in a949e9542d.
2026-04-03 13:04:27 -05:00
Kunal Dubey
2c6332a7d6 fix: resolve getFileHandle concurrent stalling by queuing callbacks (#50597)
Previously, concurrent calls to FileSystemAccessPermissionContext::ConfirmSensitiveEntryAccess
for the same file path would silently discard the subsequent callbacks because
the internal callback map used a single callback per file path and std::map::try_emplace
would drop the callback if the key already existed. This caused Promises in JS
(e.g., dirHandle.getFileHandle()) to stall indefinitely.

This commit updates the callback map to hold a vector of callbacks, so all
concurrent requesters for the same filepath are grouped together and resolved
once the asynchronous blocklist check completes.

Notes: Fixed an issue where concurrent `getFileHandle` requests on the same path could stall indefinitely.
2026-04-03 18:04:55 +02:00
Bohdan Tkachenko
ddc1bd9553 fix: forward activation token from libnotify on notification click (#50568)
* feat: forward activation token from libnotify notification clicks

When a notification action is clicked on Linux, retrieve the activation
token from libnotify (if available) via dlsym and set it using
`base::nix::SetActivationToken()`. This enables proper window focus
handling under Wayland, where the compositor requires a valid activation
token to grant focus to the application.

The `notify_notification_get_activation_token` symbol is resolved at
runtime to maintain compatibility with older libnotify versions that
do not expose this API.

* refactor: simplify libnotify soname loading and activation token lookup

Replace the chained Load() calls with a loop over a constexpr array of
sonames, and inline the lazy EnsureActivationTokenFunc() into
Initialize() since it is only called once and the library handle is
already known at that point.
2026-04-03 10:40:36 -05:00
Shelley Vohr
12109371d3 fix: validate dock_state_ against allowlist before JS execution (#50646)
fix: validate dock_state_ against allowlist before JS execution

The dock_state_ member was concatenated directly into a JavaScript
string and executed via ExecuteJavaScript() in the DevTools context.

We should validate against the four known dock states and fall back
to "right" for any unrecognized value for safety
2026-04-03 10:39:16 -05:00
Charles Kerr
69891d04bf test: improve cookie changed event coverage (#50655)
test: add tests for cookie changed overwrite and inserted

test: add tests for cookie changed inserted-no-value-change-overwrite

test: add tests for cookie changed expired-overwrite
2026-04-03 10:26:17 -05:00
David Sanders
188813e206 ci: fix pulling previous object checksums (#50635)
* ci: fix pulling previous object checksums

* chore: fix artifact finding

* chore: skip unpack

* refactor: dawidd6/action-download-artifact can't handle non-archived artifacts

Assisted-by: Claude Opus 4.6

* refactor: use Octokit in standalone script

Assisted-by: Claude Opus 4.6
2026-04-03 04:52:50 +00:00
Charles Kerr
8b768b8211 chore: stop exposing unused menu methods to JS (#50634)
* chore: remove unused undocumented API `menu.worksWhenHiddenAt()`.

Not used, documented, or typed. Added by 544d8a423c.

* chore: remove unused undocumented API `menu.getCommandIdAt()

Not used, documented, or typed. Added by dae98fa43f.

* chore: do not expose `menu.getIndexOfCommandId()` to JS

Added by dae98fa43f but not documented, typed, or used by JS code.

The C++ method is used by other shell code, but not in JS.

* chore: remove unused undocumented API `menu.getLabelAt()`

Not used, documented, or typed. Added by dae98fa43f.

* chore: remove unused undocumented API `menu.getToolTipAt()`

Not used, documented, or typed. Added by 06d48514c6.

* chore: remove unused undocumented API `menu.getSubLabelAt()`

Not used, documented, or typed. Added by dae98fa43f.
2026-04-02 22:04:18 -05:00
Mitchell Cohen
82b97ddf5b ci: run BrowserWindow test spec on Wayland (#50572)
add browserwindow test spec for wayland
2026-04-02 17:19:23 -05:00
Charles Kerr
16f408a502 chore: remove declaration for nonexistent method WebContents._getPrintersAsync() (#50628)
chore: remove declaration for nonexistent method WebContents._getPrintersAsync()

added in 8f51d3e1 but never implemented / never used
2026-04-02 15:29:10 -05:00
Michaela Laurencin
246aa63910 ci: correct contributing link and add link to ai tool policy (#50632)
* ci: correct contributing link and add link to ai tool policy

* add missing bracket
2026-04-02 13:54:13 -05:00
Shelley Vohr
230f02faf2 fix: don't force kFitToPrintableArea scaling when custom margins are set (#50615)
When silent printing with non-default margins (custom, no margins, or
printable area margins), the kFitToPrintableArea scaling option causes
double-marginalization: the custom margins define the content area, then
the scaling additionally fits content to the printer's printable area.

Only apply kFitToPrintableArea when using default margins in silent mode.
For non-default margins, use the same scaling as non-silent prints.
2026-04-02 20:41:21 +02:00
Charles Kerr
1362d7b94d refactor: remove unused internal method WebContents.equal() (#50626)
refactor: remove unused internal method WebContents.equal()

last use removed in Feb 2021 @ 51bb0ad36d
2026-04-02 12:46:39 -05:00
Mitchell Cohen
877fe479b5 fix: glitchy rendering and maximize behavior with different GTK themes (#50550)
* fix glitchy rendering with different gtk themes especially when maximizing

* use actual insets, not restored insets
2026-04-02 09:52:27 -05:00
Shelley Vohr
f41438ff73 fix: prefill native print dialog options on macOS with OOP printing (#50600)
Chromium enabled out-of-process (OOP) printing by default on macOS in
https://chromium-review.googlesource.com/c/chromium/src/+/6032774. This
broke webContents.print() option prefilling (e.g. copies, collate,
duplex) in two ways:

1. ScriptedPrint() silently aborted because RegisterSystemPrintClient()
   was only called from GetDefaultPrintSettings(), but Electron's flow
   calls UpdatePrintSettings() instead when options are provided.

2. PrinterQueryOop::UpdatePrintSettings() sends settings to the remote
   PrintBackend service, but on macOS the native dialog runs in-browser
   using the local PrintingContextMac::print_info_, which was never
   updated with the user's requested settings.

Fix by registering the system print client in UpdatePrintSettings() and
applying cached settings to the local printing context before showing
the in-browser system print dialog.
2026-04-02 16:06:35 +02:00
Shelley Vohr
c6e201c965 build: allow clearing src & cross mnt cache via dispatch (#50638) 2026-04-02 10:01:08 +00:00
Niklas Wenzel
156a4e610c fix: extension service workers not starting beyond first app launch (#50611)
* fix: extension service worker not starting beyond first app launch

* fix: set preference only for extensions with service workers
2026-04-02 10:02:06 +02:00
Charles Kerr
81f8fc1880 refactor: remove unused internal method contents.canGoToIndex() (#50606)
refactor: remove unused internal method contents.canGoToIndex()

refactor: make WebContents::CanGoToIndex() private

The JS binding has been unused since 2021-04-27 #28839 0a1b26b1
2026-04-01 22:37:41 +02:00
Charles Kerr
343d6e5f3f test: add tests for navigationHistory.goToIndex() (#50607)
test: add tests for navigationHistory.goToIndex()
2026-04-01 22:37:19 +02:00
Asish Kumar
e7080835f1 docs: add destroy method to native addon tutorials to prevent hang on quit (#50561)
Native addons that hold persistent references to callbacks, emitters,
and threadsafe functions prevent Electron from quitting cleanly since
Electron 40.5.0 due to changes in Node.js shutdown behavior. This adds
a `destroy()` method to all four native code tutorials (Swift macOS,
Obj-C macOS, C++ Linux, C++ Win32) that releases these resources and
must be called before app quit.

The destroy method resets callback and emitter references and aborts the
threadsafe function, allowing the addon's destructor to run properly.
An [!IMPORTANT] note is added to each tutorial's JavaScript wrapper
section explaining when and why to call destroy().

Fixes #50457

Signed-off-by: Asish Kumar <officialasishkumar@gmail.com>
2026-04-01 13:13:09 -05:00
LiRongWan
7c1a6f7e95 docs: recommend subdirectory for userData to avoid Chromium conflicts (#50563)
Fixes #45414

Storing files directly in the userData root can cause naming conflicts
with Chromium's own subdirectories (Cache, GPUCache, Local Storage, etc.).
Added a recommendation to use a subdirectory such as
path.join(app.getPath('userData'), 'my-app-data') instead.

Notes: no-notes
2026-04-01 09:54:08 -05:00
Calvin
22ac2b13fb fix: remove menu update debug log (#50608) 2026-04-01 17:06:26 +09:00
Samuel Attard
a8acb96608 build: replace npx with lockfile-pinned binaries (#50598)
* build: replace npx with lockfile-pinned binaries

- nan-spec-runner: reorder yarn install first, invoke nan node-gyp bin directly
- publish-to-npm: use host npm with E404 try/catch (closes existing TODO)
- upload-symbols: add @sentry/cli devDep, invoke from node_modules/.bin
- remove script/lib/npx.py (dead since #48243)

* build: bump @sentry/cli to 1.70.0 for arm support

* build: bump @sentry/cli to 1.72.0, skip CDN download on test jobs

@sentry/cli fetches its platform binary from Sentry CDN at postinstall.
Only upload-symbols.py (release pipeline) needs the binary; set
SENTRYCLI_SKIP_DOWNLOAD=1 in the two test-segment workflows that
call install-dependencies. The 64k variant uses pre-built artifacts
and does not install deps.
2026-03-31 20:23:43 +00:00
Mitchell Cohen
97773bf50c fix: prevent borders and smearing in transparent frameless/client frame windows on Linux (#50541)
fix the appearance of transparent frameless and client frame windows
2026-03-31 11:24:10 -05:00
Shelley Vohr
1e0846749b fix: invoke print callback directly when no print job exists (#50431)
ShowInvalidPrinterSettingsError() called TerminatePrintJob(true),
but when no print_job_ had been created yet (e.g. settings validation
failed before a job could start), TerminatePrintJob bails out
immediately without reaching ReleasePrintJob() where the callback
is invoked. This left the CompletionCallback stuck in callback_
until WebContents destruction, causing webContents.print() to only
fire its callback when the application closed.
2026-03-31 11:01:59 -05:00
electron-roller[bot]
8cd766ff53 chore: bump chromium to 148.0.7763.0 (main) (#50582) 2026-03-31 10:16:35 +02:00
dependabot[bot]
e5b20a11d2 build(deps): bump github/codeql-action from 4.34.1 to 4.35.1 (#50590)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.34.1 to 4.35.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3869755554...c10b8064de)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.35.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-31 10:15:41 +02:00
Alexey
e0bd4ffc39 fix: add missing HandleScope in contentTracing.getTraceBufferUsage() (#50556)
The `OnTraceBufferUsageAvailable` callback creates V8 handles via
`Dictionary::CreateEmpty()` before `promise.Resolve()` enters its
`SettleScope` (which provides a `HandleScope`). When the callback
fires asynchronously from a Mojo response (i.e. when a trace session
is active), there is no `HandleScope` on the stack, causing a fatal
V8 error: "Cannot create a handle without a HandleScope".

Add an explicit `v8::HandleScope` at the top of the callback, matching
the pattern used by the other contentTracing APIs which resolve their
promises through `SettleScope` or the static `ResolvePromise` helper.

Made-with: Cursor
2026-03-31 10:21:43 +09:00
Samuel Attard
bbbcae1a12 fix: re-enable MacWebContentsOcclusion with embedder window fix (#50579)
* fix: re-enable MacWebContentsOcclusion with embedder window fix

Replace the full revert of Chromium's MacWebContentsOcclusion cleanup
with a targeted patch that handles embedder windows shown after
WebContentsViewCocoa attachment. This lets us drop the feature flag
disable in feature_list.cc and re-enable upstream occlusion tracking.

Adds tests for show/hide event counts on macOS and visibility tracking
across multiple child WebContentsViews.

* test: drop show/hide event count assertion

The assertion that 'show' fires exactly once per w.show() call is not
an API guarantee - macOS can send multiple occlusion state
notifications during a single show() when other windows are on screen
(common on CI after hundreds of prior tests). The
visibilitychange-count test in api-web-contents-view-spec.ts covers
the actual invariant we care about.

* fix: ignore WebContentsOcclusionCheckerMac synthetic notifications in window delegate

On macOS 13.3-25.x, Chromium's occlusion checker enables manual
frame-intersection detection and posts synthetic
NSWindowDidChangeOcclusionStateNotification tagged with its class name
in userInfo. These fire when the checker's NSContainsRect heuristic
decides a window is covered by another window's frame, but the real
-[NSWindow occlusionState] hasn't changed.

Our delegate was treating these the same as real macOS notifications
and emitting show/hide events based on occlusionState, which was
unchanged - resulting in spurious duplicate show events when e.g.
Quick Look opened and its frame intersected the BrowserWindow.
2026-03-30 14:13:00 -07:00
Samuel Attard
3e1666be08 chore: remove dead C++ code from shell/ (#50513)
Removes unreferenced code found via codebase sweep. Each category below may
indicate a missing feature rather than truly-unused code — see PR description.

Dead class (1):
  ElectronNavigationUIData — never instantiated; ElectronBrowserClient uses
  upstream ExtensionNavigationUIData directly

Unused methods (7):
  CertificateManagerModel: ImportUserCert, ImportCACerts, ImportServerCert,
    Delete, is_user_db_available (only PKCS12 path is used)
  AutofillDriverFactory::AddDriverForFrame + CreationCallback type
  ZoomLevelDelegate::SetDefaultZoomLevelPref
  gtk_util: GetOpenLabel, GetSaveLabel

Unused members (2):
  AutofillPopup::selected_index_
  InspectableWebContents::synced_setting_names_

Declaration fixes (6):
  menu_util.h: BuildMenuItemWithImage signature corrected (GtkWidget* → gfx::Image&)
  win_frame_view.h: GetReadableFeatureColor (impl removed, decl left behind)
  frameless_view.h: friend class NativeWindowsViews (typo, class does not exist)
  Forward decls: WebDialogHelper, ChromeContentRendererClient,
    ElectronNativeWindowObserver, ValueStoreFactory
2026-03-30 10:36:00 -07:00
electron-roller[bot]
a06b49aca1 chore: bump chromium to 148.0.7759.0 (main) (#50515)
* chore: bump chromium in DEPS to 148.0.7755.0

* chore: bump chromium in DEPS to 148.0.7756.0

* chore: update patches

* 7698536: Wire up experiment arms for Glic summarize pdf button.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7698536

* 7695602: Include gperf to sources for iOS builds

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7695602

* 7671200: Expose IgnoreDuplicateNavs in WebView

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7671200

* chore: bump chromium in DEPS to 148.0.7758.0

* chore: update patches

* 7701873: Allow running completion callbacks directly in CommitPresentedFrameToCA() on Mac

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7701873

* 7697732: Enhance diagnostic logging for ScreenCaptureKit errors on macOS

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7697732

* 7698176: Disallow cookies with empty name and ambiguous value

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7698176

* 7607319: Code Health: Use span in base::HexEncode

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7607319

* chore: bump chromium in DEPS to 148.0.7759.0

* chore: update patches

* 7696478: [extensions] Move StreamContainer to extensions/browser/mime_handler/

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7696478

* 7656748: Fixed controlled frame fullscreen crash

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7656748

* chore: update patches

* fixup! 7696478: [extensions] Move StreamContainer to extensions/browser/mime_handler/

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-30 10:32:35 -07:00
Keeley Hammond
d318893aa0 fix: fix devtools patch type error on release builds (#50551)
fix: fix devtools types
2026-03-27 22:40:51 +00:00
Keeley Hammond
f133e2f775 refactor: improve input handling in FilePath gin converter (#50540)
refactor: improve input handling in file_path_converter

Properly handle paths containing ASCII control characters in the FilePath gin converter
2026-03-27 14:30:58 -04:00
John Kleinschmidt
b44b9ba316 ci: update nick-fields/retry to v4.0.0 (#50521) 2026-03-27 13:44:06 -04:00
dependabot[bot]
d5e4429724 build(deps-dev): bump @datadog/datadog-ci from 4.1.2 to 5.9.1 (#50407)
Bumps [@datadog/datadog-ci](https://github.com/DataDog/datadog-ci/tree/HEAD/packages/datadog-ci) from 4.1.2 to 5.9.1.
- [Release notes](https://github.com/DataDog/datadog-ci/releases)
- [Commits](https://github.com/DataDog/datadog-ci/commits/v5.9.1/packages/datadog-ci)

---
updated-dependencies:
- dependency-name: "@datadog/datadog-ci"
  dependency-version: 5.9.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-27 13:29:15 -04:00
John Kleinschmidt
8f11366f50 ci: don't request review for PRs in draft or WIP (#50539) 2026-03-27 13:27:52 -04:00
electron-roller[bot]
0dabcfdec4 chore: bump node to v24.14.1 (main) (#50480)
* chore: bump node in DEPS to v24.14.1

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
2026-03-27 13:26:58 -04:00
Hichem
b4460a05da docs: Document known issue with dock.hide() method (#50476)
* Document known issue for dock.hide() method

Added a note about a known issue with dock.hide() method.

* Adjust workaround time for dock.hide() method

Updated workaround time for dock.hide() known issue.

* Fix known issue timing for dock.hide() workaround

Updated the workaround time in the known issue section for dock.hide() to 1000ms.

* Adjust workaround delay for dock.hide() method

Updated workaround time for dock.hide() known issue.
2026-03-27 10:00:04 -04:00
Niklas Wenzel
0a1ea1f028 docs: clarify allowed characters in protocol names (#50411) 2026-03-27 09:39:16 -04:00
Mitchell Cohen
b41ec6586a fix: correct linux zygote process titles (#50509)
* fix: correct linux zygote process titles

* pass argv on mac as well

* lint
2026-03-27 08:24:05 -04:00
Niklas Wenzel
4eff8f20f2 feat: make Chrome extensions work on custom protocols (#49951) 2026-03-26 20:00:51 -04:00
Shelley Vohr
8cb61e8b9b test: add interactive macOS dialog tests (#50363) 2026-03-26 17:06:03 -04:00
WofWca
b9731b89dc docs: update Notification support info (#50364)
This is a follow-up to
74fd10450f
(https://github.com/electron/electron/pull/48132).
The support for these has been added for Windows,
but not all documentation has been updated accordingly

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-26 17:04:34 -04:00
dependabot[bot]
d64e1146dd build(deps): bump actions/download-artifact from 7.0.0 to 8.0.1 (#50444)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 7.0.0 to 8.0.1.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](https://github.com/actions/download-artifact/compare/v7...3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 8.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-26 16:17:53 -04:00
Jan Hannemann
ae6b219545 fix: outdated execution path for COM activation (#50471)
* fix: outdated execution path

* fix: use stub exe when detected
2026-03-26 18:21:58 +00:00
electron-roller[bot]
c44d60cfe4 chore: bump chromium to 148.0.7751.0 (main) (#50427)
* chore: bump chromium in DEPS to 148.0.7749.0

* chore: bump chromium in DEPS to 148.0.7751.0

* chore: update patches

* 7681299: Introduce OccludedWidgetInputProtector to track always-on-top widgets

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7681299

* 7685453: chrome://accessibility: Don't AllowJavascript() in async calls

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7685453

* 7665878: Prefer browser runtime over Node.js in HostRuntime detection

Refs https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7665878

* 7674037: Rename the bookmark-related interfaces of the Clipboard class to URL.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7674037

* 7621713: Migrate ServiceWorker framework to ChildProcessId

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7621713

* 7680500: Migrate ServiceWorkerHost to ChildProcessId

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7680500

* chore: update roller commit message lint script to handle devtools CLs

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-26 10:18:24 -04:00
Samuel Attard
9928c7d828 chore: harden GitHub Actions against script injection patterns (#50512)
* fix: harden GitHub Actions against script injection vulnerabilities

Replace direct ${{ }} expression interpolation in run: blocks with
environment variables to prevent script injection attacks. Changes:

- archaeologist-dig.yml: move clone_url, head.sha, base.ref to env vars
- non-maintainer-dependency-change.yml: move user.login to env var
- issue-unlabeled.yml: move toJSON(labels) to env var
- issue-labeled.yml: move issue.number to env var
- pipeline-electron-lint.yml: validate chromium_revision format
- cipd-install/action.yml: move all inputs to env vars and quote them
- set-chromium-cookie/action.yml: reference secrets via $ENV_VAR
- Add security comments to all 5 pull_request_target workflows

https://claude.ai/code/session_01UUWmLxn5hyyxrhK8rGxU2s

* fix: allow version strings in chromium_revision validation

The previous regex `^[a-f0-9]+$` only matched git SHAs but
chromium_revision is a version string like `148.0.7741.0`.
Broaden to `^[a-zA-Z0-9._-]+$` which still blocks shell
metacharacters.

https://claude.ai/code/session_01UUWmLxn5hyyxrhK8rGxU2s

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-26 14:02:50 +00:00
David Sanders
f5bc6f7949 ci: fix variable name when downloading previous object checkusms (#50510) 2026-03-26 09:31:30 -04:00
Keeley Hammond
a839fb94aa fix: [a11y] fire AXMenuOpened event when ARIA menu is added to DOM (#50377)
* fix: fire AXMenuOpened event when a visible ARIA menu instance is added to the DOM

* fix: remove redundent FireMenuPopupEndForDeletedMenus

MENU_POPUP_END for deleted menus is already handled by
AXTreeManager::OnNodeWillBeDeleted, which
fires the event directly on the menu node before destruction.

* chore: add feature flag (kDynamicMenuPopupEvents)

* chore: update patches
2026-03-25 21:33:49 +00:00
Michaela Laurencin
2e2c56adde ci: add functionality for programmatic add/remove needs-signed-commits label (#50316)
* remove comment based label removal

* ci: add functionality for programmatic add/remove needs-signed-commits label

* add new line to pull-request-opened-synchronized
2026-03-25 15:38:44 -04:00
Samuel Attard
678adeaf7c fix: crash calling OSR shared texture release() after texture GC'd (#50473)
The weak persistent tracking the OffscreenReleaseHolderMonitor was tied
to the texture object, but the release() closure holds a raw pointer to
the monitor via its v8::External data. If JS retained texture.release
while dropping the texture itself, the monitor would be freed on GC and
a later release() call would crash.

Track the release function instead of the texture object. Since the
texture holds release as a property, this keeps the monitor alive as
long as either is reachable.
2026-03-25 10:48:41 -07:00
Samuel Attard
1d14694dec refactor: remove dead named-window lookup from guest-window-manager (#50474)
The frameNamesToWindow map was a holdover from the BrowserWindowProxy
IPC shim. Since nativeWindowOpen became the only code path, Blink's
FrameTree::FindOrCreateFrameForNavigation resolves named window targets
directly in the renderer, scoped to the opener's browsing context
group. When a matching named window exists, Blink navigates it without
ever sending a CreateNewWindow IPC to the browser, so this map was
never consulted in the legitimate same-opener case.

The only time the map found a match was when two unrelated renderers
happened to use the same target name, in which case openGuestWindow
would short-circuit before consuming the guest WebContents that
Chromium had already created for the new window, leaking it.

Adds a test verifying Blink handles same-opener named-target reuse
end-to-end without any browser-side tracking.
2026-03-25 10:48:30 -07:00
Samuel Attard
a48f03fb8d fix: crash in clipboard.readImage() on malformed image data (#50475)
gfx::PNGCodec::Decode() returns a null SkBitmap when it fails to decode
the clipboard contents as a PNG. Passing that null bitmap to
gfx::Image::CreateFrom1xBitmap() triggers a crash.

Return an empty gfx::Image instead, matching the existing null-check
pattern in skia_util.cc.
2026-03-25 10:47:00 -07:00
Shelley Vohr
f6b43cb0ef fix: fall back to default DPI when GTK returns 0 on Linux (#50453)
GetDefaultPrinterDPI() creates a blank GtkPrintSettings and reads
its resolution, which returns 0 for uninitialized settings. With
DPI=0, SetPrintableAreaIfValid() computes a zero scale factor,
producing empty page dimensions that fail PrintMsgPrintParamsIsValid().

Fall back to kDefaultPdfDpi (72) when GTK returns 0, matching the
existing Windows fallback pattern when CreateDC fails.
2026-03-25 12:37:40 -05:00
Shelley Vohr
7451d560ba fix: register PrintDialogLinuxFactory on Linux (#50430)
fix: register PrintDialogLinuxFactory on Linux

Chromium 145 refactored Linux print dialog creation to use a factory
pattern instead of directly calling LinuxUi::CreatePrintDialog().
Chrome registers this factory in
ChromeBrowserMainExtraPartsViewsLinux::ToolkitInitialized(), but
Electron did not, causing PrintingContextLinux::EnsurePrintDialog()
to leave print_dialog_ null on every call.

Without a dialog, UseDefaultSettings() and UpdatePrinterSettings()
return success but with empty/unprocessed settings, causing
PrintMsgPrintParamsIsValid() to fail. This broke both window.print()
(no dialog appears) and webContents.print() (callback stuck until
app close with "Invalid printer settings").
2026-03-25 12:37:03 -05:00
Damglador
27edd6e21c fix: pulseaudio stream and icon names (#49270)
Use platform_util::GetXdgAppId() with fallback to argv0 as PA_PROP_APPLICATION_ICON_NAME.
Use electron::GetPossiblyOverriddenApplicationName()
to set environment variable "ELECTRON_PA_APP_NAME" in audio_service.cc,
to use it in pulse_util.cc for setting input/output pa_context name.

This replaces hard-codded kBrowserDisplayName that was used for PA_PROP_APPLICATION_ICON_NAME,
and PRODUCT_STRING that was used for pa_context names.

This is done to make audio streams recognizable in tools like qpwgrapth and general audio managers,
instead of having 20 "Chromium" outputs and "Chromium input" inputs, that are actually coming from
completely different applications.
2026-03-25 12:25:44 -05:00
Shelley Vohr
ec3a18d438 fix: hex-encode Windows notification icon temp filenames (#50454)
* fix: hex-encode Windows notification icon temp filenames

NotificationPresenterWin was using SHA1HashString(origin.spec()) directly
as the basename for the temporary PNG written for toast icons.

SHA1HashString returns raw digest bytes, so the generated filename could
contain invalid path characters on Windows. That caused WriteFile to fail
when saving notification icons, which left toast XML without the expected
icon path.

Hex-encode the digest before appending .png so the temporary filename is
filesystem-safe while keeping deterministic naming for a given origin.

* Update shell/browser/notifications/win/notification_presenter_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2026-03-25 09:29:58 -07:00
Samuel Attard
02d4101ca3 chore: remove redundant chromium patches (#50463)
- export_gin_v8platform_pageallocator_for_usage_outside_of_the_gin.patch:
  gin::V8Platform::GetPageAllocator() is now exported upstream via the
  public v8::Platform interface, so we no longer need to patch gin to
  expose a custom accessor. Update javascript_environment.cc to use the
  upstream API instead.

- fix_getcursorscreenpoint_wrongly_returns_0_0.patch: this fix has
  landed upstream in Chromium and is no longer needed as a local patch.
2026-03-24 17:21:13 -07:00
Keeley Hammond
fdaba4c6b0 chore: add CODEOWNERS for .claude folder (#50434)
Add wg-infra as code owners for the .claude folder to protect
Claude Code configuration files from unauthorized modifications.

https://claude.ai/code/session_01YK2mEzC3DLrhqbcXW9jwUr

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-24 15:39:35 -07:00
Robo
542ff828ab refactor: SafeV8Function to be backed by cppgc (#50397)
* refactor: SafeV8Function to be backed by cppgc

* spec: focus renderer before attempting paste

* spec: remove listeners to prevent leak on failed tests
2026-03-24 16:59:32 -05:00
pranjal-ogg
4371a4dceb docs: add cold-start deep link handling example (#49142)
docs: handle cold-start deep links on Windows/Linux

add a check for `process.argv` in the `app.whenReady()` callback to handle deep links when the application is cold-started on Windows and Linux.
2026-03-24 13:28:53 -05:00
dependabot[bot]
60f4b07723 build(deps): bump actions-cool/issues-helper from 3.7.6 to 3.8.0 (#50446)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.6 to 3.8.0.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](71b62d7da7...200c78641d)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.8.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-24 13:28:30 -05:00
dependabot[bot]
f282bec8ef build(deps): bump github/codeql-action from 4.33.0 to 4.34.1 (#50447)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.33.0 to 4.34.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b1bff81932...3869755554)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.34.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-24 13:28:12 -05:00
dependabot[bot]
cef388de3d build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#50445)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](https://github.com/actions/github-script/compare/v7.0.1...ed597411d8f924073f98dfc5c65a23a2325f34cd)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-24 09:54:56 -05:00
Anirudh Sevugan
1828690467 fix: deprecate ELECTRON_SKIP_BINARY_DOWNLOAD env (#50406)
* fix: remove ELECTRON_SKIP_BINARY_DOWNLOAD

it is redundant as of electron v42
its purpose was to skip the binary download for post install script
but as of electron v42, post install script is gone
and replaced with a lazy download

it was also slated for removal in [this comment](https://github.com/electron/rfcs/pull/22#issuecomment-3387307743)

* docs: remove ELECTRON_SKIP_BINARY_DOWNLOAD section

the env is redundant as of electron v42
so docs don't have to mention it anymore

* docs: add ELECTRON_SKIP_BINARY_DOWNLOAD to breaking changes
2026-03-24 09:42:15 -04:00
David Sanders
f4c4cd14ac ci: upload object change stats to Datadog (#50390)
* ci: upload object change stats to Datadog

Assisted-by: Claude Opus 4.6

* ci: bump actions/upload-artifact version

* chore: only output new object count if non-zero

* chore: skip object change tracking on ASan builds

* chore: handle pull requests as well

* chore: always set chromium-version-changed

* chore: remove npx usage
2026-03-23 18:51:02 -07:00
dependabot[bot]
3db3996102 build(deps): bump dsanders11/project-actions from 1.7.0 to 2.0.0 (#50448)
Bumps [dsanders11/project-actions](https://github.com/dsanders11/project-actions) from 1.7.0 to 2.0.0.
- [Release notes](https://github.com/dsanders11/project-actions/releases)
- [Commits](2134fe7cc7...5767984408)

---
updated-dependencies:
- dependency-name: dsanders11/project-actions
  dependency-version: 2.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-23 21:42:24 -04:00
Samuel Attard
dbcf0fb5f0 fix: lazily initialize safeStorage async encryptor (#50419)
* fix: lazily initialize safeStorage async encryptor

The SafeStorage constructor previously registered a browser observer that
called os_crypt_async()->GetInstance() on app-ready. Because ESM named
imports (import { x } from 'electron') eagerly evaluate all electron
module getters, simply importing electron in an ESM entrypoint would
construct SafeStorage and touch the OS keychain on app-ready, even when
safeStorage was never used.

This showed up as a macOS CI hang: the esm-spec import-meta fixture
triggers a keychain access prompt that blocks the test runner until
timeout.

Now the async encryptor is requested lazily on the first call to
encryptStringAsync, decryptStringAsync, or isAsyncEncryptionAvailable.
isAsyncEncryptionAvailable now returns a Promise that resolves once
initialization completes, matching what the docs already stated.

* chore: lint

* fix: add HandleScope in OnOsCryptReady for pending operations

OnOsCryptReady fires asynchronously from a posted task without an active
V8 HandleScope. Previously this was harmless because eager init meant the
pending queues were always empty when it fired. With lazy init, operations
queue up first, then the callback processes them and needs to create V8
handles (Buffer::Copy, Dictionary::CreateEmpty, Promise::Resolve).
2026-03-23 10:47:14 -07:00
Samuel Attard
29750dda08 build: enable V8 builtins PGO (#50416)
* build: enable V8 builtins PGO

Removes the gn arg that disabled V8 builtins profile-guided optimization
and adds a V8 patch to warn instead of abort when the builtin PGO profile
data does not match. Also strips the PGO-related flags from the generated
mksnapshot_args so they are not passed through to downstream mksnapshot
invocations.

* docs: clarify Node.js async_hooks as reason for promise_hooks flag

Addresses review feedback: the v8_enable_javascript_promise_hooks flag
is set to support Node.js async_hooks, not used directly by Electron.
2026-03-23 11:54:43 -04:00
electron-roller[bot]
6df6ec5f09 chore: bump chromium to 148.0.7741.0 (main) (#50336)
* chore: bump chromium in DEPS to 148.0.7739.0

* chore: bump chromium in DEPS to 148.0.7740.0

* 7654582: Delete obsolete kEnableServiceWorkersForChromeScheme feature flag.

https://chromium-review.googlesource.com/c/chromium/src/+/7654582

* chore: fixup patch indices

* chore: fixup patch indices

* 7664982: Move SharedModuleService to //extensions

https://chromium-review.googlesource.com/c/chromium/src/+/7664982

* chore: bump chromium in DEPS to 148.0.7741.0

* chore: fixup patch indices

* 7666060: [CodeHealth] Replace `RequestPermissions` with `RequestPermissionsFromCurrentDocument`

https://chromium-review.googlesource.com/c/chromium/src/+/7666060

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-23 10:23:55 +01:00
Samuel Attard
882a6b2cf9 build: speed up apply_all_patches by ~60% (#50417)
git am rewrites the index 2-3x per patch. In Chromium (~500K files,
70MB index) this dominated wall time: ~67 of 73 seconds were spent
rehashing and rewriting the index ~300 times for 150 patches.

- Add index.skipHash=true to skip recomputing the trailing SHA over
  the full index on every write
- Force index v4 before am so path-prefix compression roughly halves
  the on-disk index size (70MB -> 40MB)
- Disable core.fsync and gc.auto during am since a crashed apply is
  just re-run from a clean reset
- Apply patch targets in parallel (capped at ncpu-2); Chromium still
  dominates but this hides node/nan/etc behind it. Falls back to
  sequential on roller/ branches where conflict output needs to be
  readable.
- Prefix each output line with the target name so parallel output is
  attributable

Measured on a 13-target config with 238 total patches: 73s -> 28s.
2026-03-23 09:49:48 +01:00
Samuel Attard
b8fa540fd3 fix: use fresh LazyNow for OnEndWorkItemImpl to fix TimeKeeper DCHECK (#50418) 2026-03-22 19:54:31 -07:00
Robb Böhnke
dee8f5a0ff feat: add accessibilityDisplayShouldDifferentiateWithoutColor on macOS (#49912)
feat: add nativeTheme.shouldDifferentiateWithoutColor on macOS

Adds nativeTheme.shouldDifferentiateWithoutColor on macOS that maps to
NSWorkspace.accessibilityDisplayShouldDifferentiateWithoutColor. If true,
the user has indicated that they prefer UI that differentiates items with
something other than color alone. This is useful for users with color
vision deficiency.
2026-03-20 19:51:23 -04:00
dependabot[bot]
32f8e2ce45 build(deps-dev): bump eslint-plugin-n from 16.6.2 to 17.24.0 (#50310)
* build(deps-dev): bump eslint-plugin-n from 16.6.2 to 17.24.0

Bumps [eslint-plugin-n](https://github.com/eslint-community/eslint-plugin-n) from 16.6.2 to 17.24.0.
- [Release notes](https://github.com/eslint-community/eslint-plugin-n/releases)
- [Changelog](https://github.com/eslint-community/eslint-plugin-n/blob/master/CHANGELOG.md)
- [Commits](https://github.com/eslint-community/eslint-plugin-n/compare/16.6.2...v17.24.0)

---
updated-dependencies:
- dependency-name: eslint-plugin-n
  dependency-version: 17.24.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: disable errors we still need these

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-20 17:38:44 -04:00
Anirudh Sevugan
4e6324e00b docs: remove postinstall lifecycle warning (#50359)
* docs: change postinstall lifecycle to changed from electron v42

* docs: remove postinstall lifecycle warning
2026-03-20 17:37:53 -04:00
Shelley Vohr
7f21d31498 feat: use Downloads folder as default path for file dialogs (#49868)
* fix: use Downloads folder as default path for file dialogs

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>

* chore: improve breaking change description

---------

Co-authored-by: Sourav Bera <sbera987654321@gmail.com>
2026-03-20 17:28:53 -04:00
John Kleinschmidt
639d3b99b7 ci: update actions to node24 (#50373)
* ci: update actions to node24

* chore: fixup actions/cache to 5.0.4 everywhere
2026-03-20 15:33:48 -04:00
dodola
0c7bde54d4 feat: add copyVideoFrameAt and saveVideoFrameAs methods on webContents (#48149)
* feat: add copyVideoFrameAt and saveVideoFrameAs Method on Webcontent

chore: change the description of savevideoframe api

chore: add the description of the restrictive elements for using the APIs.

move to webframemain

fixed mediaPlayerAction to kSaveVideoFrameAs

Update spec/api-web-frame-main-spec.ts

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

Update spec/api-web-frame-main-spec.ts

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

fixed clipboard tests for video frame copying

fixed test for copying video frame to clipboard. check video loaded before copy video frame in test.

chore: try non-proprietary video format

Revert "chore: try non-proprietary video format"

This reverts commit ef085f88a1af53b6408a7af695cc60b8681398cf.

fix: format video as file url

* test: skip webFrameMain.copyVideoFrameAt on win32 CI due Chromium DCHECK
2026-03-20 15:32:09 -04:00
Noah Gregory
8a0c20431c fix: don't re-parse URL unnecessarily when handling dialogs (#50062)
* fix: fallback to opaque URL when needed inside dialog callback

* refactor: remove additional URL parsing entirely when showing dialogs

* test: add crash test case for URL-less dialogs

* refactor: exit on events instead of on timeout for dialog crash test

Co-authored-by: Robo <hop2deep@gmail.com>

* style: make linter happy

* style: make linter actually happy

* fix: address failing `safeDialogs` tests

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2026-03-20 09:27:59 -04:00
dependabot[bot]
72797d7b42 build(deps): bump flatted from 3.2.7 to 3.4.1 in the npm_and_yarn group across 1 directory (#50376)
build(deps): bump flatted in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [flatted](https://github.com/WebReflection/flatted).


Updates `flatted` from 3.2.7 to 3.4.1
- [Commits](https://github.com/WebReflection/flatted/compare/v3.2.7...v3.4.1)

---
updated-dependencies:
- dependency-name: flatted
  dependency-version: 3.4.1
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-19 19:18:55 -07:00
João Silva
9ccc752a43 fix: correct utility process exit code on Windows (#50256)
* fix: correct utility process exit code on Windows

On Windows, process exit codes are 32-bit unsigned integers (DWORD).
When passed from Chromium to Electron as a signed int and then
implicitly converted to uint64_t, values with the high bit set
(e.g., NTSTATUS codes) undergo sign extension, producing incorrect
values.

Cast the exit code to uint32_t before widening to uint64_t to
prevent sign extension and preserve the original Windows exit code.

Fixes #49455

* fix: narrow HandleTermination and Shutdown to uint32_t, add tests
2026-03-19 16:58:14 -04:00
Calvin
6993eb3c78 chore: wordsmith non-maintainer dependency change bot message (#50345)
Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-03-19 15:44:59 -04:00
Shelley Vohr
d9649f9e16 feat: support notification priority on Windows (#50225)
* feat: support notification priority on Windows

Add Windows notifications support urgency/priority levels.
This maps the existing `urgency` option (previously Linux-only) to
Windows toast notification priorities:

- 'critical' maps to ToastNotificationPriority_High, which sorts the
  notification above default-priority items in Action Center.
- 'normal' and 'low' both map to ToastNotificationPriority_Default.

Note that on Windows, 'critical' priority does not prevent the toast
from being auto-dismissed. Users should additionally set `timeoutType`
to 'never' for that behavior.

* chore: make linter happy

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-19 15:44:19 -04:00
John Kleinschmidt
5b2b9cdeff ci: don't run auto close for certain circumstances (#50372) 2026-03-19 14:48:09 -04:00
Shelley Vohr
e31a95b15f chore: remove macos hittest workaround patch (#50330)
build: remove macos hittest workaround patch

CL:6574464 changed BridgedContentView::hitTest: to use GetHitTestResult(), which
returns kRootView for any non-null, non-NativeViewHost view — causing
BridgedContentView to absorb all web content mouse events. In BrowserWindow,
content_view_ sits in front of the sibling WebContentsView and covers the full
client area, so it was always found first, breaking all loadURL page interaction.

Fix this by installing a ContentViewTargeterDelegate on content_view_ in
NativeWindowMac::SetContentView that returns nullptr (instead of the view itself)
when no children cover the target point. This makes GetHitTestResult return kOther,
allowing hitTest: to fall through to [super hitTest:] and find
RenderWidgetHostViewCocoa. This also removes the now-unnecessary chromium
partial-revert patch that worked around the same issue.
2026-03-19 11:04:17 -04:00
David Sanders
1ad832a4c1 ci: output build cache hit rate as GHA annotation (#50361) 2026-03-19 09:41:32 -04:00
John Kleinschmidt
8e077a09f3 ci: only run auto close on PRs targeting main branch (#50357) 2026-03-19 00:19:25 +00:00
John Kleinschmidt
95f0d8156b ci: test linux 64k (#49961) 2026-03-18 19:14:49 -04:00
Noah Gregory
b881f86c8f fix: always call the original impl in swizzled mousedown impls (#50096)
fix: always call the original implementation in swizzled mousedown implementations
2026-03-18 17:54:43 -04:00
John Kleinschmidt
5959ecc3ee ci: auto close PRs that do not fill out the required template (#50348) 2026-03-18 17:52:03 -04:00
John Kleinschmidt
a6a44692dc chore: Respect HTTP(S) proxy env variable for Yarn (#50322)
Respect HTTP(S) proxy env variable for Yarn

Co-authored-by: Filip Mösner <filip.mosner@seznam.cz>
2026-03-18 17:13:05 -04:00
John Beutner
12ea28c23e fix: ensure WebContents::WasShown runs when window is shown (#49421)
Avoids a freeze when failing to enter fullscreen on macOS.
2026-03-18 12:34:11 -04:00
Kyle Cutler
ade684dc35 fix: correctly track BaseWindow::IsActive() on MacOS (#49460)
fix: correctly set IsActive() in BaseWindow on MacOS
2026-03-18 11:47:19 -04:00
electron-roller[bot]
4ec6923898 chore: bump chromium to 148.0.7738.0 (main) (#50323)
* chore: bump chromium in DEPS to 148.0.7738.0

* chore: fixup patch indices

* 7664509: Migrate ServiceWorkerInfo to ChildProcessId

https://chromium-review.googlesource.com/c/chromium/src/+/7664509

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-18 11:45:24 -04:00
Ryan Zimmerman
e86cd9da96 docs: fix markdown formatting in fuses.md (#50318)
* docs: fix markdown formatting in fuses.md

* Use bulleted list (was being run together on one line)
* Wrap ASCII diagram in code block

* docs: apply suggestions from code review

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: fix misapplied suggestion

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-03-18 10:47:52 -04:00
reito
d6db1a27af feat: add nv12 osr format support. (#49799)
* feat: add nv12 osr output format.

* feat: add nv12 osr output format.
2026-03-17 17:14:01 -04:00
Shelley Vohr
76331f0564 refactor: replace CHILD_PLUGIN with CHILD_EMBEDDER_FIRST on macOS (#50278)
refactor: replace CHILD_PLUGIN with CHILD_EMBEDDER_FIRST on macOS

Chromium removed upstream support for child plugin processes without
library validation in https://crbug.com/461717105, which we patched
back via feat_restore_macos_child_plugin_process.patch.

Chromium's CHILD_EMBEDDER_FIRST mechanism already provides the right
extensibility point for this: values > CHILD_EMBEDDER_FIRST are reserved
for embedders and resolved via ContentBrowserClient::GetChildProcessSuffix().
Chrome itself uses this pattern for its Alerts helper process.

This commit replaces the Chromium patch with an Electron-native
implementation.
2026-03-17 14:41:15 -04:00
electron-roller[bot]
7cb6a737a9 chore: bump chromium to 148.0.7737.0 (main) (#50277)
* chore: bump chromium in DEPS to 148.0.7734.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 148.0.7736.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 148.0.7737.0

* chore: fixup patch indices

* 7666125: Migrate ServiceWorkerContext to ChildProcessId

https://chromium-review.googlesource.com/c/chromium/src/+/7666125

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-17 13:30:32 -04:00
dependabot[bot]
3659b97563 build(deps): bump dorny/paths-filter from 3.0.2 to 4.0.1 (#50306)
Bumps [dorny/paths-filter](https://github.com/dorny/paths-filter) from 3.0.2 to 4.0.1.
- [Release notes](https://github.com/dorny/paths-filter/releases)
- [Changelog](https://github.com/dorny/paths-filter/blob/master/CHANGELOG.md)
- [Commits](de90cc6fb3...fbd0ab8f3e)

---
updated-dependencies:
- dependency-name: dorny/paths-filter
  dependency-version: 4.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-17 12:30:14 -04:00
John Kleinschmidt
7d72eb809e ci: update test timeout to 60 minutes (#50305) 2026-03-17 10:06:42 -04:00
dependabot[bot]
8ba0ae7fa8 build(deps): bump actions/download-artifact from 8.0.0 to 8.0.1 (#50309)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 8.0.0 to 8.0.1.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](70fc10c6e5...3e5f45b2cf)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 8.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-17 14:42:11 +01:00
David Sanders
36350d78d0 chore: add missing timers-shim.ts to filenames.auto.gni (#50311) 2026-03-17 09:46:15 +01:00
dependabot[bot]
9b80324d7f build(deps): bump github/codeql-action from 4.32.6 to 4.33.0 (#50308)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.6 to 4.33.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0d579ffd05...b1bff81932)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.33.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-16 22:15:03 -07:00
dependabot[bot]
a549c56faa build(deps): bump slackapi/slack-github-action from 2.1.1 to 3.0.1 (#50307)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 2.1.1 to 3.0.1.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](91efab103c...af78098f53)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-version: 3.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-16 22:14:43 -07:00
Keeley Hammond
958278c273 feat: add id and groupId options to macOS notifications (#50097)
* feat: add custom `id` property to Notification API (macOS only)

* feat: add `groupId` property to Notification API (macOS). Notifications with the same groupId will be visually grouped together in Notification Center

* fix: move validation to construction time, add empty string check, remove setters

* docs: clarify id/group id properties, make instance properties read-only

* test: update tests to reflect read-only properties
2026-03-16 21:24:29 +01:00
Shelley Vohr
b7e9bbed0c fix: restore sdk_inputs cross-toolchain deps for macOS (#50297)
fix: restore sdk_inputs cross-toolchain deps for macOS

The change in CL:7652975 restricted sdk_inputs public_deps
to iOS only, to avoid setting up Xcode symlinks for the Linux
toolchain when cross-building chrome/linux on Mac. However, this
also broke cross-arch macOS builds (e.g. ffmpeg with target_cpu=x64)
where the mig target in the clang_arm64 toolchain depends on
sdk_inputs from the default clang_x64 toolchain.

Add target_os == \"mac\" alongside the existing iOS check to preserve
the original intent while restoring the cross-toolchain dependency
for macOS builds.
2026-03-16 20:12:38 +00:00
Justin Mayfield
eec3fe967e fix: user resizable transparent windows on win32 (#49428)
test: revert win32 frameless and transparent resizable expectations
2026-03-16 15:31:07 -04:00
David Sanders
01714757e3 ci: ignore test timeouts in audit (#50259) 2026-03-16 14:33:37 -04:00
Shelley Vohr
ffad67222d test: fix esm issue in node-spec-runner (#50289)
Chromium added a top-level package.json in CL:7485999 that sets
the type to module and breaks commonjs tests run via
node-spec-runner.js. This commit temporarily changes the type to
commonjs while running the tests, then changes it back to module when done.
2026-03-16 12:55:03 -04:00
ZHUO Xu
078586fab0 docs: update the example of webContents.setWindowOpenHandler to cla… (#49379)
docs: reorganize the comments for clarifying `webContents.setWindowOpenHandler` example
2026-03-16 12:12:52 -04:00
Noah Gregory
a561dd97a6 fix: add ASAR support to additional copy methods (#50226)
* fix: add ASAR support for additional copy methods

* test: add tests for ASAR support for additional copy messages
2026-03-16 14:36:48 +01:00
Shelley Vohr
b9cbcde600 build: remove redundant bits of ncrypto node patch (#50252)
build: remove redundant ncrypto node patch
2026-03-16 12:13:47 +01:00
electron-roller[bot]
36b0709942 chore: bump chromium to 148.0.7733.0 (main) (#50197)
* chore: bump chromium in DEPS to 147.0.7727.2

* chore: bump chromium in DEPS to 148.0.7728.0

* chore: bump chromium in DEPS to 148.0.7729.0

* chore: bump chromium in DEPS to 148.0.7730.0

* chore: bump chromium in DEPS to 148.0.7732.0

* chore: update WrappablePointerTag patch
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7641766

* chore: update custom protocol patch for removed code
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7653454

* chore: update patches

* fix: cleanup removed CHILD_PLUGIN code
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7653455

* fix: move from int to ChildProcessId
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7621912

* fix: update extensions CreateTab signature
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7644389

* fix: draggable hit region test interface update for mac windows
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7655245

* chore: bump chromium in DEPS to 148.0.7733.0

* feat: restore macos child plugin process
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7653455

* fixup! chore: merge main

* chore: update patches

* fix: replace clipboard IsFormatAvailable with async GetAllAvailableFormats
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7631097

Async API pending RFC https://github.com/electron/rfcs/pull/19

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
2026-03-16 10:55:06 +01:00
Shelley Vohr
cf84efbbb9 fix: prefer browser runtime over node in DevTools HostRuntime detection (#50241)
Upstream DevTools' HostRuntime checks `IS_NODE` before `IS_BROWSER` when
selecting the platform runtime. In Electron, `process` is available in
renderer processes, so `IS_NODE` evaluates to `true` in the DevTools
context. This causes DevTools to dynamically import the Node.js platform
runtime, which uses `node:worker_threads`. DevTools Web Workers running
under the `devtools://` protocol cannot load Node.js built-in modules,
so the import fails and breaks features like the formatter worker.

Fix by swapping the check order to prefer `IS_BROWSER` when both are
true. This is safe because in pure Node.js environments (the only case
where the node runtime is needed), `window` and `self` are both
undefined, so `IS_BROWSER` is always `false` regardless of check order.
2026-03-16 10:29:35 +01:00
David Sanders
58cd1aba10 ci: fix unsupported major in release board automation (#50260) 2026-03-14 15:34:50 -07:00
dependabot[bot]
26a3a8679a build(deps-dev): bump folder-hash from 4.1.1 to 4.1.2 (#50258)
Bumps [folder-hash](https://github.com/marc136/node-folder-hash) from 4.1.1 to 4.1.2.
- [Release notes](https://github.com/marc136/node-folder-hash/releases)
- [Changelog](https://github.com/marc136/node-folder-hash/blob/v5/CHANGELOG.md)
- [Commits](https://github.com/marc136/node-folder-hash/compare/v4.1.1...v4.1.2)

---
updated-dependencies:
- dependency-name: folder-hash
  dependency-version: 4.1.2
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-13 22:46:05 -07:00
John Kleinschmidt
a1e4c260ea ci: create PR triage project automation (#50248)
* ci: create PR triage project automation

* chore: use ubuntu-slim

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-14 02:35:29 +00:00
Samuel Attard
f4a50a8fde build: skip archiving patch conflict fix artifact (#50251)
The update-patches artifact is a single .patch file, so zipping it
is unnecessary overhead. With archive: false, gh run download fetches
the raw file directly without requiring a decompression step.

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-13 21:49:05 +00:00
Erick Zhao
b35ed6346e docs: point pull requests guide to build tools (#50198)
* docs: point pull requests guide to build tools

* update for `--fork`
2026-03-13 16:01:41 -04:00
Samuel Attard
816e5964fb build: add patch conflict resolution workflow with CI artifacts (#50235)
ci: upload patch conflict fix as artifact in apply-patches

When patch-up.js cannot auto-push the 3-way-merged patch diff (e.g. on
fork PRs), the checkout action already writes patches/update-patches.patch
and tells the user to check CI artifacts — but nothing was uploading it.

This adds the missing upload-artifact step to the apply-patches job so
the resolved diff is available for download, and documents in CLAUDE.md
that pulling this artifact and applying it with `git am` is the fast
path for fixing patch conflicts on PR branches without a full local sync.

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-13 01:46:29 +00:00
Michaela Laurencin
3295d0d4b0 build(deps-dev): replace timers-browserify (#50203)
* build(deps-dev): replace timers-browserify

Co-Authored-By: Claude <noreply@anthropic.com>
Generated-By: GitHub Copilot

* update shim from js to ts

Co-Authored-By: Claude <noreply@anthropic.com>
Generated-By: GitHub Copilot

* remove timers-shim.js

* remove refs from package json and yarn lock

* update process in yarn lock

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-12 21:26:34 -04:00
John Kleinschmidt
3e72e2e8dd ci: update actions/cache to 5.0.3 (#50222)
chore: update actions/cache to 5.0.3

Needed due to https://github.blog/changelog/2025-09-19-deprecation-of-node-20-on-github-actions-runners/
2026-03-12 20:45:01 -04:00
Erick Zhao
313e501454 feat: add ELECTRON_INSTALL_ env vars (#49981)
* feat: add `ELECTRON_INSTALL_` env vars

* add tip for available arches

* clarify!

* use `arm` instead of `armv7l`
2026-03-12 15:09:48 +01:00
Erick Zhao
1f6dbb0917 docs: add API history (G-I) (#50194) 2026-03-12 14:43:39 +01:00
Niklas Wenzel
378659c535 build: update NMV to 146 (#50214) 2026-03-11 23:32:42 +00:00
Samuel Attard
6be775ad83 fix: preserve staged update dir when pruning orphaned updates on macOS (#50210)
fix: preserve staged update dir when pruning orphaned update dirs on macOS

The previous squirrel.mac patch cleaned up all staged update directories
before starting a new download. This kept disk usage bounded but broke
quitAndInstall() if called while a subsequent checkForUpdates() was in
flight — the already-staged bundle would be deleted out from under it.

This reworks the patch to read ShipItState.plist and preserve the
directory it references, deleting only truly orphaned update.XXXXXXX
directories. Disk footprint stays bounded (at most 2 dirs: staged +
in-progress) and quitAndInstall() remains safe mid-check.

Also adds test coverage for the quitAndInstall/checkForUpdates race and
a triple-stack scenario where 3 updates arrive without a restart.

Refs https://github.com/electron/electron/issues/50200
2026-03-11 15:42:23 -07:00
Mitchell Cohen
11f28ac3ac fix: improved the appearance of shadows and borders on frameless windows on Wayland (#50007)
* remove painting from linux frame layout

* use chromium csd strategy for frameless windows

* Apply suggestions from code review

Remove unneeded virtual methods

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* removed inline destructors

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-11 15:42:09 -04:00
Erick Zhao
5ec589a1de chore: remove remark-cli from markdown linting (#50165)
* chore: remove stale `.remarkrc` file

* build(deps): remove unused deps

* cleanup again
2026-03-11 15:39:38 -04:00
Charles Kerr
4fe3752fae refactor: move electron::api::Tray to cppgc (#50187)
* refactor: migrate electron::api::tray to cppgc

* chore: add Tray to wrappable_pointer_tags.h patch

* fixup! refactor: migrate electron::api::tray to cppgc

clear keep_alive_ if error is thrown in constructor

* refactor: make Tray::menu_ a cppgc::Member<Menu>
2026-03-11 15:38:08 -04:00
Shelley Vohr
c8dd0b99ee fix: prevent traffic light buttons flashing on deminiaturize (#50183)
* fix: prevent traffic light buttons flashing on deminiaturize

When a window with a custom `trafficLightPosition` is minimized and
restored, macOS re-layouts the title bar container during the
deminiaturize animation, causing the traffic light buttons to briefly
appear at their default position before being repositioned.

Fix this by hiding the buttons container in `windowWillMiniaturize` and
restoring them (with a redraw to the correct position) in
`windowDidDeminiaturize`.

* chore: address feedback from review
2026-03-11 13:02:51 -04:00
John Kleinschmidt
55ebdfb26b ci: add timeout to test step (#50186)
Additionally, take a screenshot on timeout so that we can debug why there is a hang
2026-03-11 09:48:47 +01:00
electron-roller[bot]
d6e0c270d1 chore: bump chromium to 147.0.7727.0 (main) (#50115)
* chore: bump chromium in DEPS to 147.0.7724.0

* chore: bump chromium in DEPS to 147.0.7725.0

* chore: bump chromium in DEPS to 147.0.7727.0

* chore: update patches
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7633903

* fix: pass weak-ptr-bound callback to OnCommandsChanged
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7622614

* fix: add missing option to CSS corner smoothing property
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7646628

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
2026-03-10 23:14:36 -04:00
George Xu
c4c6195341 docs: document Wayland frameless window shadow behaviour (#50193)
docs: update linux frameless window docs to account for hasShadow:false
2026-03-10 18:37:38 -07:00
Noah Gregory
f1705eccf8 fix: don't call TaskDialogIndirect with disabled parent windows (#50078) 2026-03-10 14:51:07 -04:00
Brandon Fowler
44b12fbb7b fix: run webRequest handlers for URLs handled by ElectronURLLoaderFactory (#45915)
* fix: continue to run ProxyingURLLoaderFactory for intercepted protocols

* test: webRequest handlers when loading browser windows

* fix: wrap special URL loaders factories with ProxyingURLLoaderFactory

* test: webRequest handlers when using net.fetch

* refactor: remove redundant intercepted protocol handling

AsarURLLoaderFactory is now intercepted by ProxyingURLLoaderFactory, which already handles when the file:// scheme is intercepted.

* fix: check before using saved headers in OnReceiveResponse

* fix: run webRequest handlers when loading file service workers

* test: handlers when loading file service workers

* refactor: add shared CreateURLLoaderFactoryBuilder method

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2026-03-10 12:27:00 -04:00
dependabot[bot]
3691451c71 build(deps): bump github/codeql-action from 4.32.5 to 4.32.6 (#50179)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.5 to 4.32.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](c793b717bc...0d579ffd05)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-10 09:52:19 +01:00
dependabot[bot]
b3e4547acd build(deps): bump fast-xml-parser from 4.5.3 to 4.5.4 in the npm_and_yarn group across 1 directory (#50182)
build(deps): bump fast-xml-parser

Bumps the npm_and_yarn group with 1 update in the / directory: [fast-xml-parser](https://github.com/NaturalIntelligence/fast-xml-parser).


Updates `fast-xml-parser` from 4.5.3 to 4.5.4
- [Release notes](https://github.com/NaturalIntelligence/fast-xml-parser/releases)
- [Changelog](https://github.com/NaturalIntelligence/fast-xml-parser/blob/master/CHANGELOG.md)
- [Commits](https://github.com/NaturalIntelligence/fast-xml-parser/compare/v4.5.3...v4.5.4)

---
updated-dependencies:
- dependency-name: fast-xml-parser
  dependency-version: 4.5.4
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-10 09:51:41 +01:00
dependabot[bot]
bda1becab0 build(deps): bump actions/setup-node from 6.2.0 to 6.3.0 (#50180)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.2.0 to 6.3.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](6044e13b5d...53b83947a5)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.3.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-10 09:42:58 +01:00
Michaela Laurencin
dda92fd53d ci: add workflow to remove 'needs-signed-commits' label (#50103) 2026-03-09 18:45:49 -07:00
Erick Zhao
d4cbd6cd7d docs: fix ipc highlight lines (#50169)
Co-authored-by: Dilukshan <65407969+dilukshann7@users.noreply.github.com>
2026-03-09 17:16:06 -07:00
Kyle Cutler
2ba4872d2c feat: WebContents.getOrCreateDevToolsTargetId() (#49733)
* Feat: support getDevToolsId() on WebContents

* Rename to `getOrCreateDevToolsTargetId`

* build: use spawn instead of spawnSync for build (#49774)

* Fix build

* formatting

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2026-03-09 16:32:52 -04:00
Shelley Vohr
c264402766 fix: validate protocol scheme names in setAsDefaultProtocolClient (#50141)
fix: validate protocol scheme names in setAsDefaultProtocolClient

On Windows, `app.setAsDefaultProtocolClient(protocol)` directly
concatenates the protocol string into the registry key path with no
validation. A protocol name containing `\` could write to an arbitrary
subkey under `HKCU\Software\Classes\`, potentially hijacking existing
protocol handlers.

To fix this, add `Browser::IsValidProtocolScheme()` which validates that a protocol
name conforms to the RFC 3986 scheme grammar:

  scheme = ALPHA *( ALPHA / DIGIT / "+" / "-" / "." )

This rejects backslashes, forward slashes, whitespace, and any other
characters not permitted in URI schemes.
2026-03-09 18:16:34 +00:00
Shelley Vohr
2c6dd1156c fix: use requesting frame origin in permission helper and device choosers (#50052)
* fix: use requesting frame origin instead of top-level URL for permissions

`WebContentsPermissionHelper::RequestPermission` passes
`web_contents_->GetLastCommittedURL()` as the origin to the permission
manager instead of the actual requesting frame's origin. This enables
origin confusion when granting permissions to embedded third-party iframes,
since app permission handlers see the top-level origin instead of the
iframe's. The same pattern exists in the HID, USB, and Serial device
choosers, where grants are keyed to the primary main frame's origin rather
than the requesting frame's.

Fix this by using `requesting_frame->GetLastCommittedOrigin()` in all
affected code paths, renaming `details.requestingUrl` to
`details.requestingOrigin`, and populating it with the serialized
origin only.

* chore: keep requestingUrl name in permission handler details

The previous commit changed the details.requestingUrl field to
details.requestingOrigin in permission request/check handlers. That
field was already populated from the requesting frame's RFH, so the
rename was unnecessary and would break apps that read the existing
property. Revert to requestingUrl to preserve the existing API shape.

The functional changes to use the requesting frame in
WebContentsPermissionHelper and the HID/USB/Serial choosers remain.

---------

Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-09 09:20:22 -07:00
Shelley Vohr
eacec9a47e refactor: use WHATWG URL instead of url.parse (#48674)
refactor: use WHATWG URL instead of url.parse
2026-03-09 11:12:01 -04:00
David Sanders
0d869c2007 ci: calculate dates for release board automation (#50081) 2026-03-09 11:35:55 +01:00
Shelley Vohr
ccb2c77c17 fix: InspectorFrontendHost override in embedded windows (#49794)
fix: InspectorFrontendHost override in embedded windows
2026-03-09 10:53:02 +01:00
Samuel Attard
603679cb18 fix: read nodeIntegrationInWorker from per-frame WebPreferences (#50122)
Previously the renderer checked a process-wide command-line switch to
decide whether to create a Node.js environment for dedicated workers.
When a renderer process hosted multiple WebContents with different
nodeIntegrationInWorker values (e.g. via window.open with overridden
webPreferences in setWindowOpenHandler), all workers in the process
used whichever value the first WebContents set on the command line.

Instead, plumb the flag through blink's WorkerSettings at worker
creation time, copying it from the initiating frame's WebPreferences.
The check on the worker thread then reads the per-worker value. Nested
workers inherit the flag from their parent worker via
WorkerSettings::Copy.

The --node-integration-in-worker command-line switch is removed as it
is no longer consumed.
2026-03-09 00:50:01 -07:00
Samuel Attard
9b78d75b30 fix: validate response header names and values before AddHeader (#50123)
Matches the existing validation applied to request headers in
electron_api_url_loader.cc.
2026-03-08 15:40:48 -07:00
Samuel Attard
3a48fd5fbb build: pin diff.renames for deterministic patch export (#50121)
git format-patch honors diff.renames, which defaults to 'true' (rename
detection only). If a user has diff.renames=copies configured at the
system or global level, exported patches may encode new files as copies
of similar existing files, causing spurious diffs against patches
exported on other machines. Pin diff.renames=true to match git's
default.
2026-03-08 15:39:21 -07:00
Samuel Attard
fb13492c89 fix: correct parsing of second-instance additionalData (#50119)
- POSIX: validate StringToSizeT result and token count when splitting
  the socket message into argv and additionalData; previously a
  malformed message could produce incorrect slicing.
- Windows: base64-encode additionalData before embedding in the
  null-delimited wchar_t buffer. The prior reinterpret_cast approach
  dropped everything after the first aligned 0x0000 in the serialized
  payload, so complex objects could arrive truncated.
2026-03-08 15:39:12 -07:00
Samuel Attard
8bdae63036 fix: strictly validate sender for internal IPC reply channels (#50118)
The sender-mismatch check in invokeInWebContents and invokeInWebFrameMain
used a negative condition (`type === 'frame' && sender !== expected`),
which only rejected mismatched frame senders and accepted anything else.

Invert to a positive check so only the exact expected frame can resolve
the reply — matches the guard style used elsewhere in lib/browser/.
2026-03-08 15:39:04 -07:00
dependabot[bot]
2a4909093e build(deps): bump the npm_and_yarn group across 1 directory with 2 updates (#50080)
Bumps the npm_and_yarn group with 2 updates in the / directory: [basic-ftp](https://github.com/patrickjuchli/basic-ftp) and [minimatch](https://github.com/isaacs/minimatch).


Updates `basic-ftp` from 5.1.0 to 5.2.0
- [Release notes](https://github.com/patrickjuchli/basic-ftp/releases)
- [Changelog](https://github.com/patrickjuchli/basic-ftp/blob/master/CHANGELOG.md)
- [Commits](https://github.com/patrickjuchli/basic-ftp/compare/v5.1.0...v5.2.0)

Updates `minimatch` from 3.1.3 to 3.1.5
- [Changelog](https://github.com/isaacs/minimatch/blob/main/changelog.md)
- [Commits](https://github.com/isaacs/minimatch/compare/v3.1.3...v3.1.5)

---
updated-dependencies:
- dependency-name: basic-ftp
  dependency-version: 5.2.0
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: minimatch
  dependency-version: 3.1.5
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-08 19:20:52 +01:00
electron-roller[bot]
9f80b64617 chore: bump chromium to 147.0.7719.0 (main) (#50061)
* chore: bump chromium in DEPS to 147.0.7716.0

* chore: bump chromium in DEPS to 147.0.7717.0

* chore: bump chromium in DEPS to 147.0.7719.0

* chore: update patches

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7618634
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7622595

* [Extensions] Track service worker lifecycle more precisely

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7567646

* Make Clipboard::ReadAsciiText|ReadData|ReadText|ReadAvailableTypes asynchronous

Refs
https://chromium-review.googlesource.com/c/chromium/src/+/7609958
https://chromium-review.googlesource.com/c/chromium/src/+/7600360
https://chromium-review.googlesource.com/c/chromium/src/+/7595942
https://chromium-review.googlesource.com/c/chromium/src/+/7594881

* fixup! Make Clipboard::ReadAsciiText|ReadData|ReadText|ReadAvailableTypes asynchronous

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-03-08 06:22:11 +09:00
Keeley Hammond
3e0e1e4e84 test: fix flaky macOS dock tests (#50098)
* test: fix flaky mac dock & autofill tests

* fix: add null checks for the parent widget before calling IsVisible()

* test: remove autofill test change (failing on Linux), keep crash fix

* chore: autofill updates from code review
2026-03-06 13:35:16 -08:00
Michaela Laurencin
86f2c7cced docs: cleanup desktop-capturer doc after chromium audio capture additions (#50091)
* docs: cleanup desktop-capturer doc after chromium audio capture additions

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* disable linter for list in note

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-03-06 15:27:00 -05:00
Calvin
73596cff9d fix: Revert "updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)" (#50093)
Revert "fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)"

This reverts commit 90c9de70ac.

Ref: https://github.com/electron/electron/issues/50050
2026-03-06 15:25:36 -05:00
John Kleinschmidt
62c8db561c docs: remove release schedule in favor of https://releases.electronjs.org/schedule (#50094) 2026-03-06 15:25:00 -05:00
Charles Kerr
dc4ad2e932 fix: screen.getCursorScreenPoint() crash on Wayland (#50092)
* docs: document that getCursorScreenPoint() needs a Window on Wayland

* feat: add IsWayland() helper

* fix: Wayland crash in GetCursorScreenPoint()

fix: support Screen::GetCursorScreenPoint() on X11
2026-03-06 15:24:33 -05:00
Robo
fbfd0ed3a4 fix: specs in release build due to electron_common_testing module (#50070)
* fix: specs in release build due to electron_common_testing module

* fix: move binding into respective tests

describe block will run the callback to register which
tests to skip and having the binding hoisted will end
up being invoked.
2026-03-06 08:39:25 +09:00
Jan Hannemann
ddefb54c8f feat: implements cold COM activation (#49919)
* fix: implements cold COM activation

* fix: code review feedack
2026-03-05 17:30:04 -05:00
Developer-Ecosystem-Engineering
d6fc627ba5 feat: replace deprecated NSUserNotifications with User Notifications (#47817)
* refactor: replace deprecated NSUserNotifications with User Notifications

Removes deprecated NSUserNotification API, now using User Notifications

It replaces API calls for generating, scheduling, and receiving native
macOS notifications with equivalent API calls from the new framework,
or functionally equivalent implementations.

To preserve the existing Notification module API, special handling was
required in certain cases:

  - Dynamically declared notification actions
    Typically, notification actions should be declared at app launch time
    when using the User Notifications framework. However, this isn’t
    compatible with Electron’s architecture. Instead, we dynamically
    declare new notifications actions when necessary and carefully manage
    the existing actions registered at runtime.

  - Localizations for ‘Reply’ and ‘Show’ labels
    New translation files are added and processed through GRIT to add
    localizations for “Reply” and “Show” button labels which were
    initially supplied by the NSUserNotification framework.

* Use NotificationImageRetainer pattern from //chrome

* build: fix lint

* build: update config to handle --translate-gender for pak files

* test: also sign on arm64

* fix: add error handling for scheduling notification

* docs: add details to breaking changes

* docs: clarify breaking change details

* docs: add details for notifications tutorial and API documentation

---------

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-03-05 11:57:19 -08:00
Shelley Vohr
7c0cb61b3c fix: prevent use-after-free in PowerMonitor via dangling OS callbacks (#50045)
PowerMonitor registered OS-level callbacks (HWND UserData and
WTS/suspend notifications on Windows, shutdown handler and lock-screen
observer on macOS) but never cleaned them up in its destructor. The JS
layer also only held the native object in a closure-local variable,
allowing GC to reclaim it while those registrations still referenced
freed memory.

Retain the native PowerMonitor at module level in power-monitor.ts so
it cannot be garbage-collected. Add DestroyPlatformSpecificMonitors()
to properly tear down OS registrations on destruction: on Windows,
unregister WTS and suspend notifications, clear GWLP_USERDATA, and
destroy the HWND; on macOS, remove the emitter from the global
MacLockMonitor and reset the Browser shutdown handler.
2026-03-05 09:00:37 -06:00
ANANYA542
9b15976136 fix: avoid redundant page-favicon-updated events on setBounds (#49464)
* fix: avoid duplicate calls in electron_api_web_contents

* Style: fix lint errors

* fix: prevent duplicate page-favicon-updated events and add regression test
2026-03-05 11:30:46 +01:00
Erick Zhao
55106192af docs: add more api history (C-D) (#49510) 2026-03-05 11:30:20 +01:00
Charles Kerr
d18b017cb0 fix: FTBFS when printing is disabled (#50056)
these variables hit with-Werror,-Wunused when printing is disabled
2026-03-04 13:14:02 -06:00
Shelley Vohr
f7507447ad fix: use proper quoting for exe paths and args on Windows (#50016)
Previously, GetProtocolLaunchPath and FormatCommandLineString in
browser_win.cc used naive quoting which could break when paths or
arguments contained backslashes, spaces, or embedded quotes.

Fix by extracting the CommandLineToArgvW-compatible quoting logic from
relauncher_win.cc into a shared utility and use it in both browser_win.cc
and relauncher_win.cc to properly quote the exe path and each argument
individually.
2026-03-04 11:59:49 -05:00
Keeley Hammond
ff623a731c build: fix code-signing for MacOS x64 tests (#50058)
* fix: code-sign binaries for notification tests

* test: remove redundent feedURL test

* test: move squirrel feed tests to api-autoupdater

* fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings

* Revert "fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings"

This reverts commit 5ad9892a67.

* test: unsign tests requiring no signed app
2026-03-04 11:58:47 -05:00
Michaela Laurencin
442debdcd4 docs: correct lazy electron download breaking change to 42 (#50031) 2026-03-04 16:15:01 +01:00
Shelley Vohr
0d7fc95817 chore: remove applescript from trash (#50044)
Previously, when trashItemAtURL: failed (e.g. on network shares or
under app translocation), the code fell back to constructing an
AppleScript that interpolated the bundle path directly into a string
literal via %@ with no escaping. This was fragile and unnecessary —
trashItemAtURL: has been the standard API since 10.8 and covers the
relevant cases. The fix simply removes the AppleScript fallback
entirely, so Trash() now returns the result of trashItemAtURL: directly.
2026-03-04 12:16:33 +01:00
electron-roller[bot]
54ac544f27 chore: bump chromium to 147.0.7714.0 (main) (#50041)
* chore: bump chromium in DEPS to 147.0.7714.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-03-04 12:15:40 +09:00
dependabot[bot]
2c9bf0df6d build(deps): bump minimatch from 3.1.2 to 3.1.3 in the npm_and_yarn group across 1 directory (#50008)
build(deps): bump minimatch in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [minimatch](https://github.com/isaacs/minimatch).


Updates `minimatch` from 3.1.2 to 3.1.3
- [Changelog](https://github.com/isaacs/minimatch/blob/main/changelog.md)
- [Commits](https://github.com/isaacs/minimatch/compare/v3.1.2...v3.1.3)

---
updated-dependencies:
- dependency-name: minimatch
  dependency-version: 3.1.3
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 14:16:40 -05:00
dependabot[bot]
7b1dde1f10 build(deps): bump github/codeql-action from 4.32.4 to 4.32.5 (#50039)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.4 to 4.32.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](89a39a4e59...c793b717bc)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 12:07:37 -05:00
Robo
5eb1e1bf89 fix: uaf in non-client hittest during view teardown (#50042)
* fix: uaf in non-client hittest during view teardown

* chore: update crash spec
2026-03-04 00:29:49 +09:00
dependabot[bot]
6418847fd2 build(deps): bump actions/download-artifact from 7.0.0 to 8.0.0 (#50037)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 7.0.0 to 8.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](37930b1c2a...70fc10c6e5)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 16:00:15 +01:00
Mitchell Cohen
2f13d85785 fix: better shortcut registration and app icon matching on Wayland (#49988)
* fix: set default desktop name that matches exec name on linux

* chromium patches for global shortcuts

* use app name for shortcut description
2026-03-03 15:37:54 +01:00
Shelley Vohr
6d2fc4e5cb fix: validate USB device selection against filtered device list (#50002)
* fix: validate USB device selection against filtered device list

Previously, UsbChooserController::OnDeviceChosen looked up the chosen
device_id via chooser_context_->GetDeviceInfo(), which searches all
known USB devices on the system rather than the filtered list shown to
the select-usb-device handler. This meant a device excluded by the
renderer's filters or exclusion_filters could still be granted
permission if the handler returned its GUID.

* bump for CI

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-03 10:44:33 +01:00
dependabot[bot]
f037673655 build(deps): bump actions/upload-artifact from 6.0.0 to 7.0.0 (#50038)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](b7c566a772...bbbca2ddaa)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 10:41:43 +01:00
electron-roller[bot]
238699221e chore: bump chromium to 147.0.7713.0 (main) (#49975)
* chore: bump chromium in DEPS to 147.0.7708.0

* chore: update patches

* chore: bump chromium in DEPS to 147.0.7709.0

* chore: bump chromium in DEPS to 147.0.7710.0

* chore: bump chromium in DEPS to 147.0.7713.0

* 7603876: Remove OriginatingProcess and RendererProcess overloads

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7603876

Co-Authored-By: Claude (claude-opus-4-20250514)

* 7596126: Clean up StoragePartitionImpl bucket data deletion.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7596126

* fix(patch): ENABLE_GLIC guard removed upstream

Upstream removed the #if BUILDFLAG(ENABLE_GLIC) guard around
ShouldShowGlicSummarizeButton, making the code unconditional.
Restructured the patch to use #if 0 / #else / #endif instead.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7616763

Co-Authored-By: Claude (Anthropic)

* fix(patch): Win32 API :: scope qualifiers

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7613666

Co-Authored-By: Claude (Anthropic)

* chore: update patches (trivial only)

* docs: add skip-and-recreate warning to chromium upgrade skill

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-03 13:54:44 +09:00
Noah Gregory
0ae46d71d3 fix: add explicit JSON property mappings for SQRLShipItRequest model (#49980)
* fix: add explicit JSON property mappings for SQRLShipItRequest model

* style: add patch body to mantle v2 fix patch
2026-03-02 20:48:41 -08:00
Shelley Vohr
9f9a5b8b9b fix: prevent use-after-free in permission request callbacks (#50032)
EnterFullscreenModeForTab, RequestPointerLock, and RequestKeyboardLock
bind callbacks with base::Unretained(this); fullscreen also captures a
raw RenderFrameHost*. These callbacks may be invoked by the app's JS
permission handler after the WebContents or RenderFrameHost is destroyed.

Use GetWeakPtr() in all three call sites, and capture a
GlobalRenderFrameHostToken instead of the raw RenderFrameHost* for
fullscreen so the pointer is resolved and null-checked only when the
callback fires. Cancel in-flight permission requests from ~WebContents()
via a new ElectronPermissionManager::CancelPendingRequests()` so stale
callbacks are never handed back to JS.
2026-03-02 19:01:24 -05:00
GUNDUPU JAYA KRISHNA
21a2bfca16 fix(styles): add missing dot prefix to .hero-icon.loop-3 CSS selector (#49950) 2026-03-02 13:11:25 -05:00
Zach Waugh
89483e7e89 feat: add macOS-only api to determine if app is currently active (#49622)
* feat: add macOS-only api to determine if app is currently active

You can `focus()` the app and get events for `did-become-active`, but there's currently not a way to directly check if your app is the active (foreground) application.

* test: add unit test for app.isActive api

* fix: ensure we hide app after showing in test

If the app is still active, it may affect other tests like dock.bounce
that behave differently depending on whether the app is active

* docs: simplify isActive api description
2026-03-02 11:47:37 -05:00
Shelley Vohr
4c3565fb88 feat: show toast dismissal reason on Windows (#49913)
* feat: show toast dismissal reason on Windows

* Update docs/api/notification.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-02 11:38:51 -05:00
Shelley Vohr
e1e11c8fbe build: authenticate curl requests to googlesource in lint workflow (#50001)
fix: authenticate curl requests to googlesource in lint workflow

The "Download GN Binary" and "Download clang-format Binary" steps
fetch files from chromium.googlesource.com without passing
authentication cookies. When googlesource rate-limits or returns a
transient error (502), the HTML error page is piped into `base64 -d`,
causing `base64: invalid input`.

The `set-chromium-cookie` action already configures `~/.gitcookies`
in a prior step. Pass `-b ~/.gitcookies` to both `curl` calls so
they authenticate, matching what the cookie verification step itself
does.
2026-03-02 11:29:49 -05:00
Shelley Vohr
222c989f13 fix: bind offscreen paint callback to child WebContents (#49998)
fix: bind offscreen paint callback to child WebContents

Previously, MaybeOverrideCreateParamsForNewWindow bound the
OffScreenWebContentsView's paint callback to the parent WebContents
using base::Unretained(this). This was both unsafe (dangling pointer
risk if the parent is destroyed before the child) and semantically
incorrect — paint events belong to the child window, not the opener.

Replace the callback in MaybeOverrideCreateParamsForNewWindow with
base::DoNothing(), then rebind it to the child WebContents in
AddNewContents via a new SetCallback method on OffScreenWebContentsView.
2026-03-02 11:24:48 -05:00
Samuel Attard
838d30510f fix: use destination context when wrapping VideoFrame in contextBridge (#49997)
Enter the destination context scope before creating the VideoFrame V8
wrapper, matching the sibling Element and Blob branches. Without this,
ScriptState::ForCurrentRealm resolved to the calling context instead of
the target context, producing an incorrect wrapper.

Also switch to ScriptState::From with an explicit context argument to
make the intent clearer.

Adds spec coverage for VideoFrame crossing the bridge in both
directions and adds VideoFrame to the existing prototype checks.
2026-03-02 08:18:19 -08:00
Samuel Attard
ee76e549fa fix: use setter's creation context when proxying setter in OverrideGlobalPropertyFromIsolatedWorld (#49990)
The setter branch was deriving source_context from getter-> instead of
setter->. Currently latent since the only call site passes both from
the same preload context, but this would crash or mis-resolve if a
future call site passed a setter without a getter or from a different
context.
2026-03-02 08:18:00 -08:00
Samuel Attard
97fceb5f7c docs: add PR labeling guidance to CLAUDE.md (#49992)
Document semver/* and target/* label conventions so Claude Code
can automatically apply the right labels when opening PRs against
electron/electron. Includes a gh one-liner to discover currently
active target branches via label color.

Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-03-02 16:05:31 +00:00
Shelley Vohr
6dcec79bba chore: remove unused commandLineSwitches flag (#49993)
chore: remove unused commandLineSwitches flag
2026-03-02 10:30:13 -05:00
Shelley Vohr
07dcba74b3 fix: potential UAF in OnDownloadPathGenerated (#50003)
fix: potential UAF in OnDownloadPathGenerated
2026-03-02 10:28:14 -05:00
Dante Issaias
839cc5b879 fix: deliver Universal Links when NSUserActivity.userInfo is nil (#49986)
* fix(mac): deliver Universal Links when NSUserActivity.userInfo is nil

* chore: format
2026-03-02 14:28:52 +01:00
Samuel Attard
d0241ea27d fix: delete temporary blink* globals after restoring Blink implementations (#49991)
ElectronRendererClient::DidCreateScriptContext (and the worker
equivalent) save Blink's fetch/Response/FormData/Request/Headers/
EventSource as temporary globalThis.blink* properties before Node
initialization may overwrite them. node/init.ts and worker/init.ts
restore the originals but previously never deleted the temporary
blink* globals.

They persisted as non-standard global pollution visible to page
content when contextIsolation is disabled -- a minor fingerprinting
signal and a bypass for any preload that wraps window.fetch (page
could call blinkfetch() instead).
2026-03-02 10:44:49 +00:00
WofWca
20dfc93f3a fix: menu bar hiding on two setFullscreen(false) (#45930)
* test: add failing test for `setFullscreen(false)`

`setFullscreen(false)` should do nothing
when not already in fullscreen, but it hides the menu bar
on Linux.

* fix: menu bar hiding on two setFullScreen(false)

This fixes the following bug on Linux (and maybe macOS):
1. Create a window with a menu bar.
2. Call `win.setFullScreen(false)`.

The menu bar will hide.

See the original bug in our project:
https://github.com/deltachat/deltachat-desktop/issues/4752.
2026-03-02 10:01:30 +01:00
electron-roller[bot]
2bd7758ec1 chore: bump chromium to 147.0.7707.0 (main) (#49965)
* chore: bump chromium in DEPS to 147.0.7706.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 147.0.7707.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-27 16:12:17 -05:00
dependabot[bot]
806b7e19a3 build(deps): bump basic-ftp from 5.0.5 to 5.1.0 in the npm_and_yarn group across 1 directory (#49954)
build(deps): bump basic-ftp in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [basic-ftp](https://github.com/patrickjuchli/basic-ftp).


Updates `basic-ftp` from 5.0.5 to 5.1.0
- [Release notes](https://github.com/patrickjuchli/basic-ftp/releases)
- [Changelog](https://github.com/patrickjuchli/basic-ftp/blob/master/CHANGELOG.md)
- [Commits](https://github.com/patrickjuchli/basic-ftp/compare/v5.0.5...v5.1.0)

---
updated-dependencies:
- dependency-name: basic-ftp
  dependency-version: 5.1.0
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-27 14:13:36 -05:00
Shelley Vohr
3d1cc3970b fix: update label/sublabel/icon in MenuItems on open (#49678)
fix: update label/sublabel/icon in macOS item on open
2026-02-27 12:47:05 -05:00
Mitchell Cohen
6a440f0bc9 fix: correct window sizing on Linux when constraints on resizability are enforced (#49903)
* fix window sizing on linux when constraints are applied

* added tests

* apply window style directly when changing resizability

* Revert "apply window style directly when changing resizability"

This reverts commit 949e2ee2ab.

* set size constraints for resizability on window and linux
2026-02-27 12:33:21 -05:00
electron-roller[bot]
699445f5da chore: bump chromium to 147.0.7705.0 (main) (#49958)
* chore: bump chromium in DEPS to 147.0.7705.0

* chore: update patches (trivial only)

* 7607719: Refactor predictors GN targets and clean up LCPP unittest params

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7607719

Co-Authored-By: Claude (claude-3-5-sonnet)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-26 16:56:30 -05:00
Charles Kerr
e3d8c9fcdf refactor: replace std::to_string() with base::NumberToString() (#49949) 2026-02-26 14:57:54 -05:00
Jarek Radosz
55d9e48c35 fix: menu close event missing after opening a submenu (#49783)
* fix: menu close event missing after opening a submenu

* add a unit-like test
2026-02-26 10:40:29 -05:00
electron-roller[bot]
96ad701dd0 chore: bump node to v24.14.0 (main) (#49941)
* chore: bump node in DEPS to v24.14.0

* lib: prefer call() over apply() if argument list is not array

https://github.com/nodejs/node/pull/60796

* build,deps: replace cjs-module-lexer with merve

https://github.com/nodejs/node/pull/61456

* chore: fixup patch indices

* test: use fixture directories for sea tests

https://github.com/nodejs/node/pull/61167

* src: throw RangeError on failed ArrayBuffer BackingStore allocation

https://github.com/nodejs/node/pull/61480

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-26 10:32:14 -05:00
Charles Kerr
aee0661046 refactor: simplify BaseWindow parent<->child association code (#49537)
* refactor: simplify BaseWindow parent<->child association code

* refactor: remove unnecessary local variable from BaseWindow::GetParentWindow()
2026-02-26 09:22:42 -06:00
electron-roller[bot]
227cc02aee chore: bump chromium to 147.0.7703.0 (main) (#49935)
* chore: bump chromium in DEPS to 147.0.7702.0

* chore: update patches (trivial only)

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* chore: bump chromium in DEPS to 147.0.7703.0

* 7582039: [Extensions] Use dependency injection for ManifestHandlerRegistry

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7582039

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* 7582477: spanification: migrate base::ReadUnicodeCharacter usage to string_view

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7582477

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* chore: update patches (trivial only)

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* 7590029: Remove 5 unused deprecated sync methods in ui::Clipboard

Migrate clipboard API calls from synchronous methods to async callback-based
methods with RunLoop pattern.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7590029

* 7599553: [rust png] Chromium: Update `png` to version `0.18.1`.

https://chromium-review.googlesource.com/c/chromium/src/+/7599553
Chromium updated their to Rust PNG implementation which produces
different (but valid) PNG output. Update tests to compare raw bitmap
data instead of encoded PNG data URLs.

* test: fixup clipboard tests to properly handle urls

Needed after migrating clipboard API calls from synchronous methods to async callback-based methods with RunLoop pattern.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7590029

* fixup "7599553: [rust png] Chromium: Update `png` to version `0.18.1`."

https://chromium-review.googlesource.com/c/chromium/src/+/7599553
Chromium updated their Rust PNG implementation which produces
different (but valid) PNG data URLs.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-26 08:21:31 -05:00
yureiblack
128880988e test: correct typo in node-spec.ts comment (#49141)
fix: correct typo in node-spec.ts comment
2026-02-25 23:03:06 -08:00
Shelley Vohr
8d05285a1f fix: potential std::stoi crash in Windows Toasts (#49947)
fix: potential std::stoi crash in Windows Toasts
2026-02-25 14:14:45 -08:00
Mitchell Cohen
6a2571ee3d ci: Wayland test job, helpers, and app spec (#49908)
* wayland test chromium patch

* ci: add wayland test job and helpers

* use weston directly instead of wlheadless-run

* roll build image to eac3529

* fixed exec command

* Update .github/workflows/pipeline-segment-electron-test.yml

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* Update .github/workflows/pipeline-segment-electron-test.yml

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* chore: fixup shard case statement

* reverted leftover patch line

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-25 14:51:13 -05:00
Shelley Vohr
94aa90bb64 fix: recover network requests after Network Service restart (#49887)
* fix: recover network requests after Network Service restart

* chore: reuse implementation

* chore: make linter happy

* chore: fix lint

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-25 12:53:06 -05:00
zonescape
b9a09acff3 docs: mark "Show hidden files" file dialog setting as deprecated on Linux (#46926)
* fix: don't overwrite "Show hidden files" setting on Linux/GTK

* docs: deprecate showHiddenFiles property in dialogs on Linux

* docs: mark Electron 42 as the removal date for this feature

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-25 11:05:01 -05:00
David Sanders
fd9bf54243 build: fix Chromium roll linting merge base determination in CI (#49937) 2026-02-25 08:38:31 -05:00
John Kleinschmidt
d9170093aa build: exit upload with error code if github upload fails (#49936) 2026-02-25 14:16:13 +01:00
David Sanders
aca83afeef ci: add maintainer /request-review command (#49927)
Assisted-by: Claude Opus 4.6
2026-02-24 20:13:37 -08:00
electron-roller[bot]
e5d3fbf6dc chore: bump chromium to 147.0.7699.0 (main) (#49831)
* chore: bump chromium in DEPS to 147.0.7693.0

* chore: bump chromium in DEPS to 147.0.7694.0

* chore: bump chromium in DEPS to 147.0.7695.0

* chore: bump chromium in DEPS to 147.0.7697.0

* chore: bump chromium in DEPS to 147.0.7698.0

* fix(patch): IsGuest moved to SecurityPrincipal

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234613

Co-Authored-By: Claude (claude-opus-4-6)

* chore: update patches (trivial only)

* fix(patch): v8::External API now requires ExternalPointerTypeTag

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7562476

Co-Authored-By: Claude (claude-opus-4-6)

* fix: update CreateCustomWebContents signature

Upstream added disposition and window_features parameters.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7585256

Co-Authored-By: Claude (claude-opus-4-6)

* fix: OriginatingProcess renamed to OriginatingProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7557820

Co-Authored-By: Claude (claude-opus-4-6)

* fix: kLogNetLog moved from network::switches to net::switches

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7559090

Co-Authored-By: Claude (claude-opus-4-6)

* fix(patch): patch out glic and save-to-drive Profile usage in PDF

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7589312

Co-Authored-By: Claude (claude-opus-4-6)

* chore: bump chromium in DEPS to 147.0.7699.0

* chore: remove upstreamed pseudonymization salt descriptor code

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7568382

Co-Authored-By: Claude (claude-opus-4-6)

* chore: update patches (trivial only)

* chore: update reclient patch format (copy-from to new-file)

Co-Authored-By: Claude (claude-opus-4-6)

* chore: remove upstreamed patch and update stale patches

Co-Authored-By: Claude (claude-opus-4-6)

* fix: expose GetLibGdk3 and guard glic function body

GetLibGdk3 needs to be public for Electron's gdk_display_beep usage.
ShouldShowGlicSummarizeButton body must be guarded, not just call site.

Co-Authored-By: Claude (claude-opus-4-6)

* fix(patch): v8::External API in nan requires ExternalPointerTypeTag

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7562476

Co-Authored-By: Claude (claude-opus-4-6)

* fixup fix(patch): v8::External API in nan requires ExternalPointerTypeTag

* fixup: remove extraneous changes to patches

Caused by
debb371681
6e51034728

* fixup: revert fix: expose GetLibGdk3 and guard glic function body

Reverts 6e51034728 as this was an unneeded changed caused by the incorrect changes made in debb371681

* 7586673: Update logic for showing pdf summarize button

7586673: Update logic for showing pdf summarize button | https://chromium-review.googlesource.com/c/chromium/src/+/7586673

Also 7454131: set enable_glic=true | https://chromium-review.googlesource.com/c/chromium/src/+/7454131 (landed in previous roll)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-24 16:42:05 -05:00
Shelley Vohr
0aaea4eaa0 fix: crash after win.showAllTabs() new tab (#49917)
fix: crash after win.showAllTabs new tab
2026-02-24 16:09:09 -05:00
dependabot[bot]
818b28410f build(deps): bump github/codeql-action from 4.32.3 to 4.32.4 (#49925)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.3 to 4.32.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](9e907b5e64...89a39a4e59)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.4
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-24 16:13:04 +01:00
David Sanders
25db585a23 docs: fix some string enum typings (#49923) 2026-02-24 16:11:22 +01:00
dependabot[bot]
02eed1ec0b build(deps): bump actions/stale from 10.1.1 to 10.2.0 (#49924)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.1 to 10.2.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](997185467f...b5d41d4e1d)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.2.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-24 16:11:18 +01:00
Mitchell Cohen
acd01e15e2 fix: prevent crash on Windows when closing child windows (#49901)
* guard against window destruction in min/max size checks

* use weakptr to prevent hit test crash on teardown

* revove web contents views during teardown

* fix test failure

* fix other tests
2026-02-24 15:48:04 +01:00
David Sanders
fc3a0abf19 build: fix roller branch detection in CI (#49920) 2026-02-23 18:10:22 -08:00
David Sanders
fa2b9ac466 ci: fix checking latest release for website docs update (#49918) 2026-02-23 15:22:01 -08:00
Andre Hora
481e224992 docs: remove documentation link to discontinued Touch Bar Simulator (#49899)
Remove link to discontinued Touch Bar Simulator

https://github.com/sindresorhus/touch-bar-simulator is archived.

> This app is discontinued as it no longer works because of changes in macOS.
2026-02-23 15:04:31 -05:00
Shashwat Raj
90c9de70ac fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)
Updated Alt detection to explicitly exclude AltGraph/AltGr
2026-02-23 13:00:27 -05:00
Shelley Vohr
9d0a0a5459 fix: apply zoomFactor from setWindowOpenHandler to window.open() windows (#49886)
fix: apply zoomFactor from setWindowOpenHandler to window.open() windows
2026-02-23 09:02:48 +01:00
Erick Zhao
19d0c072d5 feat: lazy electron download (#49328)
* feat: lazy electron download

* better error messaging?

* add breaking changes script doc

* add binary download step to install instructions

* respect no binary env var
2026-02-20 15:35:38 -05:00
redeemer
2b80f4ccc9 fix: prevent GBytes leak in GdkPixbufFromSkBitmap on Linux/GTK (#49863)
Inside gtk_util::GdkPixbufFromSkBitmap, g_bytes_new() was called
inline as an argument to gdk_pixbuf_new_from_bytes(), which per
GTK docs does not take ownership of the GBytes - it adds its own
internal reference. The caller's GBytes* was never stored or
unreffed, leaking 4 x width x height bytes of pixel data on every
call.
2026-02-20 15:00:46 -05:00
Shelley Vohr
5795689fd9 fix: fullscreen restoration on Windows (#49872) 2026-02-20 11:58:37 -05:00
Shelley Vohr
3e58c6cb3a fix: refresh menu item state on key equivalent dispatch (#49875) 2026-02-20 11:35:44 -05:00
Mitchell Cohen
ea89ba5b8d feat: Shadows and CSD for frameless windows on Wayland (#49295)
* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* layout helper

* CSD shadows for frameless windows on Linux

* simplify min/max size calculation

* use base window size for min/max

* respect HasShadow option

* moved windows min/max size overrides

* add newline at end of file

* fix setting background color for frameless csd windows

* fix wco positioning nad sizing to match prod

* safety improvements
2026-02-19 18:53:13 -06:00
Niklas Wenzel
5ddd8a0200 feat: add support for --experimental-transform-types (#49711)
* feat: add support for `--experimental-transform-types`

* chore: add tests

* docs: add `--experimental-transform-types` to docs
2026-02-19 20:27:49 +01:00
Nilay Arya
8b81bfda8f ci: log mocha retries in spec runner (#49150) 2026-02-19 11:30:46 -05:00
reito
491fa0442b fix: rgbaf16 shared texture remove keyed mutex. (#49798)
* fix: rgbaf16 shared texture remove keyed mutex.

* fix: rgbaf16 patch.

* 更新 shared-texture-handle.md

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-19 11:28:53 -05:00
Shelley Vohr
b508510cab fix: update DBus signal signature for XDG GlobalShortcuts portal (#49842) 2026-02-19 15:22:27 +01:00
David Sanders
469b2af0c0 chore: use relative links from docs/ to files outside of docs/ (#49605) 2026-02-19 01:15:27 -08:00
Noah Gregory
61b3d5d63c refactor: initialize libgdk stubs before use in platform_util:Beep (#49680)
* refactor: initialize libgdk stubs before use in `platform_util:Beep`

* feat: add upstream function to get libgdk handle

* fix: add missing include for libgdk support

* style: adjust comment wording and make linter happy

* style: make linter actually happy
2026-02-19 09:59:10 +01:00
reito
1e437c9a18 feat: use 1.0f as default for offscreen scale factor. (#49683) 2026-02-19 09:58:29 +01:00
David Sanders
efb3fd98c6 build: lint commits on Chromium roller branches (#49655)
* build: lint commits on Chromium roller branches

Assisted-By: Claude Opus 4.5

* chore: add ability to skip linting CLs by adding #nolint

* chore: only exit with non-zero exit code in CI
2026-02-18 20:45:44 -08:00
Shelley Vohr
9ca9311b73 docs: note required windows in 'new-window-for-tab' event (#49851)
docs: note required windows in new-window-for-tab
2026-02-18 19:30:43 -08:00
Samuel Attard
8b05717661 docs: clarify ASAR integrity is supported in MAS builds (#49852)
* docs: clarify ASAR integrity is supported in MAS builds

Add a note to the ASAR integrity documentation explicitly stating
that this feature is fully supported and recommended in Mac App
Store builds. While MAS-installed apps have system-level protections,
ASAR integrity provides an additional security layer and is important
for MAS builds distributed outside the Mac App Store.

Slack thread: https://electronhq.slack.com/archives/CB6CG54DB/p1771449093872419?thread_ts=1771446183.473289&cid=CB6CG54DB

https://claude.ai/code/session_01A97nfiqHUVxLNaQyHVXS7j

* docs: clarify ASAR integrity support for MAS builds

Updates the ASAR integrity documentation to explicitly mention that
it is supported and recommended in Mac App Store builds. Clarifies
that while MAS-installed apps have system-level protections (Resources
folder owned by root), ASAR integrity is especially important when
distributing MAS builds through other channels like direct download,
since those installations won't have the read-only protections.

https://claude.ai/code/session_012mBNZQW34h91NRcdFaLxNh

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-02-18 14:14:00 -08:00
John Kleinschmidt
be45b5f8e7 ci: fixup build stats upload on Windows (#49845) 2026-02-18 15:00:30 -05:00
dependabot[bot]
87597a99de build(deps-dev): bump webpack from 5.95.0 to 5.104.1 in the npm_and_yarn group across 1 directory (#49779)
build(deps-dev): bump webpack

Bumps the npm_and_yarn group with 1 update in the / directory: [webpack](https://github.com/webpack/webpack).


Updates `webpack` from 5.95.0 to 5.104.1
- [Release notes](https://github.com/webpack/webpack/releases)
- [Changelog](https://github.com/webpack/webpack/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack/compare/v5.95.0...v5.104.1)

---
updated-dependencies:
- dependency-name: webpack
  dependency-version: 5.104.1
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-18 14:22:25 -05:00
Shelley Vohr
3ed52a3ded build: roll sysroots (#49844) 2026-02-18 13:24:29 -05:00
Shelley Vohr
dfdf04976e fix: draggable region position with docked DevTools (#49822) 2026-02-18 11:49:18 -05:00
Shelley Vohr
f4ba25a3da fix: frameless window resize in MAS builds (#49780) 2026-02-18 10:35:10 -05:00
Robo
05061544ab feat: enable WASM trap handlers in all Node.js processes (#48983)
fix: enable WASM trap handlers in all Node.js processes

```
Original reason for revert:

Some apps started throwing exception on startup
https://github.com/electron/electron/issues/48956
```

We now move the trap handler registeration before
any user script execution. Add a fuse to support
disabling the feature is application needs to run
in memory constrained environments.
2026-02-18 12:08:03 +09:00
Sam Maddock
10566c2d5f test: MAS for private API usage (#49712) 2026-02-17 15:29:21 -05:00
Mitchell Cohen
931c257de7 fix: accurate window sizing and support for content sizing on Linux/Wayland with CSD (#49209)
* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* simplify min/max size calculation

* use base window size for min/max

* moved windows min/max size overrides

* remove unnecessary checks for client frame

* cleanup
2026-02-17 15:23:54 -05:00
Ronald Eddy Jr
459a88f788 docs: fix typos across tutorial documentation (#49736) 2026-02-17 14:47:45 -05:00
electron-roller[bot]
c98cf69f40 chore: bump chromium to 147.0.7687.0 (main) (#49782)
* chore: bump chromium in DEPS to 147.0.7683.0

* fix(patch): constant moved to header

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* fix(patch): occlusion simplification upstream

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7563790

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: remove upstreamed patches

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: bump chromium in DEPS to 147.0.7685.0

* fix(patch): V1 Keychain removal

Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted

keychain_password_mac.mm to use KeychainV2 APIs.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7535923: Rename ozone buildflags

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7528398: [LNA] Rename PNA-named files to LNA-named files

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528398

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7534194: Convert some functions in ui::Clipboard to async

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7544580: [DevTools] Add command to restart Chrome to DevTools UI bindings

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7544580

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: bump chromium in DEPS to 147.0.7687.0

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: incorporate learnings into claude skill

I asked Claude to reflect on our upgrade session, consider what it learned and should know in the future, and to update its skill documents.

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-02-17 14:25:21 -05:00
John Kleinschmidt
0da0c3a47e build: use spawn instead of spawnSync for build (#49774) 2026-02-17 13:24:19 -05:00
John Kleinschmidt
f19cfce430 chore: add Copilot CLI instructions (#49784)
chore: add copilot-instructions
2026-02-17 09:49:59 -05:00
dependabot[bot]
ca61f2d7df build(deps): bump actions-cool/issues-helper from 3.7.5 to 3.7.6 (#49813)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.5 to 3.7.6.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](e2ff99831a...71b62d7da7)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-17 11:24:20 +01:00
dependabot[bot]
1322bee878 build(deps): bump github/codeql-action from 4.32.2 to 4.32.3 (#49814)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.2 to 4.32.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](45cbd0c69e...9e907b5e64)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-17 11:24:06 +01:00
Samuel Attard
dda71a464c chore: add PR Notes section requirement to CLAUDE.md (#49816)
docs: add PR Notes section requirement to CLAUDE.md

Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-02-17 01:02:52 -08:00
Shelley Vohr
a056c63fd8 fix: excise abort_report_np usage in MAS (#49726)
* fix: excise abort_report_np usage in MAS

* chore: fix it harder
2026-02-16 12:23:53 +01:00
reito
bf3eb098bd fix: missing shared texture docs (#49797) 2026-02-16 10:51:31 +01:00
Shelley Vohr
67cced1270 build: remove *.star files (#49796) 2026-02-16 10:49:39 +01:00
Shelley Vohr
eb29568e45 feat: introduce os_crypt_async in safeStorage (#49054)
* feat: support Freedesktop Secret Service OSCrypt client

Refs https://issues.chromium.org/issues/40086962
Refs https://issues.chromium.org/issues/447372315

* chore: rework to async interface

* refactor: allow customizing freedesktop config

* docs: add more async impl info

* refactor: reject when temporarily unavailable

* chore: feedback from review

* chore: push_back => emplace_back
2026-02-15 19:54:50 +01:00
Shelley Vohr
dcdbb0397e feat: allow defaulting to printer default page size (#49523)
Co-authored-by: Edvan de Matos <edvan.santos@querodelivery.com>
2026-02-13 07:40:14 -05:00
electron-roller[bot]
3a5f9e0a33 chore: bump node to v24.13.1 (main) (#49744)
* chore: bump node in DEPS to v24.13.1

* chore: fixup patches

refs:
* https://github.com/nodejs/node/pull/60425
* https://github.com/nodejs/node/pull/61270
* https://github.com/nodejs/node/pull/61044

* fix: generate_config_gypi needs to generate valid JSON

https://github.com/nodejs/node/pull/60794

* doc: align Buffer.concat documentation with behavior

https://github.com/nodejs/node/pull/60405

* src: fix off-thread cert loading in bundled cert mode

https://github.com/nodejs/node/pull/60764

* build: fix extraneous includes

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-13 09:48:05 +01:00
Keeley Hammond
f90e35cb45 chore: cherry-pick e045399a1ecb from chromium (#49788)
* chore: cherry-pick e045399a1ecb from chromium

* chore: update patch
2026-02-12 19:24:19 -08:00
Shelley Vohr
74fd10450f feat: improve Windows Toast actions support (#48132)
* feat: improve Windows Toast actions support

* fix: ensure MSIX compatibility

* test: add bad clsid format test
2026-02-12 17:25:20 -05:00
electron-roller[bot]
a65cfed500 chore: bump chromium to 146.0.7666.0 (main) (#49528)
* chore: bump chromium in DEPS to 146.0.7652.0

* fix(patch-conflict): update mas_avoid_private_macos_api_usage context for constrainFrameRect method

The upstream CL added a new constrainFrameRect:toScreen: method override to
NativeWidgetMacNSWindow as part of headless mode window zoom implementation.
The MAS patch's #endif for frameViewClassForStyleMask now correctly appears
after that method, since constrainFrameRect is a public API override that
doesn't need to be guarded.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7487666

* fix(patch-conflict): update printing.patch for base::DictValue rename

Updated printing.patch to use the new base::DictValue type name instead of
base::Value::Dict following Chromium's type renaming change. This affects
CompleteUpdatePrintSettings() signature and related code.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* fix(patch-conflict): update accessibility_ui patch for base::DictValue/ListValue rename

Updated adjust_accessibility_ui_for_electron.patch to use the new
base::DictValue and base::ListValue type names instead of base::Value::Dict
and base::Value::List following Chromium's type renaming change.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* chore: update patches

* 6625736: Rename DURABLE_STORAGE to PERSISTENT_STORAGE for consistency | https://chromium-review.googlesource.com/c/chromium/src/+/6625736

* chore: bump chromium in DEPS to 146.0.7653.0

* chore: update patches

* 7000847: add type tag to v8::External for gin_helper function templates

The upstream gin function templates now use v8::ExternalPointerTypeTag
for type safety when using v8::External. Updated Electron's forked
gin_helper function template to use the same kGinInternalCallbackHolderBaseTag
that Chromium's gin uses.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* fix(patch-update): extend V8 Object API deprecation patch for Node.js

Extended the existing patch to cover additional files that use
GetAlignedPointerFromInternalField and SetAlignedPointerInInternalField:
- src/stream_base-inl.h
- src/udp_wrap.cc
- src/js_udp_wrap.cc
- src/node_process_methods.cc
- src/node_snapshotable.cc
- src/base_object.cc

These APIs now require an EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* 7000847: add type tag to v8::External calls in shared_texture

Updated v8::External::New and v8::External::Value calls to use the
kExternalPointerTypeTagDefault tag as required by the V8 API change
that deprecates the tagless versions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* 7508687: use ChildProcessId for file permission APIs

The ChildProcessSecurityPolicy::CanReadFile and GrantReadFile APIs
now require ChildProcessId instead of int. Updated to use GetID()
instead of GetDeprecatedID() for these specific calls.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7508687

* 7000847: add type tag to v8::External calls in callback and osr_converter

The v8::External API now requires an EmbedderPointerTypeTag parameter
for both New() and Value() methods to improve V8 sandbox type safety.

Updated calls in:
- callback.cc: TranslatorHolder constructor and CallTranslator
- osr_converter.cc: OffscreenSharedTextureValue converter

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7000847

* fixup! 7087956: [api] Promote deprecation of v8::Context and v8::Object API methods

Extended the Node.js patch to cover histogram.cc which also uses
SetAlignedPointerInInternalField and GetAlignedPointerFromInternalField
APIs that now require the EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* chore: bump chromium in DEPS to 146.0.7655.0

* chore: update patches

* 7509043: update WebSpellingMarker type for API change

The upstream Chromium API changed - WebSpellingMarker was moved from a
nested type within WebTextCheckClient to a standalone type in the blink
namespace.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509043

* 7498491: update process_id to use OriginatingProcess type

The upstream Chromium API changed - URLLoaderFactoryParams::process_id
was changed from an integer to a union type network::OriginatingProcess
that distinguishes between browser and renderer processes.

- For browser process requests, use OriginatingProcess::browser()
- For renderer process lookups, check !is_browser() and use
  renderer_process().value() to get the child_id

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7498491

* 5710330: Add crash keys to debug NativeWidgetMacNSWindowBorderlessFrame exception | https://chromium-review.googlesource.com/c/chromium/src/+/5710330

5710330 added a new NSNextStepFrame interface extension and
implementations for NativeWidgetMacNSWindowTitledFrame and
NativeWidgetMacNSWindowBorderlessFrame. These use private macOS APIs
that are not available in Mac App Store builds.

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7661.0

* chore: bump chromium in DEPS to 146.0.7663.0

* fix(patch-conflict): update accessibility_ui for string_view API change

Upstream removed redundant std::string(default_api_type) conversion as part
of a string_view optimization cleanup. Updated patch context to match.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7514107

* fix(patch-conflict): update service process launch options for sandbox API refactor

Upstream removed content/common/sandbox_init_win.cc and
content/public/common/sandbox_init_win.h, moving the functionality directly
into ChildProcessLauncherHelper. Updated patch to call
sandbox::policy::SandboxWin::StartSandboxedProcess directly with the
LaunchOptions pointer instead of going through the removed helper.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528253

* fix(patch-conflict): update MAS safestorage for keychain API refactor

Upstream refactored KeychainPassword::GetPassword() to use a new
GetPasswordImpl() helper function with improved error tracking via
base::expected<std::string, OSStatus>. Adapted patch to use the new
GetPasswordImpl with the suffixed account name and handle migration
from legacy accounts through the new API.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7516438

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7663.0

* fix: base::Value::Dict -> base::DictValue
https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: include new cookie exclusion reason
https://chromium-review.googlesource.com/c/chromium/src/+/7486527

* fix: enable libc++ ABI flag for trivially copyable std::vector<bool>

Required for changes introduced in the following CL
https://chromium-review.googlesource.com/c/chromium/src/+/7513653

* fixup! fix: base::Value::Dict -> base::DictValue https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: spellcheck not working in tests
https://chromium-review.googlesource.com/c/chromium/src/+/7452579

* fix: cookie test failing due to multiple rejection reasons
https://chromium-review.googlesource.com/c/chromium/src/+/7506629

* fix: macos sizing unmaximized window incorrectly
https://chromium-review.googlesource.com/c/chromium/src/+/7487666

Changes to headless mode caused the unmaximized window to subtract
the height of the menubar.

* fix: skip tests for incompatible BoringSSL ML-DSA crypto
https://boringssl-review.googlesource.com/c/boringssl/+/84929

* test: fix pseudonymization registration in utility process on Linux

Ref: 7486913: Pass pseudonymization salt via shared memory at process launch | https://chromium-review.googlesource.com/c/chromium/src/+/7486913

* fix: restore MAS patch-outs

Restores some `#if !IS_MAS_BUILD()` gates dropped in 773054ad59

* fixup! 7508687: use ChildProcessId for file permission APIs

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

* chore: add note about parallel upstream change

* fixup! Merge remote-tracking branch 'origin/main' into roller/chromium/main

* Revert "fixup! 7508687: use ChildProcessId for file permission APIs"

This reverts commit 05c43e4e5d.

The _impl version has the signature, but not the public interface. :oof:

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
2026-02-12 12:37:56 -05:00
Calvin
e9faa14cc0 test: drag region tests (#49266) 2026-02-12 01:50:02 -06:00
Niklas Wenzel
ce47542ccd feat: add support for long-animation-frame script attribution (#49706)
* feat: add support for `long-animation-frame` script attribution

* docs: document `AlwaysLogLOAFURL`

* chore: add test

* docs: adjust docs as per PR comment

* fix: test failures

* chore: simplify test

* fix: tests on Windows and Linux
2026-02-11 09:34:22 -08:00
dependabot[bot]
ff2df2c98a build(deps): bump diff from 3.5.0 to 3.5.1 in the npm_and_yarn group across 1 directory (#49666)
build(deps): bump diff in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [diff](https://github.com/kpdecker/jsdiff).


Updates `diff` from 3.5.0 to 3.5.1
- [Changelog](https://github.com/kpdecker/jsdiff/blob/master/release-notes.md)
- [Commits](https://github.com/kpdecker/jsdiff/compare/v3.5.0...v3.5.1)

---
updated-dependencies:
- dependency-name: diff
  dependency-version: 3.5.1
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-11 16:52:05 +01:00
John Kleinschmidt
0284b9afcc build: fixup attestation for release assets (#49732)
* build: fixup attestation for release assets

* Generate artifact attestation for generated artifacts

* set id-token for attestation

* Add artifact-metadata permission for attestation

* add permissions for testing attestations

* Revert "add permissions for testing attestations"

This reverts commit 0284bed175.

* Revert "set id-token for attestation"

This reverts commit 69a1b13a18.

* Revert "Generate artifact attestation for generated artifacts"

This reverts commit ee0536eceb.
2026-02-11 07:17:59 -05:00
David Sanders
52061b4c28 ci: add markdownlint problem matcher (#49751) 2026-02-11 13:17:29 +01:00
David Sanders
ec6d2fe549 build(dev-deps): update micromark-core-commonmark to 2.0.3 (#49749) 2026-02-11 13:11:58 +01:00
Ronald Eddy Jr
1c621cc982 docs: fix typos across documentation (#49734)
Fix 40 typos across 25 documentation files including misspellings,
missing words, doubled words, wrong words, and grammatical errors.
2026-02-11 12:45:46 +01:00
Shelley Vohr
57a6e43025 fix: revoke Read access after removing file via FileSystemAccess API (#49620)
Refs https://chromium-review.googlesource.com/6677249
2026-02-10 15:48:05 +01:00
dependabot[bot]
ef5b232e9f build(deps): bump github/codeql-action from 4.32.1 to 4.32.2 (#49735)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.1 to 4.32.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](6bc82e05fd...45cbd0c69e)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-10 15:06:42 +01:00
Bug-Reaper
99fce5b6ca fix: address upstream Chromium shift to enable CoreAudio Tap API for audio capture used in electron's desktopCapturer (🍏 macOS). (#49717)
* fix: Enable CoreAudio Tap API for Audio Capture (🍏 macOS)

* fix: addressed markdown issue which caused pre-commit hook failure

🧑‍🔧 : Ref : https://github.com/electron/electron/pull/49717#issuecomment-3874660013

* fix: updated docs to cover `desktopCapturer` nuances with macOS

📝 : PR https://github.com/electron/electron/pull/49717
2026-02-10 15:06:21 +01:00
Rushikesh Bobade
7c66112e88 docs: link unlinked type references in API documentation (#49651)
docs: add missing type links in menu.md and shared-texture.md
2026-02-09 23:08:52 -08:00
John Kleinschmidt
fd0108907a build: fixup build attestation (#49730) 2026-02-09 11:50:17 -05:00
reito
3fa3e91f90 docs: fix framerate limit when osr with shared texture (#49705) 2026-02-09 15:18:06 +01:00
David Sanders
a3563422c4 ci: fix patches changes detected in apply patches workflow (#49701) 2026-02-06 13:48:30 -08:00
Keeley Hammond
9db2290bcd fix: restore macos 12 support in Node 24 (#49697) 2026-02-06 07:48:37 -08:00
Samuel Attard
60d35bbaf4 feat: add support for disclaiming utility processes (#49128)
* feat: add support for disclaiming utility processes

* chore: update patches

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-02-05 14:37:24 -08:00
Michaela Laurencin
15dc7170ef ci: fix ai-pr label commenting (#49685) 2026-02-05 14:27:46 -05:00
Keeley Hammond
59e434a27f refactor: use ComPtr pattern for MSIX to avoid exception handling (#49645)
* Revert "fix: fix Windows MSIX release build errors (#49613)"

This reverts commit 4b5d5f9dd5.

* refactor: use WRL ComPtr pattern for MSIX to avoid exception handling

The MSIX auto-updater code was using C++/WinRT (winrt::* namespace), which requires exception handling (/EHsc). Mixing exception and non-exception handling code in the same binary is problematic at runtime. This commit refactors electron_api_msix_updater.cc to use an upstream Chromium pattern and eliminates the need for special exception handling build flags

* build: import correct packages

* build: consolidate IPackage declarations

* refactor: use IPackageManager/IPackageManager5/IPackageManager9 and
IPackage/IPackage2/IPackage4/IPackage6 interfaces as needed for
different API methods.

Also consolidates duplicate completion handler logic, fixes a bug in
RegisterRestartOnUpdate where the command line string could go out of
scope, and removes unused includes.
2026-02-05 10:42:28 -08:00
Samuel Attard
dec7f937ae build: generate artifact attestions for released assets (#48239)
* build: generate artifact attestions for released assets

* chore: address review feedback

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-05 09:37:17 -05:00
Noah Gregory
50381a6d57 refactor: don't log error just for unsigned code (#49654) 2026-02-05 15:26:17 +09:00
David Sanders
41c7e9bb21 ci: use squash merge for apply patches workflow (#49667) 2026-02-04 15:51:49 -08:00
Shelley Vohr
9740c989da fix: default accelerator for role-based menu items (#49558)
fix: apply default accelerator for role-based menu items

Co-authored-by: Kimgun3383 <tygob5247@gmail.com>
2026-02-04 16:45:29 -05:00
John Kleinschmidt
4ea2d816b8 revert(ci): use new case syntax in workflows (#49665)
Revert "ci: use new case syntax in workflows (#49590)"

This reverts commit def7854848.
2026-02-04 14:55:20 -05:00
Noah Gregory
6a47bb4731 fix: use temp directory for singleton test and clean up at end (#49604)
* fix: create directory for singleton test in `temp` instead of `home`

* fix: remove directory for singleton test at test end

* refactor: avoid extraneous declarations in singleton test

* refactor: reintroduce `userDataFolder` declaration in singleton test

* refactor: move cleanup before app exit in singleton test

* style: add missing semicolon

* refactor: set the user data path after pre-test cleanup in singleton test

* fix: release lock before cleanup in singleton test
2026-02-04 14:43:36 -05:00
David Sanders
ef11669b67 ci: handle PRs with no checks in rerun apply patches (#49630) 2026-02-04 16:13:27 +01:00
Shelley Vohr
d7378d96a5 docs: add Wayland note to win.getPosition() and win.getBounds() (#49632)
docs: add Wayland note to win.getPosition()
2026-02-04 16:13:11 +01:00
Keeley Hammond
431f77ca1c fix: remove menu observer before destroying menu_controller_ (#49648)
* fix: remove menu observer before destroying menu_controller_

* fix: resolves private inheritance conflict
2026-02-04 16:11:00 +01:00
Shelley Vohr
51a9101c3d build: remove Core Graphics private macOS APIs on MAS (#49633) 2026-02-03 12:02:06 -05:00
Shelley Vohr
def7854848 ci: use new case syntax in workflows (#49590)
ci: use new case synta in workflows
2026-02-03 11:57:14 -05:00
Niklas Wenzel
28858ecb85 chore: add "I have built and tested this PR" box to PR template (#49434) 2026-02-03 11:39:07 -05:00
Shelley Vohr
8fdb7549bb fix: alt-space should route through 'system-context-menu' (#49619)
fix: alt-space should route through system-context-menu
2026-02-03 11:34:58 -05:00
dependabot[bot]
c3428fa413 build(deps): bump lodash from 4.17.21 to 4.17.23 in the npm_and_yarn group across 1 directory (#49577)
build(deps): bump lodash in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [lodash](https://github.com/lodash/lodash).

Updates `lodash` from 4.17.21 to 4.17.23
- [Release notes](https://github.com/lodash/lodash/releases)
- [Commits](https://github.com/lodash/lodash/compare/4.17.21...4.17.23)

---
updated-dependencies:
- dependency-name: lodash
  dependency-version: 4.17.23
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-03 11:05:40 -05:00
loc
233caf8469 fix(squirrel.mac): clean up old staged updates before downloading new update (#49365)
fix: clean up old staged updates before downloading new update

When checkForUpdates() is called while an update is already staged,
Squirrel creates a new temporary directory for the download without
cleaning up the old one. This can lead to disk usage growth when
new versions are released while the app hasn't restarted.

This adds a force parameter to pruneUpdateDirectories that bypasses
the AwaitingRelaunch state check. This is called before creating a
new temp directory, ensuring old staged updates are cleaned up.
2026-02-03 11:04:06 -05:00
Shelley Vohr
86209f60eb fix: possible crash in FileSystem API (#49578)
Refs https://chromium-review.googlesource.com/6880247

Fixes a crash that can arise in the File System Access API in the
following scenario:

1. Create fileHandle1 at path1.
2. Call fileHandle1.remove() or user manually delete the file.
3. Create fileHandle2 at path2.
4. fileHandle2.move(path1).
2026-02-03 15:15:54 +01:00
dependabot[bot]
bdf2b67462 build(deps): bump github/codeql-action from 4.32.0 to 4.32.1 (#49629)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.0 to 4.32.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b20883b0cd...6bc82e05fd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-03 15:03:22 +01:00
Mr.Chaofan
4413a0f642 fix: wrong cause and removed flag in cookie change listener (#49103) 2026-02-03 10:19:35 +01:00
Shelley Vohr
3776731f4a fix: menu state in macOS dock menus (#49574) 2026-02-02 17:01:34 -05:00
Robo
db5606b4b3 fix: handle out of order recording errors in skia graphite (#49608) 2026-02-02 14:20:19 +01:00
Calvin
1159de52e7 docs: app.getGPUInfo() may reject (#49580) 2026-02-02 10:00:05 +01:00
Keeley Hammond
4b5d5f9dd5 fix: fix Windows MSIX release build errors (#49613)
* fix: fix MSIX release build

* fix: add C++/WinRT headers

* build: modify include paths

* fix: compile msix as seperate source set

* build: add additional needed deps for msix
2026-02-01 22:27:42 -08:00
Prachi Maskar
0cbf3c2918 docs: add jsign instructions for Azure Trusted Signing on Linux/macOS (#49345)
* docs: add jsign instructions for Azure Trusted Signing on Linux/macOS

* docs: add clickable jsign link for Azure Trusted Signing
2026-01-30 15:24:08 -05:00
axolotl
f272723a33 feat: Allow View.setBounds to animate (#48812)
* feat: allow View::SetBounds to animate

* fix: support width/height animations

* fix: jumping on subsequent animations

* fix: segfault race condition

* fix: remove layer background

* fix: layer clips not being reset

* refactor: use gfx tween gin converter

* fix: layer cleanups causing flickering views

* chore: merge artifact

* fix: missing private method in header

* fix: return type

* fix: do not set layer opacity

* refactor: update animate parameter format

* refactor: move animate into options object

* chore: typo

* docs: update

* spec: add view animation test
2026-01-30 15:18:56 -05:00
Shelley Vohr
331d1e16f5 refactor: address PathProvider TODO (#49563) 2026-01-30 14:16:39 -05:00
Shelley Vohr
6825a522e9 fix: duplicate fullscreen macOS menu item (#49074) 2026-01-30 13:23:43 -05:00
Shelley Vohr
e033c10075 fix: issues with xdg activation on Linux (#49499) 2026-01-30 10:53:04 -05:00
Shelley Vohr
64872a6cb8 fix: macOS menu item accelerators when item disabled (#49553)
fix: macOS menu item acceerators when item disabled
2026-01-30 10:07:16 +01:00
Jan Hannemann
d74fcfcecb feat: msix auto-updater (#49230)
* feat: native auto updater for MSIX on Windows

* doc: added MSIX debug documentation

* fix: allow downgrade with json release file and emit update-available

* test: msix auot-update tests

* doc: API documentation

* test: add package version validation

* fix: docs typo

* fix: don't allow auto-updating when using appinstaller manifest

* fix: getPackageInfo interface implementation

* fix: review feedback, add comment

* fix: missed filename commit

* fix: install test cert on demand

* fix: time stamp mismatch in tests

* fix: feedback - rename to MSIXPackageInfo

* fix: update and reference windowsStore property

* fix: remove getPackagInfo from public API

* fix: type error bcause of removed API
2026-01-29 16:38:26 -05:00
Michaela Laurencin
92a3f7d6c1 ci: add workflow for commenting with new 'ai-pr' label (#49564)
* add workflow for commenting with new 'ai-pr' label

* Update .github/workflows/pull-request-labeled.yml

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* add pr autoclose

* replace with specific secret

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* specify repo

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* update wording of comment

* chore: use GH app token

* chore: fix indentation

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-29 13:12:42 -05:00
David Sanders
0e161c18eb ci: rework reapply patches (#49552) 2026-01-29 11:19:07 -05:00
David Sanders
3d76d3a469 build(dev-deps): bump @electron/lint-roller to 3.2.0 (#49565) 2026-01-29 16:06:47 +01:00
Kanishk Ranjan
82d350524e test: fix flaky BrowserView test (#49316)
* test: fix flaky BrowserWindow test

* fix: improved as per review
2026-01-28 11:54:35 -08:00
Shelley Vohr
e6be04a7a0 fix: chrome://accessibility drift (#49547)
https://chromium-review.googlesource.com/c/chromium/src/+/6870052
2026-01-28 12:07:14 +01:00
David Sanders
a7de47084b test: remove split dependency (#49551) 2026-01-28 10:47:43 +01:00
Kanishk Ranjan
3820d3ae6c test: fix flaky BrowserWindow test (#49364)
test: fix flaky BrowserWindow test
2026-01-27 21:47:02 -08:00
Charles Kerr
8364b62f68 fix: potential dangling pointer in api::Screen (#49536)
fixes a regression from #49506
2026-01-27 16:27:38 -05:00
dependabot[bot]
441729c3a0 build(deps): bump actions/checkout from 6.0.1 to 6.0.2 (#49541)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.1 to 6.0.2.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](8e8c483db8...de0fac2e45)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-27 11:37:15 +01:00
Shelley Vohr
c521c2b868 test: update/fix Node.js disabled specs (#49467) 2026-01-27 11:03:09 +01:00
Shelley Vohr
b2c5093542 docs: correct type for process.noDeprecation (#49524)
* docs: correct type for process.noDeprecation

* docs: mark `noDeprecation` as optional instead

Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>
2026-01-27 11:02:51 +01:00
dependabot[bot]
ec5eb64788 build(deps): bump github/codeql-action from 4.31.10 to 4.32.0 (#49540)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.10 to 4.32.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cdefb33c0f...b20883b0cd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-27 11:00:13 +01:00
David Sanders
0cc15a6386 ci: reapply patches if PR base branch updates them (#49516) 2026-01-26 15:13:34 -05:00
David Sanders
4aa89b9c3c ci: add pipeline segment to run clang-tidy (#49072)
* ci: add pipeline segment to run clang-tidy

* chore: set -header-filter='' for clang-tidy

Breaking change in `clang-tidy` 22.0.0:

> clang-tidy now displays warnings from all non-system headers by default.
> Previously, users had to explicitly opt-in to header warnings using
> -header-filter=’.*’. To disable warnings from non-system, set
> -header-filter to an empty string.
2026-01-26 14:37:01 -05:00
Felix Rieseberg
ae43f17b79 build: Run gh workflows only on e/e (#49521) 2026-01-26 14:35:11 -05:00
electron-roller[bot]
b847299f19 chore: bump chromium to 146.0.7650.0 (main) (#49496)
* chore: bump chromium in DEPS to 146.0.7650.0

* 7496671: WaaP: Control hung delay for Initial WebUI

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7496671

* 7494302: [//media] Rename renderable_gpu_memory_buffer_video_frame_pool*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7494302

* chore: update patches

* 7502996: [DevTools] Add ability to toggle Chromium feature flags from DevTools

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7502996

* 7456200: Vectorize StringImpl::CopyChars and EqualIgnoringASCIICase using Highway.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200

* 7236627: spellcheck: supply full spelling marker info, incld. marker type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7236627

* chore: rm dependency on wtf::string from blink public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200
added a public dependency on //third_party/highway for
//third_party/blink/renderer/platform/wtf:wtf which will not be
inherited by //content/renderer since wtf is internal dependency of
blink leading to the following compilation error

```
In file included from ../../content/public/renderer/window_features_converter.cc:5:
In file included from ../../content/public/renderer/window_features_converter.h:10:
In file included from ../../third_party/blink/public/web/web_window_features.h:38:
In file included from ../../third_party/blink/renderer/platform/wtf/text/wtf_string.h:40:
../../third_party/blink/renderer/platform/wtf/text/string_impl.h:27:10: fatal error: 'hwy/highway.h' file not found
   27 | #include <hwy/highway.h>
      |          ^~~~~~~~~~~~~~~
1 error generated.
```

Use `gn desc out/Testing content/renderer:renderer_sources --blame`
to verify the inherited config and dependency list.

* 7493995: Restore directive part of wasm-eval error message

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7493995

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-26 11:18:09 -08:00
Charles Kerr
6766343173 refactor: simplify NativeWindow-to-BaseWindow lookup (#49520)
refactor: simplify native window to base window lookup
2026-01-26 12:28:57 +01:00
Sourav Bera
75be2fe8d6 docs: add type reference links in Menu and MenuItem API documentation (#49437)
* docs: add type reference links in Menu and MenuItem API documentation

* docs: revert type links in Menu return types to fix parser
2026-01-26 12:22:28 +01:00
Charles Kerr
30f365d9d8 refactor: use gin::Wrappable for electron::api::PowerMonitor (#49509)
* refactor: use `gin::Wrappable` for `electron::api::PowerMonitor`

* chore: update patches
2026-01-25 22:51:31 -06:00
Charles Kerr
e8250f9955 refactor: use gin::Wrappable for electron::api::Screen (#49506) 2026-01-25 13:46:25 -06:00
Kyle Cutler
d5de8883a2 feat: add focusOnNavigation flag to WebPreferences (#49425)
* feat: add focusOnNavigation webPreference

* WebContentsView tests

* fix

* fix
2026-01-23 14:29:34 -05:00
David Franco
8a11d5afb1 fix: avoid startup crash when V8 sandbox is disabled (#49210)
* fix: avoid startup crash when V8 sandbox is disabled

* chore: update patch

---------

Co-authored-by: David Franco <davidfrsan@gmail.com>
2026-01-23 11:49:15 -05:00
Shelley Vohr
89963618d9 fix: second argument to shell.writeShortcutLink is optional (#49476)
fix: second argument to shell.writeShortcutLink is optional
2026-01-23 11:24:47 -05:00
Charles Kerr
8c5c6a6088 refactor: use gin::Wrappable for electron::api::DataPipeHolder (#49495)
* refactor: make `DataPipeHolder` inherit from `gin::Wrappable`

* test: add a test to ensure GC clears the data pipe holder

* chore: e patches all

* chore: e patches all (trivial only)

* refactor: make AllDataPipeHolders a base::flat_map of WeakPersistent
2026-01-23 20:29:01 +09:00
Szymon Kurek
24526ccd39 docs: correct yarn part of tutorial-5-packaging (#49401)
docs: fix yarn part of `tutorial-5-packaging` - adding electron forge
2026-01-23 11:14:19 +01:00
Keeley Hammond
1134d95c6d chore: update main patches (#49498)
chore: update patches
2026-01-22 20:30:32 -08:00
Charles Kerr
d76608b945 refactor: use gin::Wrappable in electron::api::PowerSaveBlocker (#49381)
* refactor: PowerSaveBlocker subclasses gin::Wrappable

* chore: update chore_add_electron_objects_to_wrappablepointertag.patch

* chore: e patches all
2026-01-22 17:31:38 -06:00
electron-roller[bot]
d689f76ff9 chore: bump chromium to 146.0.7645.0 (main) (#49453)
* chore: bump chromium in DEPS to 146.0.7643.0

* chore: bump chromium in DEPS to 146.0.7645.0

* chore: update patches

* 7402162: Refactor app shims to call ContentMain

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7402162

* 7454282: Add master key management for HTTP Cache Encryption

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7454282

* 7490440: Reland "Delete unused base::Contains()"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7490440

* chore: update patches

* 7414864: Pass CSSParserLocalContext down to CSSMathExpressionNodeParser

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7414864

* 7460969: Move child_process_id.h to common

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7460969

* 7474608: [api] Remove deprecated v8::PropertyCallbackInfo<T>::This()

Refs https://chromium-review.googlesource.com/c/v8/v8/+/7474608

* 7461067: [Viz] Rename kPreferGpuMemoryBuffer

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7461067

* 7487174: Remove GLHelper

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7487174

* 7457538: Set timeout from multi source page context fetcher

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7457538

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-22 17:01:09 -05:00
reito
e3142865b2 fix: offscreen rendering with correct screen info. (#48730)
fix: osr use correct screen info.
2026-01-22 14:58:54 -05:00
David Sanders
1f8e4079cd test: fix version color output when running prebuilt Electron (#49491) 2026-01-22 16:17:56 +01:00
Shelley Vohr
bad88c6ed4 fix: potential devtools crash on empty (#49468) 2026-01-21 17:05:26 -08:00
Noah Gregory
534cb33465 fix: return early from platform_util::Beep() on Linux if there is no default GDK display (#49442)
fix: return early from beep on linux if there is no default gdk display
2026-01-21 15:55:24 -05:00
Soobin Rho
51e7753ae9 docs: clearer wording performance common pitfalls (#45308)
docs: clearer wording (performance common pitfalls)

Signed-off-by: Soobin Rho <soobinrho@gmail.com>
2026-01-21 14:46:02 -05:00
sam marshall
d141934885 docs: document that shell.trashItem requires backslashes (#49038)
docs: Update shell.md: Document that shell.trashItem requires backslashes

In Windows many functions relating to files (e.g. shell.openItem, the Node fs functions, as well as native Win32 APIs) will accept either type of slash / or \ as a folder separator.

shell.trashItem does not work with / as folder separator in Windows. This documentation change explains that.

See also:
https://github.com/electron/electron/issues/28831
2026-01-21 13:21:01 -05:00
Erick Zhao
22e8cf9416 docs: add a few API history fragments (#49340)
* docs: add a few API history fragments

* manual fixes
2026-01-21 12:57:02 -05:00
David Sanders
5856b2e01c ci: trigger website docs update on release published (#49429) 2026-01-21 10:44:18 -05:00
Shelley Vohr
49d91dd02b revert: use deprecated setAllowedFileTypes in macOS dialogs (#49444)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

* chore: remove stray import
2026-01-21 13:08:04 +01:00
David Franco
2f20d287d1 feat: import shared texture supports p010le (#49272)
feat: import shared texture supports p010le.
2026-01-20 11:50:30 +01:00
Shelley Vohr
73377af79e build: try removing zero-fill sandbox patch component (#49452) 2026-01-20 09:40:33 +01:00
dependabot[bot]
47766801e4 build(deps): bump actions/setup-node from 6.1.0 to 6.2.0 (#49456)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.1.0 to 6.2.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](395ad32622...6044e13b5d)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.2.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-20 09:40:02 +01:00
dependabot[bot]
bf0510dc22 build(deps): bump electron/github-app-auth-action from 1.1.1 to 2.0.0 (#49457)
Bumps [electron/github-app-auth-action](https://github.com/electron/github-app-auth-action) from 1.1.1 to 2.0.0.
- [Release notes](https://github.com/electron/github-app-auth-action/releases)
- [Commits](384fd19694...e14e47722e)

---
updated-dependencies:
- dependency-name: electron/github-app-auth-action
  dependency-version: 2.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-20 09:39:47 +01:00
electron-roller[bot]
486a9a61d2 chore: bump chromium to 146.0.7635.0 (main) (#49408)
* chore: bump chromium in DEPS to 146.0.7635.0

* chore: update patch hunk headers

* 7078551: [wasm] Refactor caching API

https://chromium-review.googlesource.com/c/v8/v8/+/7078551

* 7141498: [api] Remove unused context parameter from FixedArray::Get

https://chromium-review.googlesource.com/c/v8/v8/+/7141498

* 7454865: Add timeouts to content API for CopyFromSurface

https://chromium-review.googlesource.com/c/chromium/src/+/7454865

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 15:37:02 +01:00
Niklas Wenzel
7851a34c2d docs: fix webContents.hostWebContents types (#49424) 2026-01-19 10:45:23 +01:00
Shelley Vohr
faa21a748f fix: MAS rejection for private APIs (#49391) 2026-01-18 10:34:16 +01:00
Shelley Vohr
5bd2938f6a fix: try clearing InspectableWebContents delegate earlier (#49406)
fix: try clearing InspectableWebContents delegate earlier
2026-01-16 21:36:34 +01:00
electron-roller[bot]
f149efe32e chore: bump node to v24.13.0 (main) (#49189)
* chore: bump node in DEPS to v24.12.0

* src: use CP_UTF8 for wide file names on win32

https://github.com/nodejs/node/pull/60575

* test,crypto: handle a few more BoringSSL tests

https://github.com/nodejs/node/pull/59030

* chore: fixup patch indices

* chore: re-add accidentally removed sslv23 test

* chore: fixup crypto patch rebase

* test: make buffer sizes 32bit-aware in test-internal-util-construct-sab

https://github.com/nodejs/node/pull/61026

* src: add internal binding for constructing SharedArrayBuffers

https://github.com/nodejs/node/pull/60497

* chore: bump node in DEPS to v24.13.0

* chore: fixup patch indices

* chore: fixup sandboxed pointers patch

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-16 11:08:38 -05:00
Daniel Gräfe
5dd509d2f4 fix: restore AXDocument accessibility attribute for representedFilename on macOS (#49346)
Starting from Chromium 134.0.6989.0 (Electron 35.0.0-beta.5), the
NativeWidgetMacNSWindow class overrides accessibilityDocument to return
the web content URL from the accessibility tree, but doesn't fall back
to NSWindow's default behavior when that URL is empty.

This broke Electron's setRepresentedFilename() API - the file path was
still set on the NSWindow, but no longer exposed via the AXDocument
accessibility attribute that screen readers use.

This fix adds an accessibilityDocument override in ElectronNSWindow that
checks representedFilename first, falling back to Chromium's behavior
for web content URLs.

Fixes: https://github.com/electron/electron/issues/XXXXX

Co-authored-by: Claude Opus 4.5 <noreply@anthropic.com>
2026-01-16 10:27:29 +01:00
Alex Schwartz
bdd7730a24 fix: make toplevel icon Wayland protocol work (#49290) 2026-01-16 09:55:52 +01:00
dependabot[bot]
060e76f1b6 build(deps): bump actions/upload-artifact from 5.0.0 to 6.0.0 (#49220)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](330a01c490...b7c566a772)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-16 09:55:38 +01:00
David Sanders
2fbf1f5c72 ci: detect patch needs update error with problem matcher (#49405) 2026-01-15 19:18:50 -08:00
Charles Kerr
c769361af2 fix: warning: default arguments on virtual or override methods (#49398)
fix: warning: default arguments on virtual or override methods are prohibited [google-default-arguments]

we never override these, so just make them nonvirtual
2026-01-15 16:09:43 -08:00
electron-roller[bot]
6ea7d6d5a4 chore: bump chromium to 146.0.7633.0 (main) (#49390)
* chore: bump chromium in DEPS to 146.0.7633.0

* chore: fixup patch indices

* chore: fix unsafe buffer usage in browser_linux.cc

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-15 10:52:42 -05:00
Charles Kerr
27b3a32307 chore: update patches (#49399) 2026-01-14 22:33:23 -08:00
Charles Kerr
ddeb970f18 refactor: make ReplyChannel inherit from gin::Wrappable (#49339)
* refactor: make ReplyChannel inherit from gin::Wrappable

* chore: add kElectronReplyChannel to chore_add_electron_objects_to_wrappablepointertag.patch

* fix: use gin::PerIsolateData::DisposeObserver

* fix: lifetime issues

* chore: rm perisolatedata hook in favor of prefinalizer

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-14 18:35:01 -06:00
electron-roller[bot]
5d80264944 chore: bump chromium to 145.0.7628.0 (main) (#49331)
* chore: bump chromium in DEPS to 145.0.7620.0

* chore: bump chromium in DEPS to 145.0.7622.0

* chore: bump chromium in DEPS to 145.0.7624.0

* chore: bump chromium in DEPS to 145.0.7626.0

* chore: bump chromium in DEPS to 145.0.7628.0

* 7362759: Migrate various base::Contains() to contains() in ui | https://chromium-review.googlesource.com/c/chromium/src/+/7362759

* chore: update patches

* 7411324: url: Mark deprecated functions as UNSAFE_BUFFER_USAGE

https://chromium-review.googlesource.com/c/chromium/src/+/7411324

* 7366867: Store property info in CSSParserLocalContext for random()

https://chromium-review.googlesource.com/c/chromium/src/+/7366867

* 7277406: Exclude PiP from getDisplayMedia picker thumbnails

https://chromium-review.googlesource.com/c/chromium/src/+/7277406

* 7253489: activity_reporter: Create stub module owned by browser_process

https://chromium-review.googlesource.com/c/chromium/src/+/7253489

* 7404514: Create device parental controls delegate

https://chromium-review.googlesource.com/c/chromium/src/+/7404514

* 7269504: Update histograms to use the updated MediaStreamRequestResult enum

https://chromium-review.googlesource.com/c/chromium/src/+/7269504

* fixup! 7253489: activity_reporter: Create stub module owned by browser_process

* 7368549: Reland "Use native rollup"

https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7368549

* 4803165: Enable suppressing input event dispatch while paint-holding.

https://chromium-review.googlesource.com/c/chromium/src/+/4803165

* chore: make device_parental_controls lazy

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-14 15:34:24 +01:00
Erick Zhao
dae76c2885 docs: remove stale example and standardize DevTools capitalization (#49321)
* docs: remove stale example and standardize `DevTools` capitalization

* Update docs/api/web-contents.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

---------

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>
2026-01-14 10:35:53 +01:00
Erick Zhao
a368c5da0c docs: improve build-tools instructions (#49294)
* docs: improve build-tools instructions

* address comments

* update directory structure

* update

* nits

* node -> electron_node

* update macos build version

* Update docs/development/build-instructions-gn.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-14 09:51:55 +01:00
Keeley Hammond
1b2679b315 fix: revert os_crypt async cookie provider implementation (#49382)
* Revert "fix: provide explicit cookie encryption provider for cookie encryption (#49348)"

This reverts commit 95f097a392.

* Revert "fix: fix cookie encryption provider loading on Windows and Linux (#49371)"

This reverts commit 0e4ee9f03a.

* revert: 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-14 09:34:00 +01:00
Shelley Vohr
15acf70760 build: roll build-image to a82b87d (#49377)
build: roll build-image to a82b87d
2026-01-13 12:13:14 +01:00
dependabot[bot]
324eb0eb1c build(deps): bump github/codeql-action from 4.31.7 to 4.31.10 (#49376)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.7 to 4.31.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cf1bb45a27...cdefb33c0f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-13 10:25:10 +01:00
Keeley Hammond
0e4ee9f03a fix: fix cookie encryption provider loading on Windows and Linux (#49371)
* fix: support cookie encryption provider cross-platform

* fix: add async macos key provider
2026-01-12 19:39:29 -08:00
Charles Kerr
ae94cefdba refactor: add static ReplyChannel::SendError() helper (#49338)
* refactor: add static void ReplyChannel::SendError()

* refactor: use static SendError() instead of instantiating a temporary

* refactor: remove non-static version of SendError()

* refactor: remove redundant callback-is-non-null checks
2026-01-12 17:02:58 -06:00
Shelley Vohr
409c29b12b build: roll build-tools SHA to 4430e4a (#49362)
build: roll build-tools SHA to 4430e4a
2026-01-12 12:22:30 -05:00
Shelley Vohr
b0e012f14e build: update on-create-command for siso (#49357) 2026-01-12 14:30:48 +01:00
Calvin
9a5ffd920c feat: suppress devtools console logging (#49292)
* feat: suppress devtools console logging

* Emit messages as-is in testing builds

* Promote `DCHECK_IS_ON()` to preprocessor check
2026-01-12 11:31:33 +01:00
Charles Kerr
cf2e283332 fix: clang-tidy warnings, pt. 1 (#49083)
* fix: google-readability-casting warning about the uint32_t cast

* fix: modernize-use-equals-default warnings

* fix: readability-redundant-member-init warning

* fix: modernize-make-unique warnings

* fix: modernize-use-emplace

warning: use emplace_back instead of push_back

* refactor: address code review feedback
2026-01-09 22:57:38 -08:00
Niklas Wenzel
d6a6312fc8 build: update NMV to 145 (#49349) 2026-01-09 18:14:18 -08:00
Keeley Hammond
95f097a392 fix: provide explicit cookie encryption provider for cookie encryption (#49348)
fix: provide explicit cookie encryption provider

Fixes 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-09 11:53:58 -08:00
Niklas Wenzel
b380755514 chore: remove stakeholders mention from PR template (#49317) 2026-01-09 00:36:40 -08:00
David Sanders
3985daa81c chore: improvements to script/run-clang-tidy.ts (#49335)
* chore: disable color output for clang-tidy in CI

* chore: small QoL improvements to run-clang-tidy.ts

* chore: add --fix option to script/run-clang-tidy.ts
2026-01-08 22:05:44 -08:00
Erick Zhao
5901d8a6d8 docs: document ELECTRON_SKIP_BINARY_DOWNLOAD (#49320) 2026-01-07 14:54:22 -08:00
electron-roller[bot]
eee60f202c chore: bump chromium to 145.0.7618.0 (main) (#49314)
* chore: bump chromium in DEPS to 145.0.7618.0

* 7399531: [GTK] Don't preselect file dialog accept buttons | https://chromium-review.googlesource.com/c/chromium/src/+/7399531

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-07 15:01:56 -05:00
Charles Kerr
b5a7d81c7d refactor: have GetXdgAppId() return a std::optional<std::string> (#49318)
* refactor: GetXdgAppId() now returns std::optional<std::string>

* refactor: slightly simplify app.setDesktopName() ts calls

* refactor: add better documentation for dekstop-entry in XDG notifications
2026-01-07 14:30:09 -05:00
dependabot[bot]
a89b2cd9bc build(deps): bump actions/download-artifact from 6.0.0 to 7.0.0 (#49221)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](018cc2cf5b...37930b1c2a)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-06 15:48:38 -05:00
Niklas Wenzel
44fa30695f docs: update roundedCorners documentation (#49195) 2026-01-05 16:27:46 -05:00
Niklas Wenzel
2ab56adbbd test: remove outdated disabled test (#49196) 2026-01-05 16:27:01 -05:00
electron-roller[bot]
a1f0ef80d4 chore: bump chromium to 145.0.7616.0 (main) (#49279)
* chore: bump chromium in DEPS to 145.0.7605.0

* chore: bump chromium in DEPS to 145.0.7606.0

* chore: bump chromium in DEPS to 145.0.7608.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7610.0

* chore: update patches

* [InputVizard] Fix missing touch cancel in InputTransferHandlerAndroid
using InputEventSource

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7302368

* chore: bump chromium in DEPS to 145.0.7611.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7614.0

* chore: bump chromium in DEPS to 145.0.7615.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7616.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-05 13:34:36 -05:00
dependabot[bot]
c1a031be83 build(deps): bump actions-cool/issues-helper from 3.7.3 to 3.7.5 (#49282)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.3 to 3.7.5.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](3809910bc1...e2ff99831a)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-05 12:26:03 -05:00
John Kleinschmidt
c8bb700509 build: fixup release notes generation (#49302) 2026-01-05 11:11:40 -05:00
Calvin
46922de638 fix: drag regions in child windows (#49231)
* fix: drag regions in child windows

* Update comments
2026-01-05 10:34:01 -05:00
Niklas Wenzel
75ea93a279 chore: remove quiet period mention from PR template (#49298) 2026-01-05 10:12:07 -05:00
John Kleinschmidt
ace0beaa3f build: add logging to notes generator (#49300) 2026-01-05 09:49:51 -05:00
electron-roller[bot]
9eb43f3286 chore: bump chromium to 145.0.7604.0 (main) (#49265)
* chore: bump chromium in DEPS to 145.0.7599.0

* chore: bump chromium in DEPS to 145.0.7600.0

* chore: bump chromium in DEPS to 145.0.7602.0

* chore: bump chromium in DEPS to 145.0.7604.0

* chore: update patches (trivial only)

* [bytesize] Migrate network data in Task Manager to ByteSize.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/7266090

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-28 20:40:50 -08:00
electron-roller[bot]
809ab09b6f chore: bump chromium to 145.0.7596.0 (main) (#49224)
* chore: bump chromium in DEPS to 145.0.7588.0

* fix(patch-conflict): update scroll_bounce_flag for split overscroll methods

Chromium split IsElasticOverscrollEnabled() into two methods:
IsElasticOverscrollEnabledOnRoot() and IsElasticOverscrollSupported().
Updated patch to apply the scroll-bounce command-line switch to both
methods.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7233733

* fix(patch-conflict): update exclusive_access patch context

Upstream refactored the profile variable declaration. Updated patch to
match new surrounding context with brace-style if statement.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239252

* fix(patch-conflict): update screen capture kit non-shareable filter

Upstream refactored PiP window exclusion to use GetWindowsToExclude()
helper function. Updated patch to combine non-shareable window filtering
with the new helper's output.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7274596

* fix(patch-conflict): update corner smoothing CSS property id position

Upstream added new internal overscroll CSS properties. Updated patch to
add kElectronCornerSmoothing after the new entries.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234051

* fix(patch-conflict): update permission patches for new permission types

Upstream added new permission types: LOCAL_NETWORK, LOOPBACK_NETWORK,
and GEOLOCATION_APPROXIMATE. Updated Electron permission patches to
include these new types and renumber Electron-specific permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7231952

* fix(patch-conflict): update memory query fallback for new function signature

Upstream added AmountOfTotalPhysicalMemory() with PCHECK. Updated patch
to maintain fallback logic with correct ByteSize return type.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254886

* chore: update patch hunk headers

* fix(patch): update reclient-configs patch to use new file mode

The fix_add_python_remote_wrapper patch was using 'copy from' mode
which caused inconsistent behavior between local and CI git versions.
Changed to 'new file' mode for consistent patch application.

* fix(patch-conflict): remove duplicate GEOLOCATION_APPROXIMATE case

Upstream moved GEOLOCATION_APPROXIMATE earlier in the switch statement
in GetPermissionString(). The 3-way merge kept both the old and new
positions, causing a duplicate case error.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6397637

* chore: update libcxx filenames for new headers

* chore: bump chromium in DEPS to 145.0.7590.0

* chore: update patch hunk headers

* fix(patch): update memory fallback return type to ByteSize

Upstream changed the return type from ByteCount to ByteSize.

* fix: suppress nodiscard warning in node_file.cc

libc++ added [[nodiscard]] to std::filesystem::copy_options operator|=
which causes build failures with -Werror.

* 7229082: update CopyFromSurface to use CopyFromSurfaceResult

Upstream changed CopyFromSurface callback to return
base::expected<viz::CopyOutputBitmapWithMetadata, std::string>
instead of SkBitmap, enabling better error handling.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7229082

* 7254070: add ip_address_space param to OnLocalNetworkAccessPermissionRequired

Upstream added IPAddressSpace parameter to check address space for
proper permission handling in Local Network Access.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254070

* 7136679: add spelling_markers param to RequestCheckingOfText

Upstream added spelling_markers parameter to report misspelling
ranges from Blink to Spellcheck to IME.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7136679

* 7240487: remove second param from RegisterWebSafeIsolatedScheme

Upstream removed the schemes_okay_to_appear_as_origin_headers_ parameter.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7240487

* 7254577: use explicit WebElement constructor

WebElement default constructor now requires explicit construction
rather than brace initialization.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254577

* 7256335: remove override from CreateGlobalFeaturesForTesting

Upstream removed BrowserProcess::CreateGlobalFeaturesForTesting virtual
method so the override specifier is no longer valid.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7256335

* chore: add missing SingleThreadTaskRunner include

A transitive include of SingleThreadTaskRunner was removed upstream,
requiring an explicit include.

Ref: Unable to locate specific CL (transitive include change)

* 7260483: add LOCAL_NETWORK, LOOPBACK_NETWORK permission type cases

Upstream added new permission types for Local Network Access split
permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7260483

* chore: update patch hunk headers

* 7264893: update postMessage tests for file: origin serialization change

Chromium now serializes file: origins as 'null' in MessageEvent per spec.
This is a security improvement aligning with the HTML spec behavior.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893

* fix: add paths to custom scheme URLs in protocol tests

Custom scheme URLs without paths (e.g. test-scheme://foo) cause a
DCHECK crash in ASAN builds when CorsURLLoader tries to log the
request via GenerateRequestLine -> PathForRequest, which asserts
that the path is non-empty.

Adding trailing slashes ensures URLs have valid paths.

* chore: bump chromium in DEPS to 145.0.7592.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 145.0.7594.0

* chore: bump chromium in DEPS to 145.0.7596.0

* chore: update accelerator.patch

no manual changes; patch applied with fuzz 2 (offset 1 line)

* chore: update patches (trivial only)

* chore: node ./script/gen-libc++-filenames.js

---------

Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-25 17:15:53 -06:00
Samuel Attard
3df3a6a736 fix: webRequest.onBeforeSendHeaders not being able to modify reserved headers (#49226)
* fix: `webRequest.onBeforeSendHeaders` not being able to modify reserved headers

* chore: add unit test for reserved header
2025-12-19 23:08:40 +13:00
Samuel Attard
7433c14af5 chore: add CLAUDE.md and Chromium Upgrade claude skill (#49229)
* chore: add CLAUDE.md and Chromium Upgrade claude skill

* Update script/lint.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-12-19 13:07:58 +13:00
electron-roller[bot]
a90ccc753b chore: bump chromium to 145.0.7577.0 (main) (#49175)
* chore: bump chromium in DEPS to 145.0.7572.0

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Polished the edits and formatted the result. No real changes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7232079 "7232079: Use WindowsToExclude to exclude PiP window in macOS screencapture device"

* chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7214586 "7214586: Refactor SelectFileDialogLinuxPortal to request XDG portal on demand"
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910 "7237910: Remove g_gtk_ui global"

* 7228586: Migrate SystemMemoryInfo from ByteCount to ByteSize

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7228586

* 7207583: GlobalRenderFrameHostId to ChildProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7207583

* 7205548: Remove uses of BodyAsStringCallbackDeprecated (extensions/)

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7205548

* chore: bump chromium in DEPS to 145.0.7574.0

* chore: update libc++ filenames

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7246150 "7246150: Fix crash in ScreenCaptureKitDeviceMac due to null PIPScreenCaptureCoordinator"

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* fixup! chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

* 7239572: [OOPIF PDF] Enable OOPIF PDF by default on Windows/macOS/Linux

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239572

* chore: bump chromium in DEPS to 145.0.7576.0

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* chore: update patches (trivial only)

* chore: add note to keep patch that was upstreamed but reverted

fix_restore_original_resize_performance_on_macos.patch was organically upstreamed but that change got reverted just after the current roll's cutoff.

I've added a note in the patch contents so the patch sticks around and so we can keep it after the revert is included.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* chore: bump chromium in DEPS to 145.0.7577.0

* chore: update patches (trivial only)

* chore(patch-conflict): keep patch after revert

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* 7237910: Remove g_gtk_ui global

I tried to find a way to avoid the patch, but other approaches seemed complex and involved.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910

* 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7251900

* 7170174: [LNA] Retry requests for cached local resources

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7170174

* fix: PDFs use OOPIF (behavior change)

* fixup! 7237910: Remove g_gtk_ui global

* fixup! 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-16 12:32:38 -05:00
John Kleinschmidt
e181fd040f build: drop dugite as a dependency (#49194) 2025-12-12 13:43:12 -05:00
David Sanders
a486185e10 ci: disallow non-maintainer changes to Yarn files (#49186) 2025-12-11 09:25:29 -05:00
John Kleinschmidt
8cefc8425c build: upgrade yarn to 4.12.0 (#49176) 2025-12-10 14:04:14 -05:00
electron-roller[bot]
fe477ce3aa chore: bump chromium to 145.0.7568.0 (main) (#49145)
* chore: bump chromium in DEPS to 145.0.7562.0

* fix(patch-conflict): update code cache patch for PersistentCache refactor

Upstream refactored code cache to use PersistentCache with new class-based
implementation (NoopCodeCacheHost, LocalCodeCacheHost, CodeCacheWithPersistentCacheHost).
Updated patch to integrate custom scheme support into the new structure while
preserving ProcessLockURLIsCodeCacheScheme checks for embedder-registered schemes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7044986

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update dialog patch for RequestXdgDesktopPortal API

Upstream changed from SetSystemdScopeUnitNameForXdgPortal to RequestXdgDesktopPortal
API pattern. Updated OnServiceStarted signature and kept OnSystemdUnitStarted callback
that calls Electron's file_dialog::StartPortalAvailabilityTestInBackground().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7204285

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): remove reference to deleted AbortByPlaceholderLayout flag

Upstream removed the AbortByPlaceholderLayout runtime flag from
runtime_enabled_features.json5. Updated patch to only add ElectronCSSCornerSmoothing
without the removed flag reference.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7226494

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): guard media_file_system_registry for ChromeOS only

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7100719
moved media_file_system_registry to be ChromeOS-only since Media
Galleries is a Chrome Apps API and Chrome Apps are only available
on Chrome OS now.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): update VideoPixelFormat API for SharedImageFormat

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7207153
removed VideoPixelFormatToGfxBufferFormat as part of migration to
SharedImageFormat. Update to use VideoPixelFormatToSharedImageFormat
which directly returns the SharedImageFormat.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): extend profile methods patch for ShouldEnableXfaForms

The ShouldEnableXfaForms function uses Profile::FromBrowserContext()
which is not available in Electron. Wrap the profile-dependent code
in #if 0 to fall through to the feature flag default.

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: bump chromium in DEPS to 145.0.7563.0

* chore: bump chromium in DEPS to 145.0.7565.0

* chore: bump chromium in DEPS to 145.0.7567.0

* chore: bump chromium in DEPS to 145.0.7568.0

* fix(patch-conflict): update content_main_delegate.h context for IsInitFeatureListEarly

Upstream added a new IsInitFeatureListEarly() virtual method to ContentMainDelegate
just before where our GetBrowserV8SnapshotFilename() method is added. Updated patch
context to account for this new method.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-update): include v8-cppgc.h for CppHeap complete type

The std::unique_ptr<v8::CppHeap> default argument in node.h requires
the complete CppHeap type definition for the destructor. Added the
v8-cppgc.h include to provide the full type definition.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): move NativeAppWindowFrameViewMacClient before constructor

The std::unique_ptr<NativeAppWindowFrameViewMacClient> member requires
the complete type definition to be visible at the point of the constructor
because the unique_ptr destructor may be instantiated during exception
handling. Moved the class definition before the NativeWindowMac constructor.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update create_browser_v8_snapshot_file_name_fuse context for IsInitFeatureListEarly

The upstream added IsInitFeatureListEarly() virtual method declaration to
ContentMainDelegate class. Updated the patch context to account for this
new function being present before the GetBrowserV8SnapshotFilename()
declaration we add.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-update): remove reverted IsInitFeatureListEarly from v8 snapshot patch

The upstream added IsInitFeatureListEarly() was reverted, so the patch should
not include this declaration. Only GetBrowserV8SnapshotFilename() should be
added by the create_browser_v8_snapshot_file_name_fuse patch.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7230430

Co-Authored-By: Claude <noreply@anthropic.com>

* 6171655: include single_thread_task_runner.h for complete type

Added include for base/task/single_thread_task_runner.h in osr_converter.cc
to resolve incomplete type error when using
base::SingleThreadTaskRunner::GetCurrentDefault().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6171655

Co-Authored-By: Claude <noreply@anthropic.com>

* 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

Upstream removed GetChromiumGitRevision() function from embedder_support.
Updated to use CHROMIUM_GIT_REVISION macro directly via
build/util/chromium_git_revision.h as recommended in the Chromium CL.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7224136

Co-Authored-By: Claude <noreply@anthropic.com>

* fixup! 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

* fix(build): add missing include

`components/dbus/xdg/systemd.h` for `void OnSystemdUnitStarted(dbus_xdg::SystemdUnitStatus)` in the same patch.

* fix(build): adapt to string-view-ification change in windows jump_list.cc

7186922: Fix unsafe buffer usage in base/win/win_util.cc
https://chromium-review.googlesource.com/c/chromium/src/+/7186922

* chore: update libc++ filenames

* fixup! fix(build): add missing include

* fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

* fixup! fix(build): guard media_file_system_registry for ChromeOS only

* fixup! fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-10 10:28:31 -05:00
John Kleinschmidt
bab6bd3dae build: use @electron-ci/dev-root for package.json default (#49154) 2025-12-09 14:49:12 -05:00
dependabot[bot]
33f6942565 build(deps): bump actions/stale from 10.1.0 to 10.1.1 (#49159)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.0 to 10.1.1.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5f858e3efb...997185467f)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:50 -05:00
dependabot[bot]
a1b2e82778 build(deps): bump actions-cool/issues-helper from 3.7.2 to 3.7.3 (#49157)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.2 to 3.7.3.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](9861779a69...3809910bc1)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:13 -05:00
dependabot[bot]
1e06b74cd2 build(deps): bump github/codeql-action from 4.31.6 to 4.31.7 (#49155)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.6 to 4.31.7.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fe4161a26a...cf1bb45a27)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.7
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:15:08 -05:00
dependabot[bot]
fe0caa0e0d build(deps): bump actions/checkout from 6.0.0 to 6.0.1 (#49158)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.0 to 6.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](1af3b93b68...8e8c483db8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:14:41 -05:00
dependabot[bot]
cd48083be8 build(deps): bump actions/setup-node from 6.0.0 to 6.1.0 (#49156)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.0.0 to 6.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](2028fbc5c2...395ad32622)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:13:56 -05:00
John Kleinschmidt
8d5b104c17 build: upgrade github-app-auth to 3.2.0 (#49152) 2025-12-09 09:49:37 -05:00
John Kleinschmidt
6e134a8ad9 build: use powershell for Electron build step (#49144) 2025-12-08 16:03:40 -05:00
electron-roller[bot]
95e87e46ab chore: bump chromium to 144.0.7547.0 (main) (#49058)
* chore: bump chromium in DEPS to 144.0.7543.0

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

* chore: update patches

* chore: update filenames.libcxx.gni

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

* chore: bump chromium in DEPS to 144.0.7545.0

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7547.0

* chore: update patches

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

* fixup Add support for UnownedUserData in GlobalFeatures

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

* fixup BUILD.gn for lint

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

* chore: skip setting LPAC ACLs

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <70381+ckerr@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Samuel Attard <MarshallOfSound@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-12-04 16:40:04 -08:00
Jan Hannemann
90e338df50 fix: run toast creation on background thread (#49106)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

* fix: comments
2025-12-02 15:27:22 -08:00
dependabot[bot]
1b3fc9c174 build(deps): bump actions/checkout from 4.2.2 to 6.0.0 (#49125)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.2.2...1af3b93b6815bc44a9784bd300feb67ff0d1eeb3)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:02:06 -05:00
dependabot[bot]
c51018281f build(deps): bump github/codeql-action from 4.31.5 to 4.31.6 (#49124)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.5 to 4.31.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fdbfb4d275...fe4161a26a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:01:21 -05:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
Keeley Hammond
c7aa0b537d chore: cherry-pick ec6c18478382 from v8 (#48335)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches
2025-09-16 19:08:15 -07:00
Robo
048d620701 fix: remove unneeded handlescope from JS callbacks (#48318)
fix: remove handlescope from JS callbacks
2025-09-16 06:56:38 +09:00
Charles Kerr
15cdae1cf0 refactor: make api::NetLog inherit from gin::Wrappable (#48308)
* refactor: remove unused v8::Isolate* arg from NetLog ctor

* refactor: allocate api::NetLog on cpp heap

* refactor: make electron::api::Session::net_log_ a cppgc::Member<api::NetLog>

* refactor: remove unnecessary EscapableHandleScope

* chore: code style consistency
2025-09-16 06:29:46 +09:00
Shelley Vohr
bac383c219 feat: add fileSystem to ses.setPermissionCheckHandler (#48170)
feat: add fileSystem to ses.setPermissionCheckHandler
2025-09-15 17:00:58 -04:00
John Kleinschmidt
49eb165ef9 ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48319)
cleanup
2025-09-15 16:31:49 -04:00
Charles Kerr
a468ed7f10 refactor: narrow or remove gin arguments (#48300)
* refactor: narrow App:SetJumpList() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow WebContents::AddWorkSpace() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowMessageBox() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowOpenDialog() arg from gin::Arguments* to v8::Isolate*

* refactor: remove unused gin::Arguments* arg from OverrideGlobalPropertyFromIsolatedWorld()

* refactor: narrow WebContents::StartDrag() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow NetLog::StopLogging() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow Protocol::IsProtocolHandled() arg from gin::Arguments* to v8::Isolate*
2025-09-13 08:19:07 +09:00
Calvin
5444738721 fix: set ozone platform for wayland (#48301)
* fix: set ozone platform for wayland

* whoops, includes. thx charles
2025-09-13 08:17:06 +09:00
Charles Kerr
a6959ca97b refactor: allocate api::Debugger on cpp heap (#48266)
* refactor: remove unused isolate arg from Debugger ctor

* refactor: make Debugger ctor, dtor public

needed for cppgc::MakeGarbageCollected()

This is what upstream does, e.g. https://chromium-review.googlesource.com/c/chromium/src/+/6722236

* fixup! refactor: remove unused isolate arg from Debugger ctor

mark Debugger ctor as explicit

* refactor: in EventEmitterMixin, handle both old and new WrapperInfo types

* refactor: make electron::api::Debugger inherit from gin::Wrappable

* refactor: add api::Debugger::GetTypeName()

* refactor: add api::Debugger::GetClassName()
2025-09-11 16:03:17 -04:00
dependabot[bot]
45353ae38c build(deps): bump actions/setup-node from 4.4.0 to 5.0.0 (#48282)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.4.0 to 5.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](49933ea528...a0853c2454)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 21:35:54 -05:00
Charles Kerr
f702327dce refactor: avoid unused inheritance in ServiceWorkerMain (#48279)
ServiceWorkerMain does not need to inherit from EventEmitterMixin
2025-09-10 11:16:35 -05:00
dependabot[bot]
fda3a3d493 build(deps): bump github/codeql-action from 3.29.11 to 3.30.1 (#48283)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.11 to 3.30.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3c3833e0f8...f1f6e5f6af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 09:47:34 -05:00
Michaela Laurencin
dae5dad167 docs: update release timeline for unsupported v35 (#48285) 2025-09-09 15:03:48 -07:00
John Kleinschmidt
940ebb6c7a chore: update patches (#48278) 2025-09-08 15:44:47 -04:00
electron-roller[bot]
793565e4be chore: bump chromium to 141.0.7390.7 (main) (#48212)
* chore: bump chromium in DEPS to 141.0.7381.3

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7382.0

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7384.0

* chore: bump chromium in DEPS to 141.0.7386.0

* [Extensions] Move devtools_page and chrome_url_overrides handlers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6862700

* Reland "[api] Advance deprecation of GetIsolate"

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6875273

* Move "system integrated UI" concept out of NativeTheme.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6867375

* chore: update patches

* Reland "[PermissionOptions] Return PermissionResult in callback for requests"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6851838

* Reland "[exit-time-destructors] Enable by default"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update patches

* [FSA] Revoke Read access after removing file via FileSystemAccess API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6677249

* chore: IWYU

* [DevToolsUIBindings] Accept an object for `dispatchHttpRequest` params

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6877528

* chore: IWYU

* Pass navigation UI parameters on EnterFullscreen in EAM

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6874923

* chore: rm band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch

* Remove unused PreHandleMouseEvent

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6880411

* 6878583: siso: update to version 1.4.1

https://chromium-review.googlesource.com/c/chromium/src/+/6878583

* Fold native_theme_browser into native_theme.

https://chromium-review.googlesource.com/c/chromium/src/+/6882627

* fixup: Reland "[exit-time-destructors] Enable by default

https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update filenames.libcxx.gni

* chore: IWYU

* fixup: chore: IWYU

* fixup: Reland "[exit-time-destructors] Enable by default

* fixup: Reland "[exit-time-destructors] Enable by default

* Remove common_theme.*; place its method in NativeTheme instead.

https://chromium-review.googlesource.com/c/chromium/src/+/6886029

* fixup: Reland "[exit-time-destructors] Enable by default

* Better track when WebPreferences need updates for color-related changes.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6886797

* chore: bump chromium in DEPS to 141.0.7390.7

* 6904664: Reland "Make BrowserContext::GetPath() const"

https://chromium-review.googlesource.com/c/chromium/src/+/6904664

* Restore read access after certain file modification operations

https://chromium-review.googlesource.com/c/chromium/src/+/6861041

* fixup: Move "system integrated UI" concept out of NativeTheme.

* fixup: Reland "[exit-time-destructors] Enable by default

* chore: update patches

* 6906096: Remove GetSysSkColor().

https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* Inline implementation of SysColorChangeListener into the lone user.

https://chromium-review.googlesource.com/c/chromium/src/+/6905083

Also 6906096: Remove GetSysSkColor(). | https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* fixup: 6906096: Remove GetSysSkColor()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-08 12:57:15 +02:00
electron-roller[bot]
1f322ebce3 chore: bump node to v22.19.0 (main) (#48222)
* chore: bump node in DEPS to v22.19.0

* chore: fixup patch indices

* crypto: add tls.setDefaultCACertificates()

https://github.com/nodejs/node/pull/58822

* esm: js-string Wasm builtins in ESM Integration

https://github.com/nodejs/node/pull/59179

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-05 17:16:45 -04:00
Samuel Attard
f009e077f2 build: update spec deps for clean audit (#48238) 2025-09-03 15:05:49 -04:00
Calvin
fed73040e2 docs: move some planned breaking changes to 39 (#48236) 2025-09-01 14:55:11 -07:00
Shelley Vohr
828fd59a72 fix: file-only picker incorrectly allowing some directories (#48198) 2025-08-29 13:14:45 -04:00
Shelley Vohr
e892840975 fix: ensure dragging works again after emitting contextmenu event (#48199) 2025-08-29 10:37:37 -04:00
Shelley Vohr
7373173e44 fix: showMessageDialog should center dialog to parent (#48181) 2025-08-29 09:56:51 +02:00
electron-roller[bot]
5d5e672f17 chore: bump chromium to 141.0.7361.0 (main) (#48054)
* chore: bump chromium in DEPS to 141.0.7352.0

* chore: update patches

* 6830573: Revert 'Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable' | https://chromium-review.googlesource.com/c/chromium/src/+/6830573

* chore: bump chromium in DEPS to 141.0.7354.0

* chore: bump chromium in DEPS to 141.0.7356.0

* chore: bump chromium in DEPS to 141.0.7357.0

* chore: bump chromium in DEPS to 141.0.7359.0

* chore: bump chromium in DEPS to 141.0.7361.0

* 6838518: [Mac] Correctly deallocate sandbox error buffers and prevent crash resulting from nullptr assignment | https://chromium-review.googlesource.com/c/chromium/src/+/6838518

* 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* chore: update patches

* fixup! 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* fixup! 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* fix: unsafe buffer warning in fix_properly_honor_printing_page_ranges.patch

* fix: FTBFS in src_remove_dependency_on_wrapper-descriptor-based_cppheap.patch

This change should be upstreamed.

Fixes this error:

../../third_party/electron_node/src/env.cc:606:3: error: no matching function for call to 'Wrap'
  606 |   v8::Object::Wrap<v8::CppHeapPointerTag::kDefaultTag>(
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1076:14: note: candidate function template not viable: cannot convert argument of incomplete type 'void *' to 'v8::Object::Wrappable *' for 3rd argument
 1076 | void Object::Wrap(v8::Isolate* isolate, const v8::Local<v8::Object>& wrapper,
      |              ^
 1077 |                   v8::Object::Wrappable* wrappable) {
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1084:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const PersistentBase<Object>' for 2nd argument
 1084 | void Object::Wrap(v8::Isolate* isolate, const PersistentBase<Object>& wrapper,
      |              ^                          ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1093:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const BasicTracedReference<Object>' for 2nd argument
 1093 | void Object::Wrap(v8::Isolate* isolate,
      |              ^
 1094 |                   const BasicTracedReference<Object>& wrapper,
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
1 error generated.

* [v8-init] Access crash key only from main thread | https://chromium-review.googlesource.com/c/chromium/src/+/6827167

* chore: e patches all

* chore: remove chore_restore_some_deprecated_wrapper_utility_in_gin.patch from patches

this remove line got re-added when rebasing roller/chromium/main

* chore: e patches all

* fix: include base/time/time.h when using base::Time

* chore: update patches

* Make --host-rules an alias for --host-resolver-rules.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/4867872

* ci: update BUILD_TOOLS_SHA

Refs https://github.com/electron/build-tools/pull/746

* [Fontations] Remove Fontations suffix from font names

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6835930

* temp: debug macOS addon build failure

* Revert "temp: debug macOS addon build failure"

This reverts commit 40bc8abab65dc83e17c4ab97cb6e7522a193fb44.

* test: run tests with Xcode 16.4

* ci: fix tccdb update for macOS 15

* spec: disable opening external application for loadURL

on macOS opening unknown external application will bring
up dialog to choose apps from application store which will
break our other test suites that want to capture screen
for pixel matching.

The loadURL spec that tests bad-scheme://foo is sufficient
that we hit the permission handler for openExternal since
at that point we already know the runtime gave up on handling
the scheme.

* chore: rebase patches

* chore: disable codesiging tests

* ci: update ScreenCaptureApprovals.plist for /bin/bash

* ci: try updating tcc permissions

* ci: update TCC permissions

Refs https://www.rainforestqa.com/blog/macos-tcc-db-deep-dive

* chore: test with 1st quadrant of the window

* chore: adjust for macOS 15 menubar height

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-29 12:31:47 +09:00
LZL
e39943bf45 fix: BrowserWindow add the same BrowserView (#48053)
fix: BrowserWindow add the same BrowserView (#48057)
2025-08-28 10:31:41 +02:00
David Sanders
f331606e07 build: bump NMV to 140 (#48196) 2025-08-27 18:57:00 -07:00
David Sanders
cca55117e4 build: refactor Linux binary stripping to align with upstream (#47932) 2025-08-27 18:56:31 -07:00
Erick Zhao
bf29d2f0bd docs: fix some module headings (#48177) 2025-08-27 14:52:26 -07:00
John Kleinschmidt
fea1a2a987 ci: use free GH arm runners (#47872) 2025-08-27 10:01:36 -04:00
dependabot[bot]
a51c56aca9 build(deps): bump amannn/action-semantic-pull-request from 6.0.1 to 6.1.1 (#48175)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 6.0.1 to 6.1.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](fdd4d3ddf6...48f256284b)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.1.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:52:36 +02:00
dependabot[bot]
89f25e6af3 build(deps): bump github/codeql-action from 3.29.10 to 3.29.11 (#48174)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.10 to 3.29.11.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](96f518a34f...3c3833e0f8)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.11
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:49:43 +02:00
Robo
e0db4046b2 refactor: allocate gin_helper::internal::Event on cpp heap (#48161) 2025-08-27 09:30:50 +09:00
Calvin
3b9130d815 docs: add release timeline for Electron 39 (#48167) 2025-08-26 14:19:56 -07:00
Shelley Vohr
52ed4646d9 chore: remove upstream OSR temp fix (#48162) 2025-08-26 16:22:45 -04:00
John Kleinschmidt
68098c317f build: remove no longer needed arg for siso (#48164)
* build: remove no longer needed arg for siso

* chore: test ffmpeg zip

* build: fix ffmpeg build with siso

* Revert "chore: test ffmpeg zip"

This reverts commit 2bbcc86039.
2025-08-25 16:46:36 -04:00
dependabot[bot]
52e0307cc1 build(deps): bump github/codeql-action from 3.29.7 to 3.29.10 (#48113)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.7 to 3.29.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](51f77329af...96f518a34f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 13:23:15 +02:00
dependabot[bot]
7fffe77909 build(deps-dev): bump stream-json and @types/stream-json (#48114)
Bumps [stream-json](https://github.com/uhop/stream-json) and [@types/stream-json](https://github.com/DefinitelyTyped/DefinitelyTyped/tree/HEAD/types/stream-json). These dependencies needed to be updated together.

Updates `stream-json` from 1.8.0 to 1.9.1
- [Commits](https://github.com/uhop/stream-json/compare/1.8.0...1.9.1)

Updates `@types/stream-json` from 1.7.7 to 1.7.8
- [Release notes](https://github.com/DefinitelyTyped/DefinitelyTyped/releases)
- [Commits](https://github.com/DefinitelyTyped/DefinitelyTyped/commits/HEAD/types/stream-json)

---
updated-dependencies:
- dependency-name: stream-json
  dependency-version: 1.9.1
  dependency-type: direct:development
  update-type: version-update:semver-minor
- dependency-name: "@types/stream-json"
  dependency-version: 1.7.8
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 12:58:38 +02:00
Robo
3ccb1bc0a8 refactor: allocate api::Session on cpp heap (#48141) 2025-08-25 18:52:06 +09:00
Shelley Vohr
0917ed5f6f fix: snapped restoration after minimization (#48142) 2025-08-22 14:37:45 -04:00
Samuel Attard
a67aad0f50 build: use siso instead of reclient (#47534) 2025-08-22 14:17:02 -04:00
reito
ceb6d28fd3 fix: webContent.fromId should be number instead of string (#48059) 2025-08-22 11:40:10 -04:00
Shelley Vohr
e12ab6708e chore: improve failed notification error messages on Windows (#48131) 2025-08-22 11:35:39 -04:00
Shelley Vohr
6101025368 fix: net.isOnline always true in utility processes (#48111)
* fix: net.isOnline always true in utilityProcesses

* Update shell/services/node/node_service.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-08-22 14:30:41 +02:00
dependabot[bot]
97b0280ad4 build(deps): bump amannn/action-semantic-pull-request from 5.5.3 to 6.0.1 (#48115)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 5.5.3 to 6.0.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](0723387faa...fdd4d3ddf6)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-21 10:44:27 +02:00
John Kleinschmidt
1044fe675d build: use new 7z command line switch (#48136)
-snld20 replaces -snld
2025-08-20 17:05:25 -04:00
John Kleinschmidt
42af60cc7e docs: update 38.0 breaking changes (#48117) 2025-08-20 14:15:01 -04:00
John Kleinschmidt
cadba11088 build: fixup docs only condition (#48128) 2025-08-20 12:58:54 -04:00
Shelley Vohr
8aeee3f714 refactor: use XmlWriter for Windows toasts (#48065)
refactor: use XmlWriter for Windows toasts
2025-08-20 16:06:51 +02:00
Robo
dd54e84a58 refactor: allocate api::App on cpp heap (#48118) 2025-08-20 20:35:08 +09:00
John Kleinschmidt
d4b7d9e9cf build: get source cache for docs only pipeline (#48120) 2025-08-20 11:07:00 +02:00
BILL SHEN
83a5ba1e2c feat: add fileBacked and purgeable fields to process.getSystemMemoryInfo() for macOS (#47628)
* fix: Optimize the value of memory.free in the return data of getSystemMemoryInfo().

* fix: Improve the value of memory in the return data of getSystemMemoryInfo().

* fix: complete API doc.

* Update docs/api/process.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* fix: update name to fileBacked.

* fix: fix with code conflict

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
2025-08-20 09:49:41 +02:00
Shelley Vohr
13d955a73e fix: system accent color parsing hex order (#48085)
fix: system accent color parsing
2025-08-19 10:01:41 +02:00
Samuel Attard
fdf29ce838 fix: ensure snapshot is valid (#48101) 2025-08-18 14:35:58 -07:00
Samuel Attard
3770bb31a7 fix: avoid deprecated login item methods (#48090) 2025-08-17 22:00:52 -07:00
dependabot[bot]
ed4a99ba5b build(deps-dev): bump @azure/storage-blob from 12.25.0 to 12.28.0 (#48055)
Bumps [@azure/storage-blob](https://github.com/Azure/azure-sdk-for-js) from 12.25.0 to 12.28.0.
- [Release notes](https://github.com/Azure/azure-sdk-for-js/releases)
- [Changelog](https://github.com/Azure/azure-sdk-for-js/blob/main/documentation/Changelog-for-next-generation.md)
- [Commits](https://github.com/Azure/azure-sdk-for-js/compare/@azure/storage-blob_12.25.0...@azure/storage-blob_12.28.0)

---
updated-dependencies:
- dependency-name: "@azure/storage-blob"
  dependency-version: 12.28.0
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-16 09:39:46 +02:00
Shelley Vohr
0e6c26096f fix: shell.openPath should be non-blocking (#48079)
fix: shell.openPath should be non-blocking
2025-08-15 13:55:31 -07:00
Keeley Hammond
7792ed1efa build: revert bump @octokit/rest from 20.1.2 to 22.0.0 (#48082)
Revert "build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.0 (#48014)"

This reverts commit 13ed526ca7.
2025-08-14 20:50:09 -07:00
Robo
c75c390ccf chore: add uma results in macOS keychain patch (#48080) 2025-08-15 11:10:37 +09:00
Shelley Vohr
4c3c3049e1 build: disallow non-maintainer changes to GitHub Actions workflows (#48038) 2025-08-14 13:54:05 -07:00
Shelley Vohr
68e7b38c05 build: use quick tunnels for ssh debugging (#47938)
* build: use dynamic local tunnels for ssh debugging

* weeee

* that'll do

* chore: pretty output

* build: allow ssh input

---------

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-08-14 07:41:07 -04:00
dependabot[bot]
a051c7c274 build(deps): bump actions/download-artifact from 4.3.0 to 5.0.0 (#48052)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 4.3.0 to 5.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](d3f86a106a...634f93cb29)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-13 14:33:48 +02:00
Shelley Vohr
53003d7af9 fix: app.accessibilitySupportEnabled (#48041)
fix: app.accessibilitySupportEnabled on macOS
2025-08-12 16:51:27 -04:00
David Sanders
63d7f609cd ci: manually fetch author_association in workflow automations (#48013) 2025-08-12 10:30:41 -07:00
electron-roller[bot]
01291623af chore: bump chromium to 141.0.7350.0 (main) (#48032)
* chore: bump chromium in DEPS to 141.0.7349.0

* chore: bump chromium in DEPS to 141.0.7350.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-08-12 11:31:17 +02:00
dependabot[bot]
13ed526ca7 build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.0 (#48014)
Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.2 to 22.0.0.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.2...v22.0.0)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-12 11:18:08 +02:00
Shelley Vohr
afb0ee418c fix: re-entrancy issues in webContents.loadURL() (#48004)
fix: re-entrancy issues in webContents.loadURL()
2025-08-11 11:20:35 -04:00
electron-roller[bot]
55d8b71d72 chore: bump chromium to 141.0.7346.0 (main) (#47983)
* chore: bump chromium in DEPS to 141.0.7341.0

* chore: bump chromium in DEPS to 141.0.7342.0

* chore: update patches

manually resolved conflict in `osr_shared_texture_remove_keyed_mutex_on_win_dxgi.patch` due to https://crrev.com/c/6681354

* 6819541: WebShare: Improve mac share behavior when sharing a URL
https://chromium-review.googlesource.com/c/chromium/src/+/6819541

* Add missing include for SkBitmap

Couldn't quickly find where we lost the full definition in this file's includes. 🤷

* 6771055: [SxS] Move devtools to ContentsContainerView supporting side-by-side.
https://chromium-review.googlesource.com/c/chromium/src/+/6771055

There may be some simplification possible here (set_x, Rect position, ...), but this change is satisfactory to maintain the current behavior.

* 6813689: Switch SystemMemoryInfoKB to use ByteCount
https://chromium-review.googlesource.com/c/chromium/src/+/6813689

* 6818486: Track DevTools feature usage in new badge tracker
https://chromium-review.googlesource.com/c/chromium/src/+/6818486

* chore: bump chromium in DEPS to 141.0.7344.0

* Remove ELECTRON_OZONE_PLATFORM_HINT env var

6819616: Remove OzonePlatformHint | https://chromium-review.googlesource.com/c/chromium/src/+/6819616

See: https://github.com/electron/electron/issues/48001

* chore: update patches

* Add missing include for `base::NumberToString`

* Remove `DESKTOP_STARTUP_ID` code

This was removed upstream in https://chromium-review.googlesource.com/c/chromium/src/+/6819616 and I confirmed with the author that it was an intentional change. Going to mirror upstream and remove it here too.

* chore: bump chromium in DEPS to 141.0.7346.0

* chore: update patches

* 6828465: Reland "Remove BluezDBusThreadManager"
https://chromium-review.googlesource.com/c/chromium/src/+/6828465

* Patch change to Node.js test output

V8 enhanced the stack trace of "thenable" async tasks. A couple of Node.js tests needed to have their snapshots updates to accomodate the extra stack trace frames in the output.

This patch should be upstreamed to Node.js.

See:
6826001: fix thenable async stack trace
https://chromium-review.googlesource.com/c/v8/v8/+/6826001

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-11 12:57:31 +09:00
Calvin
b9ceaabb85 docs: deprecate ELECTRON_OZONE_PLATFORM_HINT env var (#48002) 2025-08-10 21:49:23 +02:00
David Sanders
d6c0691a63 fix: importing from electron/utility in ESM (#47998) 2025-08-09 09:47:47 +02:00
David Sanders
a201d6c541 build: drop @types/webpack-env in favor of webpack/module types (#47798)
* build: drop @types/webpack-env in favor of webpack/module types

* chore: improve type when assigning to global.require
2025-08-08 18:09:23 -07:00
John Kleinschmidt
51add3e847 ci: cleanup use new arc cluster (#47916) 2025-08-08 09:26:10 -04:00
reito
9dcdec5015 feat: paint event move texture data to handle, add colorSpace (#47315)
* feat: paint event move shared texture to handle, add color space

* feat: add breaking change

* fix: properties.

* fix: remove utf8 bom
2025-08-08 10:13:56 +02:00
reito
095e622a6a feat: context bridge support VideoFrame (#47316)
* feat: context bridge support VideoFrame

* docs: add VideoFrame to docs
2025-08-07 16:41:49 -04:00
Shelley Vohr
a0d983e4b5 feat: allow macOS tray to maintain position (#47838)
* feat: allow macOS tray to maintain position

* refactor: just use guid

* test: fixup tests

* docs: clarify UUID format
2025-08-07 19:25:50 +02:00
wujinli
f49a645c06 fix: compilation error when disabling extensions and pdf_viewer (#47964) 2025-08-07 11:18:32 -04:00
John Kleinschmidt
8ab5ac9069 ci: fixup mac runner hang (#47982) 2025-08-07 10:52:26 +02:00
Will Anderson
27a8cc531b chore: Remove redundant IS_WIN check inside electron_main_win.cc (#47967) 2025-08-07 09:54:13 +02:00
David Sanders
26ffc8505c fix: allow importing from electron/utility at runtime (#47968) 2025-08-07 09:53:42 +02:00
electron-roller[bot]
3b0f35a7e8 chore: bump chromium to 140.0.7339.2 (main) (#47929)
* chore: bump chromium in DEPS to 140.0.7330.0

* chore: bump chromium in DEPS to 140.0.7331.0

* chore: update patches

* fix: gn check failing on crashpad.h
Not yet sure what caused this

* fix: predictors::PreconnectManager -> content::PreconnectManager
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* chore: bump chromium in DEPS to 140.0.7333.0

* chore: bump chromium in DEPS to 140.0.7335.0

* chore: bump chromium in DEPS to 140.0.7337.0

* chore: update patches

* chore: restore some gin utility

* 6804057: [Extensions] Validate nodoc is specified as a boolean in schemas
https://chromium-review.googlesource.com/c/chromium/src/+/6804057

* fixup! chore: restore some gin utility

* fixup! fix: predictors::PreconnectManager -> content::PreconnectManager CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected
https://chromium-review.googlesource.com/c/chromium/src/+/6772346

Not certain about what the "correct" argument to pass here is. A quick dive into the CL suggests that passing `false` is safe to keep things working. The blast radius if this assumption is wrong is that "fling" scroll gestures may not work as expected with the OSR.

* 6789383: Uninstall SODA language pack after 30 days of inactivity
https://chromium-review.googlesource.com/c/chromium/src/+/6789383

* chore: update libcxx filenames

* chore: bump chromium in DEPS to 140.0.7339.0

* chore: update patches

* fixup! 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected https://chromium-review.googlesource.com/c/chromium/src/+/6772346

* chore: bump chromium in DEPS to 140.0.7339.2

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-06 20:14:23 -04:00
David Sanders
8769d5ba9e build: check zip manifest for chromedriver.zip (#47972) 2025-08-06 20:04:19 -04:00
dependabot[bot]
7f8b7c3873 build(deps-dev): bump @electron/lint-roller from 3.1.1 to 3.1.2 (#47963)
Bumps [@electron/lint-roller](https://github.com/electron/lint-roller) from 3.1.1 to 3.1.2.
- [Release notes](https://github.com/electron/lint-roller/releases)
- [Changelog](https://github.com/electron/lint-roller/blob/main/.releaserc.json)
- [Commits](https://github.com/electron/lint-roller/compare/v3.1.1...v3.1.2)

---
updated-dependencies:
- dependency-name: "@electron/lint-roller"
  dependency-version: 3.1.2
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-06 11:21:55 +02:00
David Sanders
8bf4260e3e test: add TS smoke test for electron/utility (#47969) 2025-08-06 10:30:39 +02:00
Charles Kerr
7a13c6f175 refactor: avoid deprecated v8::Context::GetIsolate() pt 4 (#47961)
* refactor: remove GetIsolate() calls from SetPrivate()

* refactor: remove excess GetIsolate() calls in PassValueToOtherContextInner()

* refactor: remove GetIsolate() calls from GetPrivate()

* refactor: add a v8::Isolate* local to ProxyFunctionWrapper()

* refactor: remove error_context->GetIsolate() call from PassValueToOtherContextInner()

* refactor: remove GetIsolate() call from ProxyFunctionWrapper()

* refactor: pass source and destination isolate as arg to CreateProxyForAPI()
2025-08-05 20:08:04 -05:00
Keeley Hammond
678fb400fd fix: video scrubbing on playback (#47703)
* fix: fix video scrubbing on playback

* chore: address review feedback

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-05 18:48:52 +02:00
Shelley Vohr
8806499904 fix: offscreen mode under window.open creation (#47868)
fix: offscreen mode under new window creation
2025-08-05 14:56:33 +02:00
dependabot[bot]
637a504e28 build(deps): bump github/codeql-action from 3.29.4 to 3.29.5 (#47962)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.4 to 3.29.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e828ff8d4...51f77329af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-05 14:41:57 +02:00
electron-roller[bot]
40cdfdb1d1 chore: bump node to v22.18.0 (main) (#47937)
* chore: bump node in DEPS to v22.18.0

* crypto: fix inclusion of OPENSSL_IS_BORINGSSL define

https://github.com/nodejs/node/pull/58845

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58960

* permission: propagate permission model flags on spawn

https://github.com/nodejs/node/pull/58853

* esm: syncify default path of ModuleLoader\.load

https://github.com/nodejs/node/pull/57419

* src: remove fast API for InternalModuleStat

https://github.com/nodejs/node/pull/58489

* src: simplify adding fast APIs to ExternalReferenceRegistry

https://github.com/nodejs/node/pull/58896/

* chore: fixup patch indices

* src: fix internalModuleStat v8 fast path

https://github.com/nodejs/node/pull/58054

* test: add tests to ensure that node.1 is kept in sync with cli.md

https://github.com/nodejs/node/pull/58878

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58942

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-04 14:40:36 -04:00
Robo
4ca10a1056 chore: move gin::Handle to gin_helper (#47959)
* chore: move gin::Handle to gin_helper

* chore: fix lint
2025-08-05 02:03:06 +09:00
Robo
9d05454dc7 chore: move gin::DeprecatedWrappable to gin_helper (#47958)
* chore: move gin::DeprecatedWrappable to gin_helper

This is in preparation for migrating to gin::Wrappable
based on cppgc #47922
The upstream class will be deleted soon via roller PR but
the cppgc migration should happen outside the roll, this
change retains the current functionality by copying the
implementation into //electron/shell/common/gin_helper.
The class can be deleted once the cppgc migration is complete.

* chore: fix lint:cpp
2025-08-04 23:28:01 +09:00
dependabot[bot]
0e862bba61 build(deps-dev): bump remark-preset-lint-markdown-style-guide from 4.0.0 to 6.0.1 (#47940)
build(deps-dev): bump remark-preset-lint-markdown-style-guide

Bumps [remark-preset-lint-markdown-style-guide](https://github.com/remarkjs/remark-lint) from 4.0.0 to 6.0.1.
- [Release notes](https://github.com/remarkjs/remark-lint/releases)
- [Changelog](https://github.com/remarkjs/remark-lint/blob/main/changelog.md)
- [Commits](https://github.com/remarkjs/remark-lint/commits)

---
updated-dependencies:
- dependency-name: remark-preset-lint-markdown-style-guide
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-04 14:29:36 +02:00
Shelley Vohr
4232ed2814 fix: crash on window.close() with webContents on blur (#47933)
fix: crash on window.close with WebContentsView on blur
2025-08-04 10:35:29 +02:00
Will Anderson
e7683bdd25 feat: Use DIR_ASSETS path to locate resource bundles (#47439)
* feat: Use DIR_ASSETS path to locate resource bundles

* Use DIR_ASSETS for calculating ASAR relative paths

* Add test to verify 'assets' matches parent dir of 'exe'

* Add Mac-specific test for assets path (but it is failing)

* test: Update app.getPath('assets') to expect an exception on Mac

* docs: Update docs for 'assets' path to indicate that it's only available on Windows + Linux

* fix: Don't define 'assets' mapping on macOS
2025-08-04 12:34:08 +09:00
Sam Maddock
bdaf3b9a2b refactor: replace webFrame.routingId with sync IPC (#47717)
* refactor: replace webFrame.routingId with sync IPC

* fix: GetConstructor missing isolate

* fix: missing isolate
2025-08-02 11:00:42 -04:00
Shelley Vohr
5c98e3609f feat: add {get|set}AccentColor on Windows (#47741)
* feat: add setAccentColor on Windows

* refactor: unify GetSystemAccentColor

* refactor: remove redundant parsing

* chore: fixup documentation

* Update docs/api/browser-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* Update docs/api/base-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

---------

Co-authored-by: Will Anderson <andersonw@dropbox.com>
2025-08-01 22:29:02 +02:00
dependabot[bot]
2cfccac074 build(deps-dev): bump folder-hash from 2.1.2 to 4.1.1 (#47931)
Bumps [folder-hash](https://github.com/marc136/node-folder-hash) from 2.1.2 to 4.1.1.
- [Release notes](https://github.com/marc136/node-folder-hash/releases)
- [Changelog](https://github.com/marc136/node-folder-hash/blob/main/CHANGELOG.md)
- [Commits](https://github.com/marc136/node-folder-hash/compare/v2.1.2...v4.1.1)

---
updated-dependencies:
- dependency-name: folder-hash
  dependency-version: 4.1.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-01 19:16:43 +02:00
electron-roller[bot]
03aad28412 chore: bump chromium to 140.0.7327.0 (main) (#47902)
* chore: bump chromium in DEPS to 140.0.7324.0

* chore: bump chromium in DEPS to 140.0.7325.0

* chore: remove @dsanders11's unused include patch
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6782507

* fix: apply keychain patch to new apple subdir
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* chore: update chromium patches

* chore: update other patches

* chore: bump chromium in DEPS to 140.0.7327.0

* fix: mistake in reapplied patch

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* chore: update patches

* fix: remove OnPrivateNetworkAccessPermissionRequired override
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6769208

* fix: update colorSpace property to use new unified value
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6795085

* fix: include OverlayWindowLiveCaptionButton
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787420

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* fix: format chromium_src/BUILD.gn
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

* fix: format BUILD.gn
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

* chore: include script/ in logged path

* fix: update filenames.libcxx.gni
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787279

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-31 18:11:00 -04:00
Sam Maddock
25e2459f31 feat: webFrameMain.fromFrameToken (#47850)
* feat: webFrameMain.fromFrameToken

* refactor: return null instead of undefined

* docs: mention renderer webFrame property

* chore: undo null->undefined in wfm.fromId api
this will be updated in another pr
2025-07-31 16:41:44 -04:00
Shelley Vohr
18af498cf1 build: roll build-images to 933c7d6 (#47880) 2025-07-31 12:08:45 -04:00
John Kleinschmidt
9f43503b3e chore: revert "ci: fixup mac runners" (#47917)
This reverts commit 06d7a51a58.
2025-07-31 11:08:43 -04:00
Shelley Vohr
ecb1eb0b5d feat: add app.getRecentDocuments() (#45839)
feat: add app.getRecentDocuments()
2025-07-31 16:15:33 +02:00
dependabot[bot]
2c916cfa33 build(deps-dev): bump @octokit/rest from 20.1.1 to 20.1.2 (#47818)
* build(deps-dev): bump @octokit/rest from 20.1.1 to 22.0.0

Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.1 to 22.0.0.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.1...v22.0.0)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump octokit/rest to 20.1.2

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-07-31 14:30:45 +02:00
Shelley Vohr
4c9ab8765b fix: dark mode on Linux default themeing (#47869) 2025-07-31 10:54:55 +02:00
dependabot[bot]
051f78dd1d build(deps): bump actions-cool/issues-helper from 3.6.0 to 3.6.2 (#47905)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.0 to 3.6.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](a610082f8a...50068f49b7)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.6.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-31 10:54:25 +02:00
dependabot[bot]
c796a74467 build(deps): bump github/codeql-action from 3.29.2 to 3.29.4 (#47904)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.2 to 3.29.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](181d5eefc2...4e828ff8d4)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.4
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-31 10:54:03 +02:00
John Kleinschmidt
0d0cbaf7b4 ci: use new arc cluster (#47897) 2025-07-30 13:45:24 -04:00
Charles Kerr
63c452dcc7 refactor: avoid deprecated v8::Context::GetIsolate() calls pt 3 context get isolate pt 3 (#47901)
* refactor: add a v8::Isolate* arg to RendererClientBase::IsWebViewFrame()

Needed for creating gin dictionaries

refactor: add a v8::Isolate* arg to ShouldLoadPreload()

Needed for calling IsWebViewFrame()

* refactor: add a v8::Isolate* arg to electron::util::CompileAndCall()

* refactor: add a v8::Isolate* arg to OnCreatePreloadableV8Context()

* refactor: add a v8::Isolate* arg to InvokeEmitProcessEvent()

* refactor: add a v8::Isolate* arg to ServiceWorkerData's constructor

* refactor: add a v8::Isolate* arg to RendererClientBase::SetupMainWorldOverrides()

* refactor: add a v8::Isolate* arg to RendererClientBase::WilLReleaseScriptContext()

* docs: update docs to avoid v8::Context::GetIsolate()

* refactor: add a v8::Isolate* arg to ElectronSandboxedRendererClient::InitializeBindings()

* refactor: avoid v8::Context::GetIsolate() call in PromiseBase::SettleScope::~SettleScope()
2025-07-30 09:14:38 -05:00
electron-roller[bot]
f6407b4949 chore: bump chromium to 140.0.7314.0 (main) (#47882)
* chore: bump chromium in DEPS to 140.0.7314.0

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

* 6632993: PDF Searchify IPH: Use embedder WebContents for GuestView PDF

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6632993

* 6769214: [ios blink] Set IOSurface shared memory region on all GMB handles

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769214

* chore: update patches

* 6769572: [soft navs]: Move AsyncSameDocumentNavigationStarted to TaskAttributionTracker

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769572

* chore: node gen-libc++-filenames.js

* 6765740: [SxS] Implement support for split view in extensions API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765740

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-28 15:31:54 -07:00
John Kleinschmidt
06d7a51a58 ci: fixup mac runners (#47877)
ci: make sure camera and bluetooth are available on macos

ci: turn off spotlight indexing
2025-07-28 13:37:05 -04:00
Charles Kerr
2255bb620a refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 2) (#47879)
* refactor: add a v8::Isolate* arg to Constructible::GetConstructor()

* refactor: add a v8::Isolate* arg to NodeBindings::Initialize()

This is needed for the GetConstructor() call

* refactor: avoid v8::Context::GetIsolate() call in GetIpcObject() by taking it as an arg

* refactor: avoid v8::Context::GetIsolate() call in ipc_native::EmitIPCEvent() by taking it as an arg
2025-07-28 10:22:27 -05:00
Charles Kerr
084c6ef549 refactor: prefer GetCreationContextChecked(v8::Isolate*) over GetCreationContextChecked() (#47878)
* refactor: pass an isolate when calling GetCreationContextChecked() in V8FunctionInvoker

* refactor: pass an isolate when calling GetCreationContextChecked() in RendererClientBase

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::Completed()

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::CopyResultToCallingContextAndFinalize()

* refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()

* refactor: pass an isolate when calling GetCreationContextChecked() in gin_helper::internal::CallMethodWithArgs()

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalPropertyFromIsolatedWorld()

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalValueFromIsolatedWorld()

* refactor: pass an isolate when calling GetCreationContextChecked() in ProxyFunctionWrapper()

* refactor: pass an isolate when calling GetCreationContextChecked() in PassValueToOtherContextInner()

* fixup! refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()
2025-07-25 09:06:57 -05:00
Shelley Vohr
01faaa30ea fix: window content protection on older Windows versions (#47856) 2025-07-24 12:05:28 -07:00
electron-roller[bot]
c569d5e4ba chore: bump chromium to 140.0.7312.0 (main) (#47862)
* chore: bump chromium in DEPS to 140.0.7312.0

* 6769540: Move NetworkTrafficAnnotationTag out of PreconnectManager.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769540

* 6771377: Roll libc++ from 3eda1e62e799 to 569aa83b4bbc (7 revisions)

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771377

* 6771398: Remove unnecessary std::optional wrappers in ResolveHostClient

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771398

* chore: update patches

* 6776165: Use shared session bus for MPRIS

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6776165

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-23 16:26:30 -07:00
Shelley Vohr
670da27305 ci: add ability to debug SSH sessions in CI (#47819) 2025-07-23 10:57:06 -04:00
dependabot[bot]
5f901174c5 build(deps): bump slackapi/slack-github-action from 2.1.0 to 2.1.1 (#47748)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 2.1.0 to 2.1.1.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](b0fa283ad8...91efab103c)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-version: 2.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-23 11:24:17 +02:00
xufuhang
b39a1fb877 fix: webContents.downloadURL() did not support referer header (#47625)
Signed-off-by: xufuhang <576484918@qq.com>
2025-07-23 10:37:24 +02:00
Robo
2156ccb577 ci: update llvmobjdump package as part of fix sync (#47858) 2025-07-23 17:05:30 +09:00
electron-roller[bot]
9e2f7065a0 chore: bump chromium to 140.0.7309.0 (main) (#47848)
* chore: bump chromium in DEPS to 140.0.7309.0

* 6762172: Replace MSG_ROUTING_NONE with IPC::mojom::kRoutingIdNone.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6762172

* 6759543: [exit-time-destructors] Exclude target with warnings

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759543

* 6765167: Split PreconnectManager into interface and implementation.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765167

* 6766775: [media] Clarify coded and visible size in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6766775

* 6760878: Move PreconnectRequest to //content/public

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6760878

* 6718973: Implement media playback trust check for the video PiP overlay window

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6718973

* chore: add missing include of <iterator> in ada

* chore: update patches

* chore: node gen-libc++-filenames.js

* 6759633: [media] Use format from shared image in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759633

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-22 16:09:47 -07:00
Niklas Wenzel
51bfe07da9 build: extend Chromium options in bug report template (#47829)
* build: extend Chromium options in bug report template

As predicted by @dsanders11 and others, we got a bunch of bug reports with clearly incorrect values for "does this issue appear in Chromium?" because people didn't test or didn't know how to test.

This PR adds an "I didn't know how to test" option.

* build: update wording to use present tense
2025-07-21 15:26:02 -04:00
Shelley Vohr
4699761649 build: improve check-zip-manifest (#47828)
* build: improve check-zip-manifest

* fix: unicode on Windows
2025-07-21 15:20:27 -04:00
electron-roller[bot]
26e1bda335 chore: bump chromium to 140.0.7301.0 (main) (#47747)
* chore: bump chromium in DEPS to 140.0.7296.0

* chore: update patches

* 6702959: Remove OwnedByWidgetPassKey usage from content analysis dialog tests | https://chromium-review.googlesource.com/c/chromium/src/+/6702959

* 6722750: Remove un-used `stream_id` argument for `AidaCodeComplete` | https://chromium-review.googlesource.com/c/chromium/src/+/6722750

* 6696478: Reland Reland [video pip] Add fade in/out animation to controls visibility changes | https://chromium-review.googlesource.com/c/chromium/src/+/6696478

* chore: update libc++-filenames

* build: explicitly include cstdlib in Boyer-Moore patch

* chore: bump chromium in DEPS to 140.0.7297.0

* chore: update patches

* 6729537: [FPF] Pipe flag state from the browser to the renderer | https://chromium-review.googlesource.com/c/chromium/src/+/6729537

* 6727996: [Win] Detect pre-IPC crashes in sandboxed utility processes | https://chromium-review.googlesource.com/c/chromium/src/+/6727996

* 6707182: Move wtf/cross_thread_copier*.* to "blink" namespace | https://chromium-review.googlesource.com/c/chromium/src/+/6707182

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

* chore: bump chromium in DEPS to 140.0.7299.0

* chore: update patches

* chore: update main patches

* build: reset the minimum macOS SDK to 15 to match upstream

This reverts commit 499e987c77.

* 6730215: Remove IPC_MESSAGE_LOG_ENABLED ifdef blocks. | https://chromium-review.googlesource.com/c/chromium/src/+/6730215

* 6690442: Delete ppapi/buildflags/buildflags.h | https://chromium-review.googlesource.com/c/chromium/src/+/6690442

* [wip]: 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

* chore: bump chromium in DEPS to 140.0.7301.0

* chore: update patches

* 6656309: extensions: Port proxy API to desktop Android | https://chromium-review.googlesource.com/c/chromium/src/+/6656309

* 6758510: Reland 'Move GN enable_plugins variable out of //ppapi' | https://chromium-review.googlesource.com/c/chromium/src/+/6758510

* 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

* 6735979: [FSA] Replace `request_writable` with a new enum `FileSystemAccessPermissionMode`. | https://chromium-review.googlesource.com/c/chromium/src/+/6735979

* 6712080: Reland "Turn on gender translation PAK generation everywhere" | https://chromium-review.googlesource.com/c/chromium/src/+/6712080

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

* build: restore minimum macOS SDK to 10, restore patch

This reverts commit a04c579b99.

* fixup! 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

* chore: correct node patches

* fixup! 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-21 09:32:53 -07:00
Shelley Vohr
cf871bce4e build: fix ffmpeg generation on Windows non-x64 (#47768)
* build: fix ffmpeg generation on Windows non-x64

* test: ffmpeg artifact
2025-07-21 11:33:42 -04:00
Charles Kerr
39cca586f6 refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 1) (#47760)
* refactor: avoid redundant GetIsolate() calls in NodeBindings::CreateEnvironment()

Xref: https://chromium-review.googlesource.com/c/v8/v8/+/6563615

* refactor: use v8::Isolate::GetCurrent() in Initialize() methods

* refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

* fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

* refactor: add v8::Isolate* arg to RendererClientBase::DidCreateScriptContext()

* fixup! refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

* fixup! fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

refactor: prefer JavascriptEnvironment::GetIsolate() in the browser layer
2025-07-21 16:34:38 +02:00
Shelley Vohr
2f4a070c39 fix: dialog file filters and macOS app bundles (#47825) 2025-07-21 13:57:50 +02:00
electron-roller[bot]
2b098408a8 chore: bump node to v22.17.1 (main) (#47776)
* chore: bump node in DEPS to v22.17.1

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-18 15:18:18 -04:00
Shelley Vohr
fa844268ec ci: remove kTCCServiceMicrophone change (#47816)
ci: remove kTCCServiceMicrophone change
2025-07-18 10:02:06 +02:00
Shelley Vohr
a29a72c3ab build: update codespace on-create-command (#47810)
build: update codespace on-create-command
2025-07-18 10:01:49 +02:00
Shelley Vohr
4601aeccde chore: clean up NativeWindowMac::UpdateVibrancyRadii (#47665)
chore: clean up NativeWindowMac::UpdateVibrancyRadii
2025-07-17 11:45:24 -04:00
Shelley Vohr
31b18c9830 fix: abnormal behavior of windows background material (#47386)
* fix: abnormal behavior of windows background material

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: update patches

* fix: setting background material after init

---------

Co-authored-by: zoy <zoy-l@outlook.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-17 14:50:12 +02:00
Shelley Vohr
895bf9103e fix: handle missing NativeWindowMac in ElectronNSWindow (#47751)
fix: handle missing NativeWindowMac in ElectronNSWindow
2025-07-17 14:49:37 +02:00
David Sanders
bf51d345c8 build(dev-deps): drop unused @types/webpack dep (#47767) 2025-07-17 11:04:11 +02:00
Shelley Vohr
6eef170d9a test: re-enable native module tests (#46747) 2025-07-17 11:03:15 +02:00
Shelley Vohr
31725b4a86 fix: window accentColor should adhere to native window behavior (#47740)
* fix: window accentColor should adhere to native window behavior

* fix: address review feedback

* chore: remove duplicate UpdateWindowAccentColor call in ctor
2025-07-17 10:59:42 +02:00
John Kleinschmidt
ec748eb915 test: cleanup RenderFrame lifespan tests (#47746)
* test: cleanup RenderFrame lifespan tests

* test: disable navigator.serial tests on arm64 mac

debug the hang

test: disable navigator.bluetooth on arm64 mac

Revert "test: disable navigator.bluetooth on arm64 mac"

This reverts commit 4b53a8485a5ff391832c7da93d859f1aa8722e70.

Revert "debug the hang"

This reverts commit 00338f0d49a7918224822087b4510fa9db0686c3.

Revert "test: disable navigator.serial tests on arm64 mac"

This reverts commit fb515ce447a9d42185e84b17b460e4fb6d1bf71d.

Reapply "test: disable navigator.serial tests on arm64 mac"

This reverts commit 0e5608108ffebbe8b8b27af9ea06aadae2ea85dd.

Reapply "test: disable navigator.bluetooth on arm64 mac"

This reverts commit f4c7d3fc0624a22421cba5d3d75df8c5d4367eea.

fixup

* test: add waitUntil for flaky test
2025-07-16 16:19:55 -04:00
Shelley Vohr
5feb91e2f4 test: fix extensions console flake (#47750) 2025-07-16 18:27:20 +02:00
Shelley Vohr
5128ebeddb test: deflake clipboard read/write specs (#47752) 2025-07-16 18:27:11 +02:00
Calvin
389927dce8 fix: corner smoothing feature gate crash (#47759)
* fix: corner smoothing feature gate crash

* Fix ElectronCornerSmoothing::CSSValueFromComputedStyleInternal
2025-07-16 08:39:17 -07:00
Calvin
67afc10b75 fix: add macos memory query fallback patch to avoid crash (#47765) 2025-07-16 08:18:54 -07:00
Pratyush
f570e6967f docs: fix broken sentence in crashReporter.start() documentation (#47688) 2025-07-16 15:05:45 +02:00
Shelley Vohr
09ab71de43 fix: deprecation warning crash when no Node.js environment available (#47700) 2025-07-16 12:45:59 +02:00
Milan Burda
21b325b034 docs: improve win.setContentProtection() docs (#46596)
* docs: improve win.setContentProtection() docs

* docs: update Windows display affinity value

* docs: update Windows behavior description

* Revert "docs: update Windows behavior description"

This reverts commit 6d1942c53a.

* Revert "docs: update Windows display affinity value"

This reverts commit c15363e75d.

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-07-15 15:16:56 -07:00
Erick Zhao
cc9ca4bee2 docs: add Menu module tutorials (#47268)
* docs: add `Menu` module tutorials

* link API docs to new tutorials

* removed unreferenced fiddles

* add wording for new types

* fix import sort errors

* delete accelerator.md

* fixes
2025-07-15 15:09:32 -07:00
Shelley Vohr
17dba93587 fix: missing SQLite builtin support in Node.js (#47706)
https://github.com/nodejs/node/pull/58122
2025-07-15 15:39:16 +02:00
electron-roller[bot]
603cafad7e chore: bump chromium to 140.0.7281.0 (main) (#47616)
* chore: bump chromium in DEPS to 140.0.7269.2

* chore: bump chromium in DEPS to 140.0.7270.0

* chore: bump chromium in DEPS to 140.0.7271.0

* chore: bump chromium in DEPS to 140.0.7273.0

* 6516731: [ExclusiveAccessForAndroid] remove unneeded includes & deps | https://chromium-review.googlesource.com/c/chromium/src/+/6516731

* 6694809: dbus: Ensure systemd scope is started before using any portal services | https://chromium-review.googlesource.com/c/chromium/src/+/6694809

* chore: patch chromium

* chore: export patches

* chore: bump chromium in DEPS to 140.0.7275.0

* 6677511: [pepper] More pepper removal | https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: export chromium patches

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: bump chromium in DEPS to 140.0.7277.0

* chore: bump chromium in DEPS to 140.0.7279.0

* chore: bump chromium in DEPS to 140.0.7281.0

* 6677314: Plumb enabled client hints in the network requestion to network layer

https://chromium-review.googlesource.com/c/chromium/src/+/6677314

* 6351556: [source-phase-imports] Support Wasm Source Phase Imports

https://chromium-review.googlesource.com/c/chromium/src/+/6351556

* 6700077: [renderer] Avoid calls to deprecated GetIsolate methods

https://chromium-review.googlesource.com/c/chromium/src/+/6700077

* 6692873: Reland "Reland "FSA: Only normalize the hardcoded rules once during initialization""

https://chromium-review.googlesource.com/c/chromium/src/+/6692873

* 6686234: [gin] Cleanup NamedPropertyInterceptor for Wrappable

https://chromium-review.googlesource.com/c/chromium/src/+/6686234

* chore: export patches

* 6667723: Remove content_enable_legacy_ipc GN arg.

https://chromium-review.googlesource.com/c/chromium/src/+/6667723

* 6646566: ui: Move NativeWindowTracker to its own directory

https://chromium-review.googlesource.com/c/chromium/src/+/6646566

* fix: add missing includes

* 6580522: [WAR, DNR] Fix unsafe redirect error to web accessible resource

https://chromium-review.googlesource.com/c/chromium/src/+/6580522

* 6680477: Implement `completeCode` endpoint and expose to DevTools

https://chromium-review.googlesource.com/c/chromium/src/+/6680477

* 6677511: [pepper] More pepper removal

https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6696689: Rename views::WidgetFocusManager -> NativeViewFocusManager

https://chromium-review.googlesource.com/c/chromium/src/+/6696689

* 6702812: Move wtf/text/string_impl*.* to "blink" namespace

https://chromium-review.googlesource.com/c/chromium/src/+/6702812

* chore: fix dialog patch

* 6702431: [animation-trigger] Parse timeline-trigger-name

https://chromium-review.googlesource.com/c/chromium/src/+/6702431

* chore: fixup patch indices

* feat: replace webFrame.routingId with webFrame.frameToken

* feat: WebFrameMain.prototype.frameToken

* test: refactor to use replacement APIs

* chore: fixup pip patch

* test: adjust webFrame tests for frameToken changes

* 6703757: Reland "Enable -fsanitize=array-bounds in non-UBSan builds"

https://chromium-review.googlesource.com/c/chromium/src/+/6703757

* test: switch to frameTokens

* test: routingId is fine to test in the main process

* docs: add routingId to breaking changes

* docs: update plugin-crashed event

* chore: fixup linux dialog patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-14 13:42:37 -07:00
Shelley Vohr
09f269426e test: add response to bluetooth request possibilities (#47725) 2025-07-14 13:12:27 -04:00
Shelley Vohr
3bbb82b42b ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK (#47694)
ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK
2025-07-14 13:11:07 -04:00
Shelley Vohr
a9504abde9 build: roll sysroots (#47710) 2025-07-14 11:27:19 -04:00
BILL SHEN
9f3636ffe2 build: add platform-specific conditions to the source_set in chromium_src (#47627)
* build: Add platform-specific if conditions to the source sets in chromium_src.

* build: Add platform-specific if conditions to the source sets in chromium_src.
2025-07-14 11:25:16 +02:00
Shelley Vohr
4a89068fb7 ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors (#47726)
ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors
2025-07-13 21:05:52 +02:00
John Kleinschmidt
137d4ec329 build: cleanup symlinks in cache (#47727)
* build: cleanup symlinks in cache

* build: ignore broken links

* try --ignore-failed-read

* build: dont deref symlinks

* build: add flag to 7zip to resolve symlink error

Needed to ignore Dangerous symbolic link path was ignored errors

* Revert "build: cleanup symlinks in cache"

This reverts commit 69e53cdc88.
2025-07-11 16:13:12 -04:00
David Sanders
624d085632 build: deep update brace-expansion to resolve an audit alert (#47692) 2025-07-11 09:57:41 +02:00
Robo
600b6b3315 build: reenable v8_enable_temporal_support (#47699)
* build: reenable v8_enable_temporal_support

* ci: test with increased vm map count

* chore: backport PA use fewer vmas by default on linux

* chore: update patches

* Revert "ci: test with increased vm map count"

This reverts commit b626c9a5ab7ad3f01e17d77c330abfd8096a8b02.

* ci: remove logs

---------

Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-11 02:49:54 +09:00
David Sanders
9e67bd3508 ci: update audit CI workflow dependencies (#47691)
* ci: update audit CI workflow dependencies

* ci: bump to @electron/fiddle-core@2.0.1
2025-07-10 19:19:36 +02:00
Shelley Vohr
909fd3d55a ci: set git core.longpaths to true (#47695)
ci: set git core.longpaths to true
2025-07-10 19:13:39 +02:00
Niklas Wenzel
f2429c31c1 build: ask bug reporters to check if it is a Chromium issue (#47702)
* build: ask bug reporters to check if it is a Chromium issue

Inspiration: https://github.com/electron/electron/issues/47672#issuecomment-3051298922

* build: fix options
2025-07-10 08:47:04 -07:00
Shelley Vohr
fbb83be785 refactor: use dbus_thread_linux::GetSharedSessionBus() (#47685)
refactor: use dbus_thread_linux::GetSharedSessionBus()
2025-07-10 10:17:34 +02:00
Shelley Vohr
1eab19fc7c build: remove unused script (#47642) 2025-07-09 10:35:04 -04:00
Shelley Vohr
02f2feabe6 docs: update build prerequisites (#47680) 2025-07-09 12:07:24 +02:00
David Sanders
712262597d build: drop eslint-plugin-unicorn (#47676) 2025-07-08 15:20:56 +02:00
Shelley Vohr
31bc5ca903 fix: default to system accent color on invalid user color (#47660)
fix: default to system accent color on invalid user color"
2025-07-08 11:15:13 +02:00
Shelley Vohr
03a02fc31e fix: fullscreen for windows without rounded corners (#47664) 2025-07-08 11:14:14 +02:00
Shelley Vohr
5ef6897bc7 fix: accent color should reflect system settings without restart (#47629)
fix: accentColor should reflect system settings without restart
2025-07-03 18:13:39 +02:00
Charles Kerr
bc585b6a3f refactor: avoid a few unnecessary strings (#47644)
* perf: replace string temporary with string_view in GetXdgAppId()

* perf: replace string temporary with string_view in ToV8(WindowOpenDisposition)

* perf: replace string temporary with string_view in ToV8(electron::api::WebContents::Type)
2025-07-03 11:08:59 -05:00
David Sanders
4c460df0a4 ci: fix audit workflow alerting on stale results (#47643) 2025-07-03 14:42:04 +02:00
Shelley Vohr
cf193b279b fix: crash on source capture with empty thumbnail size (#47641) 2025-07-03 14:41:19 +02:00
Shelley Vohr
655037fbdf fix: window.open popups are always resizable (#47540)
fix: window.open popups are always resizable

Closes https://github.com/electron/electron/issues/43591.

Per current WHATWG spec, the `window.open` API should always
create a resizable popup window. This change updates the
`parseFeaturesString` function to ensure that windows opened
with `window.open` are always resizable, regardless of the
`resizable` feature string.
2025-07-02 15:02:59 +02:00
Samuel Attard
07338bb1cf build: update yarn to 1.22.22 (#47635) 2025-07-02 12:11:42 +02:00
reito
fb0b77b731 feat: add ColorSpace (#47314) 2025-07-02 00:09:09 -07:00
Keeley Hammond
499e987c77 build: set the minimum macOS SDK to 10.15 (#47634)
* build: set the minumum macOS SDK to 10.15

* build: revert "Update mac_sdk_min to match minimum required SDK version"

This reverts commit 3d4654fc18.
2025-07-01 18:51:08 -07:00
Cas_
f7138344d8 docs: discoverability of chromium switches (#44947)
* docs: document discoverability of chromium switches

* docs: fixed typo

* docs: reference chromium endorsed list of swithes

* docs: reorder command-line-switches

* fix: address review

* fix: typo

* fix: wording

* Update command-line-switches.md

fix: lint space

* fix: Update docs/api/command-line-switches.md

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-07-01 14:31:49 -07:00
dependabot[bot]
b9248e6782 build(deps): bump github/codeql-action from 3.29.0 to 3.29.2 (#47622) 2025-07-01 11:12:15 +02:00
Shelley Vohr
af39dcfb09 refactor: use non-deprecated macOS API in RemoveAsDefaultProtocolClient (#47506)
refactor: use non-deprecated macOS API in RemoveAsDefaultProtocolClient
2025-07-01 10:19:28 +02:00
Samuel Attard
d347632046 build: write abi version to published npm package (#47598) 2025-06-30 15:01:09 -07:00
electron-roller[bot]
4f69c5835e chore: bump chromium to 140.0.7261.0 (main) (#47561)
* chore: bump chromium in DEPS to 140.0.7259.0

* chore: update patches

* Add fade in animation to Picture-in-Picture windows

https://chromium-review.googlesource.com/c/chromium/src/+/6538268

* [v8] Use V8 Apis that don't return JSGlobalObject

Refs https://issues.chromium.org/issues/333672197

* chore: IWYU

* chore: bump chromium in DEPS to 140.0.7261.0

* chore: update patches

* revert: update to siso-chromium image

* [v8] Use v8::Object::WrapGlobal()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6650977

* chore: IWYU

* chore: fix --trace-startup spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-30 12:30:05 -04:00
Taiki Komoda
fa15332587 docs: update automated-testing.md (#47017)
* Update automated-testing.md

* fixed lint error
2025-06-30 10:56:48 +02:00
Shelley Vohr
e299a1d098 feat: support complete WebUSB device properties (#47459)
* feat: support complete WebUSB device properties

* docs: correct type consistency
2025-06-30 10:28:21 +02:00
Charles Kerr
c2302960a8 refactor: reduce scope of temporaries when getting dictionary values (#47581)
refactor: reduce scale of temporaries when getting dictionary values
2025-06-29 21:58:18 +02:00
Charles Kerr
5e862f398e fix: Reland "[accessibility] Platform node lifetime cleanups" (#47590)
Reland "[accessibility] Platform node lifetime cleanups"

https://chromium-review.googlesource.com/c/chromium/src/+/6462552
2025-06-29 21:57:48 +02:00
Shelley Vohr
61c245761c test: fix nan tests on macOS (#47583) 2025-06-29 21:57:44 +02:00
Charles Kerr
7c55b24be2 refactor: avoid copies of large objects in range based for loops (#47588)
* Avoid copies of large objects in range-based for-loops.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6527689

* Avoid copies of large objects in range-based for-loops in Browser::ShowAboutPanel()
2025-06-29 21:32:26 +02:00
Charles Kerr
4af248f2b6 perf: avoid copying a vector when calling ConvertToWeakPtrVector() (#47593) 2025-06-29 21:32:03 +02:00
Erick Zhao
69e9b653ba docs: update example apps (#47597) 2025-06-29 21:31:42 +02:00
electron-roller[bot]
4dccccadbb chore: bump node to v22.17.0 (main) (#47557)
* chore: bump node in DEPS to v22.17.0

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* chore: adjust crypto specs:

- https://github.com/nodejs/node/pull/58117
- https://github.com/nodejs/node/pull/58387

* deps: update libuv to 1.51.0

https://github.com/nodejs/node/pull/58124

* test: fix test-buffer-tostring-range on allocation failure

https://github.com/nodejs/node/pull/58416

* build: use FILE_OFFSET_BITS=64 esp. on 32-bit arch

https://github.com/nodejs/node/pull/58090

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* inspector: add protocol method Network.dataReceived

https://github.com/nodejs/node/pull/58001

* test: force slow JSON.stringify path for overflow

https://github.com/nodejs/node/pull/58181

* chore: fixup patch indices

* 6049967: Remove protocol::Maybe and roll inspector_protocol

https://chromium-review.googlesource.com/c/chromium/src/+/6049967

* chore: fixup crypto test patch

* src: fix module buffer allocation

https://github.com/nodejs/node/pull/57738

* crypto: expose process.features.openssl_is_boringssl

https://github.com/nodejs/node/pull/58387

* util: add internal assignFunctionName() function

https://github.com/nodejs/node/pull/57916

* build: fix pointer compression builds

https://github.com/nodejs/node/pull/58171

* chore: put back config options

* fixup! deps: update libuv to 1.51.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-06-28 16:33:09 +02:00
Charles Kerr
79cd6a2614 refactor: sync IsKillURL() with upstream impl in extension_tab_util.cc (#47580)
Use base::MakeFixedFlatSet()
2025-06-27 15:49:41 -05:00
Charles Kerr
2ba8fe9140 refactor: extract-constant static Windows registry keys in Browser code (#47569)
* refactor: extract-constant for registry key in GetProcessExecPath()

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

* refactor: extract-constant for registry key in Browser::GetLoginItemSettings()

* chore: document the symbolic constants

* refactor: prefer base::wcstring_view::c_str() to data() to make zero-termination clearer
2025-06-27 10:34:55 -05:00
Charles Kerr
b21c4b0f88 refactor: make context bridge's private keys hidden, constexpr string_views (#47562)
* refactor: local functions GetPrivate(), SetPrivate() now take std::string_views

* refactor: make local keys std::string_views instead of C-style char arrays

* refactor: make local keys constexpr

* refactor: move local keys into local anonymous namespace
2025-06-27 09:29:53 -05:00
Charles Kerr
f50ad3d022 refactor: remove stray .c_str() calls for absl::StrFormat() (#47548)
refactor: remove stray .c_str() calls for absl::StrFormat()

StrFormat() understands std::string, std::string_view
2025-06-26 11:41:30 +02:00
Keeley Hammond
7a274a711c fix: revert upstream MacOS mouse event routing (#47560)
* fix: revert upstream MacOS mouse event routing

* fix: reduce patch surface area

* chore: update patches
2025-06-26 11:41:11 +02:00
Niklas Wenzel
bc499ffb8a docs: fix --experimental-network-inspection spelling (#47565)
doc: fix `--experimental-network-inspection` spelling
2025-06-26 11:40:55 +02:00
Niklas Wenzel
0a74e91580 docs: update asar integrity fuse availability (#47528) 2025-06-25 23:15:59 +02:00
electron-roller[bot]
035879357e chore: bump chromium to 139.0.7256.0 (main) (#47481)
* chore: bump chromium in DEPS to 139.0.7242.0

* chore: update render_widget_host_view_mac.patch

no code changes; just updating patch context

Do a cleanup pass on the history swiper code | https://chromium-review.googlesource.com/c/chromium/src/+/6604367

* chore: update mas_avoid_private_macos_api_usage.patch.patch

no code changes; just updating patch context

[tracing] Delete base/trace_event/base_tracing.h | https://chromium-review.googlesource.com/c/chromium/src/+/6624012

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

no manual changes; just updating patch context

[ActorFramework] Refactor Actor Task Management | https://chromium-review.googlesource.com/c/chromium/src/+/6618684

* chore: update fix_move_autopipsettingshelper_behind_branding_buildflag.patch

[pip] Tuck picture-in-picture windows when a file dialog is open | https://chromium-review.googlesource.com/c/chromium/src/+/6449682

Reland "[document pip] Restrict the size that a website can request" | https://chromium-review.googlesource.com/c/chromium/src/+/6372104

* chore: update feat_corner_smoothing_css_rule_and_blink_painting.patch

Xref: corner-shape: constraint radii based on opposite corner overlap | https://chromium-review.googlesource.com/c/chromium/src/+/6592572

* chore: update revert_code_health_clean_up_stale_macwebcontentsocclusion.patch

no manual changes; just updating patch context

* chore: update fix_rename_sqlite_win32_exports_to_avoid_conflicts_with_node_js.patch

no code changes; just updating patch context

* chore: e patches all

* Plumb Verify2QwacBinding and hook it up in QwacWebContentsObserver

https://chromium-review.googlesource.com/c/chromium/src/+/6624719

* [Extensions] Remove host delegate OnMainFrameCreatedForBackgroundPage

https://chromium-review.googlesource.com/c/chromium/src/+/6631123

* Extensions: Rename GetResourceURL to ResolveExtensionURL

https://chromium-review.googlesource.com/c/chromium/src/+/6625053

* [NonClientFrameView] Consolidate NativeFrameViewMac

https://chromium-review.googlesource.com/c/chromium/src/+/6614239

* ICWYU

* [views-ax] Remove dead code WidgetAXTreeIDMap

https://chromium-review.googlesource.com/c/chromium/src/+/6619701

* Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS"

https://chromium-review.googlesource.com/c/chromium/src/+/6630056

* NavigationThrottleRunner2: Remove MaybeAddThrottle

https://chromium-review.googlesource.com/c/chromium/src/+/6628079

* [pip] Tuck picture-in-picture windows when a file dialog is open

https://chromium-review.googlesource.com/c/chromium/src/+/6449682

* build: fix snapshot_blob.bin build error

xref: https://issues.chromium.org/issues/416540976

* chore: e patches all

* build: freeup disk space on macos

* chore: bump chromium in DEPS to 139.0.7244.0

* chore: update printing.patch

no manual changes; just updating patch context

* chore: remove upstreamed ignore_parse_errors_for_resolveshortcutproperties.patch

Prevent Windows crash on unexpected shortcut type | https://chromium-review.googlesource.com/c/chromium/src/+/6633298

* chore: e patches all

* Revert "Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS""

This reverts commit 77c4f967a6.

Revert CL for the high confidence crash culprit for http://crash/28f897bb9743dfe0 | https://chromium-review.googlesource.com/c/chromium/src/+/6641819

* Fix spec's expected base64-encoded PNG strings to match upstream changes.

[rust png] Enable by default. | https://chromium-review.googlesource.com/c/chromium/src/+/6085801

* chore: bump chromium in DEPS to 139.0.7246.0

* chore: e patches all

* chore: bump chromium in DEPS to 139.0.7248.0

* chore: update patches

* siso: Enable Siso by default for non-Google builds

https://chromium-review.googlesource.com/c/chromium/src/+/6638830

Disabling for now until we are ready to build siso on all platforms.

* Revert "revert Don't use static variable for UseExternalPopupMenus"

This reverts commit e91e3894e6.

* Update mac_sdk_min to match minimum required SDK version

https://chromium-review.googlesource.com/c/chromium/src/+/6493969
(cherry picked from commit 3e7cbe912d)

* [video pip] Use default window styling on Mac

https://chromium-review.googlesource.com/c/chromium/src/+/6648665

* Reland "Force the unintentional renderer process creation check by default"

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* chore: bump chromium in DEPS to 139.0.7249.0

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* chore: update patches

* chore: bump chromium in DEPS to 139.0.7250.0

* chore: bump chromium in DEPS to 139.0.7252.0

* chore: bump chromium in DEPS to 139.0.7254.0

* 6638187: browser level TOCTOU check for coordinate target

https://chromium-review.googlesource.com/c/chromium/src/+/6638187

* chore: fixup patch indices

* chore: add missing base/notimplemented includes

* 6652910: [Frame Cleanup] Push down/hide implementation-specific API

https://chromium-review.googlesource.com/c/chromium/src/+/6652910

* chore: bump chromium in DEPS to 139.0.7256.0

* chore: fix lint

* fixup! 6652910: [Frame Cleanup] Push down/hide implementation-specific API

* fix: move HandleScope location

* chore: bump chromium in DEPS to 139.0.7258.0

* fixup! [NonClientFrameView] Consolidate NativeFrameViewMac

* Revert "chore: bump chromium in DEPS to 139.0.7258.0"

This reverts commit 264b2e934f.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-26 00:12:49 +09:00
Felix Rieseberg
e4c37e4b38 docs: Add C++/Linux tutorial (#46822) 2025-06-25 12:57:43 +02:00
Calvin
828fc84e60 build: update NMV to 139 (#47529) 2025-06-24 12:24:17 -04:00
Shelley Vohr
51fbc964a6 fix: ensure /dev/null fd is closed on failure (#47525)
* fix: ensure /dev/null fd is closed on failure

* chore: ignore closehandle for windows

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-06-24 17:44:50 +02:00
Shelley Vohr
3e8e87d186 feat: support customizing window accent color on Windows (#47285) 2025-06-24 14:43:02 +02:00
Samuel Attard
498f4bc98c build: rewrite push-patch to use the github API instead of local git commits to ensure commits are signed (#47401)
* build: rewrite push-patch to use the github API instead of local git commits to ensure commits are signed

* again

(cherry picked from commit a21afc3e45)

* use pr head ref

(cherry picked from commit 0edcc985fa)
2025-06-23 22:26:43 -07:00
Michaela Laurencin
a6ad5a6e60 docs: update timelines for E38 (#47488)
Update electron-timelines.md
2025-06-23 15:50:22 +02:00
Shelley Vohr
93d5152a25 fix: chrome://accessibility loading correctly (#47497)
fix: chrome://accessibility loading correctly
2025-06-23 14:38:29 +02:00
Shelley Vohr
fb65124234 chore: fix nightly issues getting unsupported label comment (#47503)
* chore: fix nightly issues getting unsupported label comment

* chore: address review feedback
2025-06-23 14:22:41 +02:00
dependabot[bot]
93f4b3cf9f build(deps): bump github/codeql-action from 3.28.19 to 3.29.0 (#47486)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.19 to 3.29.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fca7ace96b...ce28f5bb42)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-06-23 11:24:18 +02:00
Charles Kerr
bb22eaccec refactor: simplify titlebar overlay initialization (#47480) 2025-06-23 11:24:05 +02:00
David Sanders
90a14299fd ci: fix sending Slack message in CI audit workflow (#47494) 2025-06-23 11:23:39 +02:00
Shelley Vohr
60924690d9 build: combine dependent libc patch (#47491) 2025-06-23 11:22:35 +02:00
John Kleinschmidt
9b158238dc build: update cache action to latest (#47501) 2025-06-23 11:22:14 +02:00
Samuel Attard
dac5e0cd1a build: add siso backend.star (#47509) 2025-06-20 11:25:27 -07:00
Robo
626895848e fix: utilityProcess running user script after process.exit is called (#47469)
* fix: utilityProcess running user script after process.exit is called

* docs: update breaking changes

* chore: update spec

* chore: update spec/api-utility-process-spec.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: remove interface bound checks

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-06-18 04:36:22 +09:00
Keeley Hammond
3536d4976a fix: revert moving IsClosed() and IsClosable() into NativeWindow::Close() (#47482)
Revert "refactor: move `IsClosed()` and `IsClosable()` tests into `NativeWindow::Close()` (#46888)"

This reverts commit 3faddd5ae2.
2025-06-16 16:41:19 -07:00
Shelley Vohr
2ad762e075 feat: support HIDDevice.collections (#47391)
* feat: support HIDDevice.collections

* Update docs/api/structures/hid-device.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-06-16 15:56:08 -04:00
electron-roller[bot]
6779769d22 chore: bump chromium to 139.0.7219.0 (main) (#47348)
* chore: bump chromium in DEPS to 139.0.7205.0

* 6543986: Mac: decouple deserializing and applying sandbox policy

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6543986

* 6580079: Reland 'Remove the third-party blocking feature'
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6580079

* 6505716: guest-contents: Add components/guest_contents
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6505716

* 6572556: Move LogMessageManager out of gpu_service_impl.cc.
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6572556

* 6566111: Change UtilityProcessHost to manage its instance internally
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6566111

* 6550237: Rename ReconnectEventObserver to ConnectionChangeObserverClient
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6550237

* 6565918: Validate path is valid UTF8 in SelectFileDialogLinuxPortal
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6565918

* 6579713: Remove base::NotFatalUntil::M130 usage
6566111: Change UtilityProcessHost to manage its instance internally
Refs
https://chromium-review.googlesource.com/c/chromium/src/+/6579713
https://chromium-review.googlesource.com/c/chromium/src/+/6566111

* chore: update chromium patches

* chore: update remaining patches

* fixup! 6566111: Change UtilityProcessHost to manage its instance internally Refs https://chromium-review.googlesource.com/c/chromium/src/+/6566111

* 6577970: Remove superfluous includes for base/strings/stringprintf.h in headers
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6577970

* 6568811: Add FunctionCall structured metrics event for DevTools
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6568811

* [PDF Ink Signatures] Support PdfAnnotationsEnabled policy
https://chromium-review.googlesource.com/c/chromium/src/+/6558970

* build: disable libcxx modules for rbe

* chore: bump chromium in DEPS to 139.0.7217.0

* chore: bump chromium in DEPS to 139.0.7218.0

* chore: update patches

fix_use_delegated_generic_capturer_when_available.patch was updated to handle a small change:
6582142: Use content::Create*Capturer in DesktopCaptureDevice. | https://chromium-review.googlesource.com/c/chromium/src/+/6582142

* chore: bump chromium in DEPS to 139.0.7219.0

* chore: update patches

* 6594615: Change Chromium's deployment target to macOS 12
https://chromium-review.googlesource.com/c/chromium/src/+/6594615

Updated the assertion message to match the docs structure now too. I removed the callout to the supported versions doc because it has moved and doesn't contain minimum platform version information.

* 6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_
https://chromium-review.googlesource.com/c/chromium/src/+/6606232

|NativeWindow::GetContentMinimumSize| and |NativeWindow::GetContentMaximumSize| may be good opportunities for a refactor now.

* add squirrel.mac patch for removed function

This was triggered by the macOS 12.0 deployment upgrade change.

See: https://developer.apple.com/documentation/coreservices/1444079-uttypeconformsto?language=objc

* 6582142: Use content::Create*Capturer in DesktopCaptureDevice.
https://chromium-review.googlesource.com/c/chromium/src/+/6582142

* 6579732: Two minor API "quality of life" cleanups in OSCrypt Async
https://chromium-review.googlesource.com/c/chromium/src/+/6579732

* chore: add include for base::SingleThreadTaskRunner

Not sure what change caused this, I expect it would be a removed include somewhere else, but it's likely not important to track down.

* chore: update libcxx filenames

* chore: update CI build-tools commit target for macOS SDK 15.4

The following change uses an API that was added in the macOS 15.4 SDK. Support for that SDK version was added later than the current build-tools commit target.

6575804: Use a quick-and-dirty solution to avoid glitching with paste-and-go | https://chromium-review.googlesource.com/c/chromium/src/+/6575804

See: https://developer.apple.com/documentation/appkit/nspasteboard/accessbehavior-swift.enum?language=objc

* fixup! 6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_ https://chromium-review.googlesource.com/c/chromium/src/+/6606232

* chore: bump chromium in DEPS to 139.0.7220.0

* chore: update patches

Minor changes due to:

6613978: pwa: let events fall through in the transparent area of TopContainerView | https://chromium-review.googlesource.com/c/chromium/src/+/6613978
6614778: Refactor auto pip tab observer for Android support | https://chromium-review.googlesource.com/c/chromium/src/+/6614778

* 6543986: Mac: decouple deserializing and applying sandbox policy
https://chromium-review.googlesource.com/c/chromium/src/+/6543986

The DecodeVarInt and DecodeString functions look benign from a MAS perspective. I suspect they were patched out to avoid "unused function" errors. Their complements for encoding are unpatched, supporting this idea.

The code that uses these functions was refactored out of the section that we patch out. Instead of patching out that new function, I decided to treat it the same as the serialization function that is unpatched.

* chore: bump chromium in DEPS to 139.0.7222.0

* chore: bump chromium in DEPS to 139.0.7224.0

* chore: bump chromium in DEPS to 139.0.7226.0

* chore: bump chromium in DEPS to 139.0.7228.0

* chore: update patches

* Don't use static variable for UseExternalPopupMenus

https://chromium-review.googlesource.com/c/chromium/src/+/6534657

* Reland "Roll libc++ from a01c02c9d4ac to a9cc573e7c59

https://chromium-review.googlesource.com/c/chromium/src/+/6607589

* chore: bump chromium in DEPS to 139.0.7219.0

* chore: update patches

* revert Don't use static variable for UseExternalPopupMenus

* tls: remove deprecated tls.createSecurePair and SecurePair

https://github.com/nodejs/node/pull/57361

* Revert "Reland "Roll libc++ from a01c02c9d4ac to a9cc573e7c59"

This reverts commit 33e1436a0c.

* test: cleanup api-desktop-capturer-spec.ts

* test: more cleanup of api-desktop-capturer-spec.ts

* chore: debug dcheck error in webrtc on linux

* fixup patch

* add debugging to desktop capturer spec

* test: fixup api-desktop-capturer-spec.ts for linux

* chore: remove debugging patch

* Revert "fixup! 6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_ https://chromium-review.googlesource.com/c/chromium/src/+/6606232"

This reverts commit 32e75651c1.

* Revert "6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_"

This reverts commit 89c51aa1c7.

* [views] Remove DesktopWindowTreeHostWin::window_enlargement_

https://chromium-review.googlesource.com/c/chromium/src/+/6606232

Reverting as we need this functionality for now.

* fixup: remove patch that was accidentally added back

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-06-16 12:46:06 -05:00
Shelley Vohr
96fcc2f8c8 chore: exempt upgrade-follow-up issues from stale (#47460)
chore: exempt upgrade-follow-upissues from stale
2025-06-14 21:43:57 -07:00
Charles Kerr
3c9b8475a2 refactor: move gin::Converter<PreloadScript> impl to a .cc file (#47445)
refactor: move gin::Converter<PreloadScript> impl to a .cc file
2025-06-13 10:15:32 +02:00
Charles Kerr
6f915e85e2 refactor: have ShowSaveDialogSync() return a std::optional<base::FilePath> (#47428)
* refactor: have ShowSaveDialogSync() return a std::optional<base::FilePath>

* fixup! refactor: have ShowSaveDialogSync() return a std::optional<base::FilePath>
2025-06-12 12:25:40 +02:00
Anny Yang
0259abe920 docs: update remaining references to electron-quick-start (#47405)
* chore: udpate remaining references to electron-quick-start

* chore: Update docs/tutorial/tutorial-1-prerequisites.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: Update docs/tutorial/tutorial-3-preload.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: Update docs/tutorial/tutorial-2-first-app.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: linebreak

* chore: swap minimal-repro for npx create-electron-app

* chore: add back code commands

* chore: add whitespace

* chore: remove reference to repo containing old quick start

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-06-12 10:32:17 +02:00
Shelley Vohr
38fe14041d fix: crash calling Fetch.continueResponse with WebContentsView (#47434)
fix: crash calling Fetch.continueResponse with WebContentsView
2025-06-11 15:43:47 +02:00
dependabot[bot]
996945d3e3 build(deps): bump github/codeql-action from 3.28.18 to 3.28.19 (#47426)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.18 to 3.28.19.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](ff0a06e83c...fca7ace96b)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.28.19
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-06-11 11:24:03 +02:00
Niklas Wenzel
d7ef8b79ae docs: mention kwallet6 command line option (#47427) 2025-06-10 16:12:31 -04:00
Erick Zhao
6aa3665b96 docs: no class inheritance (#47403) 2025-06-10 10:00:06 +02:00
Robo
c964296ec3 feat: add support for --no-experimental-global-navigator (#47370)
chore: add support for --no-experimental-global-navigator
2025-06-09 14:57:27 +09:00
David Sanders
6f48e3ab12 ci: fix up branch CI audit workflow (#47404) 2025-06-07 09:58:48 +02:00
Shelley Vohr
06bc59be88 fix: rework lifetime mgmt of ClearDataTask/ClearDataOperation (#47361)
* fix: rework lifetime mgmt of ClearDataTask/ClearDataOperation

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-06-07 08:00:30 +02:00
David Sanders
0b84c68229 ci: ignore network-related error annotations in audit (#47333)
* ci: ignore network-related error annotation in audit

* chore: add another error message
2025-06-06 16:52:25 -04:00
Shelley Vohr
09a0926c5b fix: printing PDF via webContents.print() (#47377)
fix: printing PDF via webContents.print()
2025-06-06 14:20:37 -04:00
Shelley Vohr
6606230813 fix: silent printing of PDFs with webContents.print (#47378)
fix: silent printing
2025-06-06 14:19:08 -04:00
David Sanders
a42afaa866 chore: fix docs lint (#47389) 2025-06-06 10:01:26 +02:00
John Kleinschmidt
b1f0ab11c5 build: cache gitcache dir (#47328)
* revert build: migrate to new chromium git auth

* build: cache gitcache dir
2025-06-05 17:00:21 -04:00
David Sanders
4c3e2eb560 build(deps-dev): bump husky and lint-staged (#47291) 2025-06-05 20:23:55 +02:00
Niklas Wenzel
72340e79e8 docs: remove electron-quick-start from README (#47359)
Refs https://github.com/electron/.permissions/pull/293

The repo was renamed to `minimal-repro` and is no longer intended to be used as a way to start new projects (see PR above).

Since we really want bugs in `electron/electron` to be reported with a Fiddle gist instead of a standalone repo (makes reproducing and bisecting sooo much easier and safer!), I removed the repo from the README completely instead of mentioning as an issue reproduction starting point.
2025-06-05 20:12:21 +02:00
Niklas Wenzel
7196a28d3a docs: mention Azure Trusted Signing (#47323) 2025-06-05 19:13:39 +02:00
Shelley Vohr
6c96979b6c chore: remove unused spec-chromium (#47367)
chore: remove unused spec-chromium
2025-06-05 15:50:19 +02:00
Felix Rieseberg
5cbab906c9 docs: Add Swift/macOS tutorial (#46697)
Co-authored-by: Felix Rieseberg <fr@makenotion.com>
2025-06-05 15:45:04 +02:00
Erick Zhao
2a51a997eb docs: update link to runAsNode fuse (#47350) 2025-06-05 10:03:58 +02:00
Shelley Vohr
fbb3fa7503 feat: allow intercepting mouse events (#47280)
* feat: allow intercepting mouse events

* test: add specs

* Update spec/api-web-contents-spec.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-06-04 14:10:33 +02:00
Shelley Vohr
c22f94037a docs: document possible print failureReasons (#47337)
docs: document possible print failureReasons
2025-06-04 14:09:24 +02:00
John Kleinschmidt
ba7c3bbdf7 chore: update patches (#47346) 2025-06-03 13:52:17 -04:00
electron-roller[bot]
53fd879043 chore: bump chromium to 138.0.7190.0 (main) (#47107)
* chore: bump chromium in DEPS to 138.0.7180.0

* 6546797: Add a metric for the overall success of the "safe storage" item retrieval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6546797

* 6548078: extensions: Fix TODO in ScriptInjectionTracker for desktop Android

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6548078

* 6544950: Revert "FSA: Only normalize the hardcoded rules once during initialization"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6544950

* chore: bump chromium in DEPS to 138.0.7181.0

* chore: update patches

* fix: correctly clamp HSL shift values between 0 and 1

* chore: bump DEPS to 138.0.7183.0

* 6553142: Remove SelectFileDialogLinuxKde | https://chromium-review.googlesource.com/c/chromium/src/+/6553142

* chore: update patches

* chore: bump chromium in DEPS to 138.0.7184.0

* chore: bump chromium in DEPS to 138.0.7186.0

* chore: bump chromium in DEPS to 138.0.7190.0

* chore: update patches

* 6547778: Remove some superfluous //ui/gfx includes from //chrome headers | https://chromium-review.googlesource.com/c/chromium/src/+/6547778

* 6556022: Reland FSA: Only normalize the hardcoded rules once during initialization | https://chromium-review.googlesource.com/c/chromium/src/+/6556022

* fix: remove pdf_extension_util::AddAdditionalData
https://chromium-review.googlesource.com/c/chromium/src/+/4099130

This was removed 2 years ago in Chrome.

* fix: provide BrowserContext to pdf_extension_util::AddAdditionalData
https://chromium-review.googlesource.com/c/chromium/src/+/6558173

* fixup! 6556022: Reland FSA: Only normalize the hardcoded rules once during initialization | https://chromium-review.googlesource.com/c/chromium/src/+/6556022

* fix: pass in navigation throttle registry
https://chromium-review.googlesource.com/c/chromium/src/+/6536175

* fixup! 6556022: Reland "FSA: Only normalize the hardcoded rules once during initialization" | https://chromium-review.googlesource.com/c/chromium/src/+/6556022

This partially reverts commit 20d709dd15ba0ff332e24ee314149d642dc5d47c.

* 6545984: corner-shape: render dashed & dotted borders
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6545984

* Update corner smoothing expected images

* Apply "future" revert commit to fix windows build

> Reason for revert: Multiple eng reporting that this is causing build failures due to too-long pathnames, with no immediate feasible workaround

This issue also affects our CI builds.

Problematic CL in current roll: 6494836: [webgl] Add stub WebGL[2]RenderingContextWebGPU | https://chromium-review.googlesource.com/c/chromium/src/+/6494836
"Future" revert CL: 6565622: Revert "[webgl] Add stub WebGL[2]RenderingContextWebGPU" | https://chromium-review.googlesource.com/c/chromium/src/+/6565622

This patch should automatically disappear when we roll the revert.

* 6533919: win: don't add WS_CAPTION style to popup windows
https://chromium-review.googlesource.com/c/chromium/src/+/6533919

This mirrors the change made earlier to the code ours is based on: 6374074: [headless] Provide headless aware window metrics on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/6374074

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-06-03 11:19:20 -04:00
Shelley Vohr
5f5e8d012d fix: add back fallback wasm-trap handling (#47186)
* fix: add back fallback wasm-trap handling

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5372409

This change sets up wasm-trap handling for the case where content_shell
has not enabled crash reporting but moves the responsibility to
ElectronRendererClient. The default ContentRendererClient assumes
that crash reporting is enabled (crashpad enabled by default) and does
not set up its own handler.

* chore: fix build

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-03 15:31:23 +02:00
Calvin
508c601996 fix: do not load source for electron module in ESM loader synchronous flow (#46810) 2025-06-03 12:50:17 +02:00
Sta Zhu
158176f0f3 fix: addChildView() crashes when adding a closed WebContentsView (#47099)
fix: addChildView() crashes when add a closed WebContentsView
2025-06-03 10:53:25 +02:00
dependabot[bot]
d1e64c37a2 build(deps): bump ossf/scorecard-action from 2.4.1 to 2.4.2 (#47329)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.1 to 2.4.2.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](f49aabe0b5...05b42c6244)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-06-03 10:18:03 +02:00
Shelley Vohr
17ba863f69 docs: correct 'select-bluetooth-device' requirement (#47325) 2025-06-03 10:16:16 +02:00
electron-roller[bot]
82a59d9894 chore: bump node to v22.16.0 (main) (#47217)
* chore: bump node in DEPS to v22.16.0

* crypto: remove BoringSSL dh-primes addition

https://github.com/nodejs/node/pull/57023

* tools: enable linter in test/fixtures/test\-runner/output

https://github.com/nodejs/node/pull/57698

* src: improve thread safety of TaskQueue

https://github.com/nodejs/node/pull/57910

* buffer: define global v8::CFunction objects as const

https://github.com/nodejs/node/pull/57676

* src: disable abseil deadlock detection

https://github.com/nodejs/node/pull/57582

* zlib: fix pointer alignment

https://github.com/nodejs/node/pull/57727

* chore: fixup patch indices

* src: set default config as node.config.json

https://github.com/nodejs/node/pull/57171

* src: update std::vector<v8::Local<T>> to use v8::LocalVector<T>

https://github.com/nodejs/node/pull/57578

* test: disable chmod tests failing in Docker

https://github.com/nodejs/node/issues/58326

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-06-02 17:30:15 -04:00
David Sanders
55006fe9a8 ci: change patches stats DataDog metric type to gauge (#47319) 2025-06-02 14:49:44 -04:00
zeeker999
dc5efca0f6 feat: [net] add "priority" option to net.request (#42628)
document the default value of priority option

Update the priority test to not use the httpbin.org as server

Fixed the lint errors

Fixed the build error
2025-05-30 15:28:13 -04:00
David Sanders
cf6c662702 ci: upload stats about patches to DataDog (#47206) 2025-05-30 11:14:57 -04:00
Shelley Vohr
c84e8c6c22 feat: expose win.isContentProtected() (#47242)
* feat: expose win.isContentProtected()

* chore: remove stray _isContentProtected
2025-05-30 11:00:13 +02:00
John Kleinschmidt
46921d3652 docs: document commit signing requirement (#47290) 2025-05-30 10:59:29 +02:00
David Sanders
b303413a04 build: drop shx dependency (#47293) 2025-05-30 10:59:11 +02:00
David Sanders
83524adf17 chore: fix lint for ImageView doc (#47304) 2025-05-29 17:10:41 -04:00
David Sanders
14b3183eb5 ci: add a problem matcher for ESLint output (#47303) 2025-05-29 16:58:17 -04:00
David Sanders
0d70389ccb chore: lint code blocks in docs with ESLint (#42113) 2025-05-29 12:45:26 -07:00
Niklas Wenzel
4e61f5b26f fix: Squirrel.Mac crash when zip extraction fails (#47271)
* fix: Squirrel.Mac crash when zip extraction process fails to launch

* chore: add end-to-end test
2025-05-29 10:31:46 -07:00
Will Anderson
5b5f900e34 docs: add documentation for ImageView (#46760)
* docs: Add documentation for ImageView

* docs: Add ImageView main process module list in README.md

* test: Add some basic tests for ImageView

* test: Fill out Window embedding tests to better reflect how someone might use an ImageView

* docs: Add notes about using ImageView as a splash screen

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: Update ImageView example to show a more complete splash screen example

* docs: Remove view resizing logic since the ImageView automatically gets resized

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-05-29 10:24:16 -07:00
David Sanders
2e0b4eca94 build: remove unnecessary eslint-plugin-standard package (#47283) 2025-05-28 13:58:14 +02:00
David Sanders
3a32f25750 ci: audit important branches for CI errors (#47207)
* ci: audit important branches for CI errors

* chore: move message to Slack workflow
2025-05-27 11:35:33 -04:00
Erick Zhao
f6b8ee0731 chore: add .eslintrc.json for docs/fiddles (#47269) 2025-05-27 09:13:10 -05:00
Robo
5ccbfa2faf fix: regression with directory selection in macOS dialogs (#47259) 2025-05-27 19:08:11 +09:00
Shelley Vohr
f89c2a0ef4 fix: titlebar showing in content protected window (#47241)
Closes https://github.com/electron/electron/issues/47152.
2025-05-26 09:46:04 +02:00
Shelley Vohr
c6f368acc6 chore: debug crash on DevTools SetOwnerWindow (#47243) 2025-05-26 09:45:43 +02:00
David Sanders
5e3b5ef04c chore: update @electron/lint-roller to 3.1.1 (#47202)
* chore: update @electron/lint-roller to 3.1.1

* docs: fix broken link in breaking-changes.md

* chore: fix for Node.js versions without require(esm)
2025-05-25 07:58:55 -05:00
John Kleinschmidt
ac5e3c76f3 build: migrate to new chromium git auth (#47230) 2025-05-25 07:57:20 -05:00
Gellert Hegyi
b9b96a96f7 feat: add menu item role palette and header (#45538)
* feat: add menu item role `palette` and `header`

* adds comments

* refactors new role items to new item types

* docs: custom type

* docs: note types only available on mac 14+

---------

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-05-23 12:43:49 -04:00
Charles Kerr
2248de847d refactor: use base::fixed_flat_set in NativeWindowViews::SetAlwaysOnTop() (#47201)
refactor: use base::fixed_flat_set in NativeWindowViews::SetAlwaysOnTop()
2025-05-22 18:20:39 -05:00
Charles Kerr
38e7ff944e refactor: make NativeWindow::has_frame_ const (#47200)
* refactor: make NativeWindow::is_modal_ const

* refactor: make NativeWindow::title_bar_style_ const and private

* refactor: make NativeWindow::has_client_frame() protected

refactor: make NativeWindow::transparent() protected

* refactor: make NativeWindow::enable_larger_than_screen() protected

* refactor: make NativeWindow::has_frame_ const

* fixup! refactor: make NativeWindow::has_client_frame() protected

fix: GetExpandedWindowSize()
2025-05-22 17:32:46 -05:00
David Sanders
8f09d7037b ci: add problem matcher for patch conflict output (#47183) 2025-05-22 09:27:23 -04:00
David Sanders
d0102ff392 ci: add problem matcher for clang output (#46577) 2025-05-22 09:25:57 -04:00
Keeley Hammond
274e1df1ca build: revert bump @octokit/rest from 20.1.1 to 21.1.1 (#47208)
Revert "build(deps-dev): bump @octokit/rest from 20.1.1 to 21.1.1 (#47159)"

This reverts commit 517f5c15b9.
2025-05-21 18:39:24 -07:00
John Kleinschmidt
b2d0074cc6 build: fix depot tool pathing on Windows (#47194)
build: properly set depot_tools pathing for Windows
2025-05-21 16:05:50 -07:00
Charles Kerr
2e8fc17f07 refactor: pass views::Widget* into constructors of our TreeHosts and NativeWidgets (#47177)
* refactor: remove unnecessary downcast in MenuViews::PopupAt()

* refactor: pass a views::Widget as an arg to the ElectronDesktopWindowTreeHostLinux ctor

* refactor: pass a views::Widget as an arg to the ElectronDesktopNativeWidgetAura ctor

* refactor: pass a views::Widget as an arg to the ElectronDesktopWindowTreeHostWin ctor

* refactor: create desktop_window_tree_host_ in the ElectronDesktopNativeWidgetAura constructor

* fixup! refactor: create desktop_window_tree_host_ in the ElectronDesktopNativeWidgetAura constructor

fix: tyop
2025-05-21 16:02:55 -05:00
Charles Kerr
4af0c5d762 refactor: make NativeWindow::transparent_ const (#47172)
* refactor: use in-class member initialization for NativeWindow::widget_

* refactor: make NativeWindow::transparent_ const

refactor: make NativeWindow::enable_larger_than_screen_ const

* chore: make linter happy after rebase
2025-05-21 19:42:08 +02:00
Charles Kerr
a7a3e10300 refactor: prefer base::circular_deque over std::deque (#47171)
* refactor: use base::circular_deque in ResolveProxyHelper

* refactor: use base::circular_deque in GetExtraCrashKeys()

refactor: reduce visibility of kMaxCrashKeyValueSize

This change is to match Chromium's usage advice from
base/containers/README.md: `base:circular_deque` is preferred over
`std::deque` to provide consistent performance across platforms.
2025-05-21 12:04:36 -05:00
Shelley Vohr
7b77a24211 fix: remove extra 'suspend'/'resume' handling from powerMonitor (#47162)
fix: remove extra 'suspend'/'resume' handling from powerMonitor
2025-05-21 10:00:38 -05:00
David Sanders
7112c592c9 test: strip color output in ESM spec (#47185) 2025-05-21 10:50:06 +02:00
Charles Kerr
d6638f9564 refactor: make NativeWindow::pending_transitions_ a base::queue (#47157)
refactor: make NativeWindow::pending_transitions a base::queue

Follow the base/containers/README.md advice that "Chromium code should
always use `base::circular_deque` or `base::queue` in preference to
`std::deque` or `std::queue` due to memory usage and platform variation."
2025-05-20 17:35:51 -05:00
Charles Kerr
9f8bcc4d98 refactor: make NativeWindow::has_client_frame_ const (#47156) 2025-05-20 17:14:28 -05:00
Charles Kerr
21155679a0 refactor: add NativeWindowViews::GetClientFrameViewLinux() (#47130)
* refactor: add NativeWindowViews::GetClientFrameViewLinux()

* chore: clarify code comment
2025-05-20 14:15:06 -05:00
Charles Kerr
211faed848 refactor: add NativeWindow::IsActive() (#47148)
this was already present on macOS; use in NativeWindowViews too
2025-05-20 11:08:44 -04:00
Shelley Vohr
296e39456a refactor: match upstream macOS a11y handling (#47144) 2025-05-20 11:06:57 -04:00
John Kleinschmidt
a19198d784 build: update_depot_tools on initial install (#47160)
this ensures that python is setup for proper use from depot_tools
2025-05-20 10:40:48 -04:00
reito
263c76df09 fix: prevent gc monitor 2nd pass crash (#46987) 2025-05-20 22:54:03 +09:00
dependabot[bot]
517f5c15b9 build(deps-dev): bump @octokit/rest from 20.1.1 to 21.1.1 (#47159)
Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.1 to 21.1.1.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.1...v21.1.1)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 21.1.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-20 09:57:30 +02:00
dependabot[bot]
d29293556d build(deps): bump github/codeql-action from 3.28.15 to 3.28.18 (#47158)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.15 to 3.28.18.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](45775bd823...ff0a06e83c)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.28.18
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-20 09:56:54 +02:00
Shelley Vohr
e0ea069859 build: remove fix_linter_error.patch (#47150)
build: remove fix_linter_error.patch
2025-05-19 22:52:01 +02:00
electron-roller[bot]
7cc76c094a chore: bump node to v22.15.1 (main) (#47105)
* chore: bump node in DEPS to v22.15.1

* chore: fixup patch indices

* src: fix error handling on async crypto operations

https://github.com/nodejs-private/node-private/pull/709

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-19 16:12:48 -04:00
Charles Kerr
3660432f42 refactor: NativeWindows should prefer widget() over GetWidget() for internal use (#47133) 2025-05-19 21:43:16 +02:00
Charles Kerr
687e50b4f3 refactor: add NativeWindowViews::SetTitleBarOverlay() (#47126)
* refactor: move SetTitleBarOverlay() impl to NativeWindowViews

* refactor: make NativeWindowViews::set_overlay_button_color() private

refactor: make NativeWindowViews::set_overlay_symbol_color() private

refactor: make NativeWindow::set_titlebar_overlay_height() protected

* refactor: simplify downcasting in NativeWindowViews::SetTitleBarOverlay()
2025-05-19 08:19:03 -05:00
David Sanders
d426667a01 build(dev-deps): update @electron/lint-roller and markdownlint-cli2 (#47082) 2025-05-19 14:19:04 +02:00
Charles Kerr
208bbc0504 refactor: add NativeWindow::SetShape() (#47131)
use NativeWindow::SetShape() in api::BaseWindow
2025-05-19 10:29:29 +02:00
dependabot[bot]
e2f496cfbc build(deps-dev): bump @typescript-eslint/eslint-plugin from 8.7.0 to 8.32.1 (#47135)
build(deps-dev): bump @typescript-eslint/eslint-plugin

Bumps [@typescript-eslint/eslint-plugin](https://github.com/typescript-eslint/typescript-eslint/tree/HEAD/packages/eslint-plugin) from 8.7.0 to 8.32.1.
- [Release notes](https://github.com/typescript-eslint/typescript-eslint/releases)
- [Changelog](https://github.com/typescript-eslint/typescript-eslint/blob/main/packages/eslint-plugin/CHANGELOG.md)
- [Commits](https://github.com/typescript-eslint/typescript-eslint/commits/v8.32.1/packages/eslint-plugin)

---
updated-dependencies:
- dependency-name: "@typescript-eslint/eslint-plugin"
  dependency-version: 8.32.1
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-19 10:27:22 +02:00
Charles Kerr
1da150f9a3 chore: remove gclient sync macOS CI hack patch (#47123)
chore: remove hack_to_allow_gclient_sync_with_host_os_mac_on_linux_in_ci.patch
2025-05-19 10:26:58 +02:00
Calvin
5dd6481e53 fix: explicit microtask scope DCHECK condition (#47134) 2025-05-19 12:08:59 +09:00
dependabot[bot]
d72e622a3f build(deps): bump slackapi/slack-github-action from 2.0.0 to 2.1.0 (#47060)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 2.0.0 to 2.1.0.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](485a9d42d3...b0fa283ad8)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-version: 2.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-16 12:55:00 -05:00
Charles Kerr
8efd24c339 perf: don't create unused menuitem icons (#47100)
GTK >= 3.90.0 removed support for menuitem icons. When Electron is
built with GTK >= 3.90.0, our code builds these icons and then throws
them away unused. Instead, let's just not build them.

Our gtk_util::GdkPixbufFromSkBitmap utility uses BGRAToRGBA and is
expensive to call.
2025-05-16 02:43:03 -05:00
Erick Zhao
dc34e8732c docs: add note on DIP and DPI (#47080) 2025-05-15 16:51:49 -05:00
Charles Kerr
77c58658c5 refactor: decouple NativeWindowViews and GlobalMenuBarX11 (#47094)
The GlobalMenuBar used to hold a raw_ptr reference to its NativeWindow;
but since it doesn't use it & only wants the gfx::AcceleratedWidget info,
let's remove the NativeWindowViews reference.

AFAICT, GlobalMenuBarX11::window_ has never been used
2025-05-15 16:10:56 -05:00
Charles Kerr
d720aea700 refactor: make TrackableObject::weak_map_id() constexpr (#47092)
* refactor: make TrackableObject::weak_map_id() constexpr

refactor: make BaseWindow::GetID() inline and constexpr

* refactor: make NativeWindow::window_id() constexpr too
2025-05-15 16:10:33 -05:00
Charles Kerr
e2bcd8f0aa test: fix desktopCapturer mocha syntax (#47088)
* test: fix desktopCapturer mocha syntax

do not nest `it` calls in desktopCapturer specs

* empty commit
2025-05-15 16:54:49 -04:00
Robo
99a3e360ec fix: opening package paths as directory on macOS (#47077) 2025-05-15 12:47:46 -05:00
electron-roller[bot]
883f48b9b4 chore: bump chromium to 138.0.7178.0 (main) (#47086)
* chore: bump chromium in DEPS to 138.0.7178.0

* 6351556: [source-phase-imports] Support Wasm Source Phase Imports

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6351556

* chore: update patches

* 6509682: extensions: Use ChromeExtensionsBrowserClient on desktop Android, part 2

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6509682

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-05-15 12:47:07 -05:00
Charles Kerr
9a7b73b533 refactor: use kKeyModifiers in IsAltModifier() (#47066)
We probably didn't use this before because IsAltModifier() was written
two years before the KeyModifiers mask was added upstream in 98ec378a.
2025-05-14 11:00:00 -04:00
Charles Kerr
6170a5af40 chore: combine all the "patch out Profiles" changes into a single patch (#47063)
* chore: fold the profile patches into one patch

* chore: e patches all

* chore: patch out ProfileSelections::ApplyProfileSelection()

Another profile reference. Referenced iff making a debug build.
2025-05-14 09:21:11 -05:00
electron-roller[bot]
d65a856bf3 chore: bump chromium to 138.0.7177.0 (main) (#47081)
* chore: bump chromium in DEPS to 138.0.7177.0

* 6530423: [WebContents] Fix IsNeverComposited() calls during initialization

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6530423

* 6512551: [ios] Enable -Wobjc-property-assign-on-object-type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6512551

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-05-14 10:08:31 -04:00
Shelley Vohr
f2639d13cc refactor: remove CreateViewForWidget patch (#46981)
* refactor: remove CreateViewForWidget patch

* chore: rm unintended osr change

* Trigger CI

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-05-14 21:43:23 +09:00
Charles Kerr
11fa915724 refactor: remove introduce_ozoneplatform_electron_can_call_x11_property.patch (#47075)
* refactor: use x11_util::IsX11() in BuildSubmenuFromModel()

* refactor: use x11_util::IsX11() in ElectronDesktopWindowTreeHostLinux::OnBoundsChanged()

* refactor: use skia_can_fall_back_to_x11 in x11_util::IsX11()

it is identical in practice to electron_can_call_x11 and does not require a Chromium patch

* chore: remove introduce_ozoneplatform_electron_can_call_x11_property.patch

* refactor: use ui::GetOzonePlatformId() to test for x11
2025-05-14 13:38:35 +09:00
David Sanders
9aacc473e6 build: remove patch that landed upstream (#47079) 2025-05-13 20:10:48 -05:00
Charles Kerr
c218128675 chore: remove disable_unload_metrics.patch (#47059) 2025-05-13 14:55:59 -04:00
electron-roller[bot]
e3e647d21e chore: bump chromium to 138.0.7175.0 (main) (#46986)
* chore: bump chromium in DEPS to 138.0.7166.0

* chore: bump chromium in DEPS to 138.0.7166.2

* 6508373: Add WebContents, Tab getters for future Clank navigation capture rework

https://chromium-review.googlesource.com/c/chromium/src/+/6508373

* 6470924: Introduce auto-populated Search Engine icons.

https://chromium-review.googlesource.com/c/chromium/src/+/6470924

* 6502977: Force same tab navigation while actor coordinator is acting on a tab

https://chromium-review.googlesource.com/c/chromium/src/+/6502977

* chore: bump chromium in DEPS to 138.0.7168.0

* chore: update patches

* fix grit patch

* chore: bump Chromium to 138.0.7169.2

* fixup! 6508373: Add WebContents, Tab getters for future Clank navigation capture rework

* 6493688: NavigationThrottleRunner2: void CreateThrottlesForNavigation

https://chromium-review.googlesource.com/c/chromium/src/+/6493688

* 6488755: Reland "WebSQL: Remove WebPreference"

https://chromium-review.googlesource.com/c/chromium/src/+/6488755

* 6428707: FSA: Only normalize the hardcoded rules once during initialization

https://chromium-review.googlesource.com/c/chromium/src/+/6428707

* chore: fixup patch indices

* chore: bump chromium in DEPS to 138.0.7170.0

* 6514121: Remove origin calculation debug info and related methods

 https://chromium-review.googlesource.com/c/chromium/src/+/6514121

* chore: bump chromium in DEPS to 138.0.7172.0

* chore: bump chromium in DEPS to 138.0.7173.0

* chore: bump chromium in DEPS to 138.0.7175.0

* fixup! 6514121: Remove origin calculation debug info and related methods

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6514121

* 6531585: Don't retry LayerTreeSink creation on the high priority queue

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6531585

* 6512253: Modernize base::apple's base bundle ID

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6512253

* fixup! 6428707: FSA: Only normalize the hardcoded rules once during initialization

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6428707

* fixup! 6508373: Add WebContents, Tab getters for future Clank navigation capture rework

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6508373

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-05-13 14:51:20 -04:00
Shelley Vohr
7ab032f594 fix: white window flicker on window creation (#47022) 2025-05-10 18:24:35 -05:00
Erick Zhao
2493e530d0 docs: unify [!NOTE] structure (#46893)
* docs: unify [!NOTE] structure

* Update docs/api/command-line.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update docs/api/browser-window.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update docs/api/download-item.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update docs/api/global-shortcut.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* revert line break

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-05-09 14:36:42 -07:00
Michaela Laurencin
10e4f9ad37 feat: enable secondary label for macOS menu (#46887)
* feat: enable secondary label for macOS menu

* Update shell/browser/ui/cocoa/electron_menu_controller.mm

Co-authored-by: Robo <hop2deep@gmail.com>

* fix for lint

* update docs for sublabel

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-05-09 12:05:26 -04:00
Michaela Laurencin
b9f0aebb2f feat: enable innerWidth and innerHeight for window open (#46749)
* feat: enable innerWidth and innerHeight for window open

* update comment for added special innerWidth and innerHeight

* update 100 min spec requirement handling

* update testing to include getContentSize

* update macOS min requirement handling

* adjust refactored consts

* update const values from nativewindowviews
2025-05-09 12:03:45 -04:00
Shelley Vohr
8ecd731e96 fix: webview crash on focus (#46979) 2025-05-09 17:56:22 +02:00
Shelley Vohr
75cf8ea96d fix: restore previous Windows screenshotting (#47020)
Fixes https://github.com/electron/electron/issues/45990

We previously made a change in https://github.com/electron/electron/pull/45868
to fix content protection being lost on hide and re-show. However, this
cause a breaking change where protected windows were made opaque black
instead of being hidden as before. This overrides relevant methods in
ElectronDesktopWindowTreeHostWin to restore the previous behavior.
without regressing the original issue.
2025-05-09 09:38:27 -05:00
Aman Karmani
376634c75a feat: add support for --experimental-network-inspection (#46690)
* feat: add support for `--experimental-network-inspection`

* docs: fix minor formatting issues

visible on both GH[1] and the docs site[2]

[1] https://github.com/electron/electron/blob/main/docs/api/command-line-switches.md#nodejs-flags
[2] https://www.electronjs.org/docs/latest/api/command-line-switches#--inspect-brkhostport

* docs: add entry for new nodejs flag
2025-05-09 09:44:14 -04:00
Robo
8e8d3a4f3e fix: use-after-move of bus connection in xdg portal detection (#47008) 2025-05-09 18:32:08 +09:00
Charles Kerr
2cbd968da5 refactor: use gin_helper::Dictionary::ValueOrDefault() (#46982)
* refactor: use ValueOrDefault() in electron_api_web_contents.cc

* refactor: use ValueOrDefault() in electron_api_url_loader.cc

* refactor: use ValueOrDefault() in electron_download_manager_delegate.cc

* refactor: use ValueOrDefault() in electron_touch_bar.mm

* refactor: use ValueOrDefault() in electron_url_loader_factory.cc

* refactor: use ValueOrDefault() in electron_browser_context.cc

* refactor: use ValueOrDefault() in electron_touch_bar.mm

* refactor: use ValueOrDefault() in blink_converter.cc

* feat: add ValueOrDefault() to PersistentDictionary

* empty commit

* refactor: use ValueOrDefault() in blink_converter.cc

* refactor: inline the rectangle base::Value::Dict

* refactor: remove has_scroll temporary

---------

Co-authored-by: Deepak Mohan <hop2deep@gmail.com>
2025-05-08 14:17:22 -05:00
Keeley Hammond
aea7b4ae8c build: update hasher return value (#47009) 2025-05-08 11:34:21 -07:00
Charles Kerr
9f8a629126 refactor: reduce use of NativeWidgetPrivate (#46942)
* refactor: do not use native_widget_private() in NativeWindowViews::SetContentProtection()

refactor: do not use native_widget_private() in NativeWindowViews::IsContentProtected()

* refactor: do not use native_widget_private() in NativeWindowViews::Show()

* chore: remove native_widget_private #include from native_window_views_win

Not needed since Feb 2025: 9199d5c6
2025-05-08 09:02:19 -05:00
Charles Kerr
d4ca829069 test: enable hasShadow tests on Linux (#46984)
refactor: enable hasShadow tests on Linux
2025-05-08 10:07:10 +02:00
Charles Kerr
54a6bbb4cb build: remove skip_atk_toolchain_check.patch (#46988)
chore: remove skip_atk_toolchain_check.patch
2025-05-08 10:06:55 +02:00
Charles Kerr
24f1f7ed57 build: remove deps_add_v8_object_setinternalfieldfornodecore.patch (#46992)
chore: remove deps_add_v8_object_setinternalfieldfornodecore.patch

This was a Node 20-specific workaround that's no longer needed in Node 22.

Xref: https://github.com/nodejs/node/pull/49874.
2025-05-08 09:39:58 +02:00
Keeley Hammond
153dae5b48 build: move release script to new hasher function (#46989)
build: move to new hasher function
2025-05-08 01:15:08 -05:00
Calvin
580fa57a29 refactor: Node.js temporary "explicit" microtask policy scope pattern (#46973)
refactor: Node.js explicit microtask scope pattern
2025-05-08 10:21:39 +09:00
Calvin
37639b5400 refactor: replace gin_helper::MicrotasksScope with v8::MicrotasksScope (#46963)
* Remove microtasks_scope.h and microtasks_scope.cc

* Use v8::MicrotasksScope when ignoring browser checkpoint

These call always skip the browser checkpoint, so they are equivalent to using v8::MicrotasksScope directly (modulo the optional wrapper behavior).

* Remove MicrotasksScope from node_bindings.cc

This code seems contradictory: it explicitly specifies "do not run microtasks" yet runs a microtask checkpoint in the browser process.

Looking at its history, it [was introduced][1] with the intention to not run microtasks, but a [subtle C++ language behavior][2] caused it to do the opposite later in the same roll. Since the original intention was to not run microtasks, and since that is also the simplest explanation, we can assume `ignore_browser_checkpoint` should be true and migrate this to `v8::MicrotasksScope` as it is equivalent (modulo the optional wrapper behavior).

[1]: a4ea80dd47 (diff-efe58cf03c97028f37f801db044d396a5f428686da6595d2c692f1c052bbd09c)
[2]: https://github.com/electron/electron/pull/43185

* Migrate gin_helper/promise.h and gin_helper/promise.cc to v8::MicrotasksScope

Restores the [original][1] behavior of running the microtask checkpoint at destruction, but preserves the behavior of running microtasks in the browser process. This had last changed in the migration to gin_helper::MicroTasks.

[1]: https://github.com/electron/electron/pull/16401
2025-05-07 14:10:34 -05:00
electron-roller[bot]
a8695d4387 chore: bump chromium to 138.0.7166.0 (main) (#46975)
* chore: bump chromium in DEPS to 138.0.7165.0

* 6492127: Add new less invasive context menu mode for mobile interesttarget

https://chromium-review.googlesource.com/c/chromium/src/+/6492127

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-07 13:04:15 -04:00
Charles Kerr
924a8da940 refactor: use WidgetDelegate::SetAccessibleTitle() (#46765)
* refactor: use WidgetDelegate::SetAccessibleTitle()

* test: add window.accessibleTitle tests
2025-05-07 10:44:53 -05:00
Shelley Vohr
c16ea8d54e fix: printing when no mediaSize specified (#46937)
fix: printing when no mediaSize specified
2025-05-06 19:12:25 -05:00
Charles Kerr
b7ae162716 refactor: add gin_helper::Dictionary::ValueOrDefault() (#46939)
* feat: add gin_helper::Dictionary::ValueOrDefault()

A convenience function for using a default value if the
specified key isn't present in the dictionary.

* refactor: use ValueOrDefault() in native_window.cc

* refactor: use ValueOrDefault() in native_window_mac.mm

* refactor: use ValueOrDefault() in native_window_views.cc

* refactor: use ValueOrDefault() in electron_api_native_image.cc
2025-05-06 15:20:12 -05:00
Shelley Vohr
e876cecbc7 test: test menu rendering accelerators (#44634)
* test: test menu rendering accelerators

* Update spec/api-menu-spec.ts

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-05-06 14:09:35 -04:00
electron-roller[bot]
c4ac192aa4 chore: bump chromium to 138.0.7164.0 (main) (#46948)
* chore: bump chromium in DEPS to 138.0.7164.0

* 6508870: Add missing PermissionType mapping and remove default case.

https://chromium-review.googlesource.com/c/chromium/src/+/6508870

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-06 14:01:37 -04:00
Charles Kerr
8308ac29c8 refactor: pass gfx::ResizeEdge by value (#46935)
refactor: pass gfx::ResizeEdge by value

It is an enum class, so no reason to pass by reference
2025-05-06 11:57:53 -05:00
1698 changed files with 92051 additions and 42196 deletions

1
.claude/.gitignore vendored Normal file
View File

@@ -0,0 +1 @@
settings.local.json

25
.claude/settings.json Normal file
View File

@@ -0,0 +1,25 @@
{
"permissions": {
"allow": [
"Bash(e sync)",
"Bash(e patches --list-targets:*)",
"Bash(git add:*)",
"Bash(git am:*)",
"Bash(git commit:*)",
"Bash(git log:*)",
"Bash(git show:*)",
"Bash(e patches:*)",
"Bash(e sync:*)",
"Skill(electron-chromium-upgrade)",
"Skill(electron-node-upgrade)",
"Read(*)",
"Bash(echo:*)",
"Bash(e build:*)",
"Bash(tee:*)",
"Bash(git diff:*)",
"Bash(git rev-parse:*)"
],
"deny": [],
"ask": []
}
}

View File

@@ -0,0 +1,106 @@
---
name: chrome-release-cls
description: Given a Chrome Releases blog post URL (chromereleases.googleblog.com), extract every CVE/bug and find the underlying Gerrit CL that fixed it by searching the local Chromium checkout and sub-repos. Use when asked to map Chrome security release notes to fixing CLs, or to find which commits correspond to CVEs in a Chrome stable update.
---
# Chrome Release → Fixing CL Mapper
Maps every security fix in a Chrome Releases blog post to the Gerrit CL(s) that fixed it.
## Input
`$ARGUMENTS` — a `https://chromereleases.googleblog.com/...` URL. If empty, ask the user for one.
## Procedure
### 1. Extract CVE → bug ID pairs from the blog post
The blog HTML buries bug IDs inside `<a>` tags, so strip tags first. Run:
```bash
curl -sL "$URL" | python3 -c '
import sys, re, html
t = re.sub(r"<[^>]+>", " ", sys.stdin.read())
t = re.sub(r"\s+", " ", html.unescape(t))
seen = set()
for m in re.finditer(r"\[\s*(\d{6,})\s*\]\s*(Critical|High|Medium|Low)\s*(CVE-\d{4}-\d+):\s*([^.]+?)\.", t):
if m.group(3) in seen: continue
seen.add(m.group(3))
print(f"{m.group(3)}|{m.group(1)}|{m.group(2)}|{m.group(4).strip()}")
' > /tmp/cve_bugs.txt
cat /tmp/cve_bugs.txt
```
If this yields nothing, the page may have changed format — fall back to `grep -oE 'CVE-[0-9]{4}-[0-9]+'` and `grep -oE 'crbug\.com/[0-9]+'` and pair them by order.
### 2. Find the fixing CL for each bug
Search git history in the Chromium checkout and relevant sub-repos for commits whose `Bug:` or `Fixed:` footer references the bug ID, then extract the `Reviewed-on:` Gerrit URL.
Repo selection by component keyword:
- ANGLE → `third_party/angle`
- Skia, Graphite → `third_party/skia`
- PDFium → `third_party/pdfium`
- Dawn → `third_party/dawn`
- V8, Turbofan, Maglev, Turboshaft → `v8`
- everything else → `.` (chromium/src)
Always also fall back to `.` if the hinted repo has no match.
```bash
cd /root/src/electron/src # chromium root (parent of electron/)
lookup() {
local bug="$1" repos="$2"
for repo in $repos . v8 third_party/skia third_party/angle third_party/pdfium third_party/dawn; do
local hits
hits=$(git -C "$repo" log --all --since='6 months ago' -E \
--grep="(Bug|Fixed):.*\\b${bug}\\b" --format='%H' 2>/dev/null | sort -u)
[[ -z "$hits" ]] && continue
while read -r h; do
git -C "$repo" log -1 --format='%B' "$h" | grep '^Reviewed-on:' | sed 's/^/ /'
echo "$(git -C "$repo" log -1 --format='%s' "$h")"
done <<<"$hits"
return 0
done
echo " (not found locally)"
}
```
Drive it from `/tmp/cve_bugs.txt`. Prefer the **non-`[M1xx]`-prefixed** commit subject as the canonical main CL; the `[M1xx]` ones are branch cherry-picks.
### 3. Handle misses
For any bug with no local hit:
- `git -C <repo> fetch origin` then re-search `--remotes` (fix may be newer than the checkout).
- Query Gerrit directly: `curl -s "https://chromium-review.googlesource.com/changes/?q=bug:${BUG}&n=10" | tail -n +2 | python3 -m json.tool` (also try `skia-review`, `pdfium-review`, `dawn-review`, `aomedia-review`).
- **`b/` bug format (Skia, Graphite, Dawn):** These repos reference bugs as `b/<id>` in commit messages rather than `Bug: <id>` footers. The Gerrit `bug:` query will return nothing. Use `message:<id>` search instead:
```bash
curl -s "https://skia-review.googlesource.com/changes/?q=message:${BUG}&n=5" | tail -n +2
```
Apply the same pattern for `dawn-review.googlesource.com` when the component is Dawn.
- **Tracing main CLs from merges:** When only `[M1xx]` merge CLs are found, query the CL detail for `cherry_pick_of_change` to find the original main CL number:
```bash
curl -s "https://chromium-review.googlesource.com/changes/${CL_NUM}?o=CURRENT_REVISION" | tail -n +2 | python3 -c "
import sys, json
d = json.load(sys.stdin)
print(d.get('cherry_pick_of_change', 'none'))
"
```
- If still nothing and the bug was reported very recently (especially by "Google Threat Intelligence" or marked in-the-wild), the CL is likely still access-restricted — report it as such rather than guessing.
### 4. Special cases
- **Roll CLs — skip and find the upstream fix:** For components whose fixes land in upstream repos (PDFium, Dawn, Skia, Graphite, libaom, libvpx, ffmpeg), the chromium-review hit will be a `Roll src/third_party/...` commit. Do not report the roll CL as the fix. Instead, query the component's own Gerrit instance directly for the actual fixing CL:
- PDFium → `pdfium-review.googlesource.com` (use `bug:` or `message:` query)
- Dawn → `dawn-review.googlesource.com` (use `message:` query — uses `b/` format)
- Skia / Graphite → `skia-review.googlesource.com` (use `message:` query — uses `b/` format)
- libaom → `aomedia-review.googlesource.com`
Only if the upstream Gerrit instance returns no results should you fall back to reporting the roll CL — in that case, include the roll CL and note that the actual fix is upstream but the specific CL could not be identified.
- Multiple `Reviewed-on:` lines in one commit body: cherry-picks keep the original line plus a new one. The **first** `Reviewed-on:` is the original CL.
- A bug may have multiple distinct fix CLs (fix + follow-up hardening) — list all of them.
### 5. Output
Produce a markdown table per severity level: `CVE | Bug | Component | Fix CL (main)`. Link bugs as `https://crbug.com/<id>`. Save raw output (including all branch merges) to `/tmp/cve_cls.txt` and mention the path.

View File

@@ -0,0 +1,123 @@
---
name: chrome-release-verify
description: End-to-end Chrome security backport for an Electron release branch. Given a Chrome Releases blog URL and a branch (e.g. 41-x-y), determines which CVE fixes are missing from the *actual synced source*, writes the cherry-pick patches locally, validates them with `e sync --3` + `lint --patches`, then pushes a single PR. Use when asked to backport a Chrome security release to N-x-y, "is CVE-X already in N-x-y?", or to produce/validate the cherry-pick set for a release branch.
---
# Chrome Release → Validated Backport PR
Input: `$ARGUMENTS` = `<release-branch> <chrome-releases-blog-url>` (e.g. `41-x-y https://chromereleases.googleblog.com/2026/04/stable-channel-update-for-desktop_15.html`). Ask if either is missing.
The flow is **local-first**: nothing is pushed until every patch applies via `e sync --3` and passes `lint --patches`.
## 1. Map CVE → bug → fix CL
Run `/chrome-release-cls <blog-url>` (or its inline procedure) to produce `/tmp/cve_bugs.txt` (`CVE|bug|severity|desc`) and a per-bug canonical fix CL. For each CL also note `repo` (path under `src/`: `.`, `v8`, `third_party/{skia,angle,pdfium,dawn}`, `third_party/libaom/source/libaom`) and `gerrit-host`.
**Prefer the target-milestone merge CL** if one exists (e.g. on `41-x-y` ≈ M146, prefer the `[M146]` cherry-pick over the main CL) — it's already rebased and far less likely to conflict. Find it via `git log --all --grep` on the Change-Id, or Gerrit `?q=bug:<n>`. If Chrome did *not* merge a fix to the target milestone, that's a strong signal the vulnerable code doesn't exist there — flag it for skip rather than forcing a port.
## 2. Prepare a synced worktree
Reuse `bp-<NN>` from `e show configs` if present, else `e worktree add bp-<NN> ~/src/electron-bp-<NN> --source <current> --no-sync`.
```bash
cd <root>/src/electron
git fetch origin <branch>
git checkout -B security-backport/<branch>/<short-date> origin/<branch>
e use bp-<NN>
e sync 2>&1 | tee /tmp/bp_sync.log
```
If sync fails with `NotADirectoryError: '<root>/src/.git/objects/info/alternates'`, remove `GIT_CACHE_PATH` from the bp config's `env` and retry.
## 3. Verify IN-TREE vs NEEDS-BACKPORT
For each bug, three checks against the **synced** repo:
1. `git -C "$repo" log HEAD --since='1 year ago' -E --grep="\b${bug}\b" --format='%h %s'`
2. Fetch Change-Id from Gerrit, then `git log HEAD --grep="^Change-Id: ${cid}$"`
3. `grep -rlE "(\b${bug}\b|${cid})" <root>/src/electron/patches/`
Any hit ⇒ IN-TREE. All empty ⇒ NEEDS-BACKPORT.
For each NEEDS-BACKPORT CL, also fetch its file list (`/changes/<proj>~<cl>/revisions/current/files`) and **skip** if every file is under `chrome/browser/`, `chrome/android/`, `ios/`, or `components/**/android/` — Electron doesn't compile those.
Report the table now (`CVE | Sev | Bug | Component | Verdict | CL`) and the proposed backport set; get user sign-off before continuing.
## 4. Write patches locally (no push yet)
For each backport CL, fetch the raw patch and write it into `patches/<dir>/`:
```bash
curl -s "https://${host}.googlesource.com/changes/${proj//\//%2F}~${cl}/revisions/current/patch" \
| base64 -d > "patches/${dir}/cherry-pick-${short}.patch"
echo "cherry-pick-${short}.patch" >> "patches/${dir}/.patches"
```
For repos with no Gerrit host `e cherry-pick` supports (e.g. **libaom** on aomedia), instead `git cherry-pick` the upstream commits onto the synced sub-repo HEAD and `git format-patch` the result.
For any newly-created `patches/<dir>/`, append to `patches/config.json` **preserving the compact one-line-per-entry style**:
```json
{ "patch_dir": "src/electron/patches/<dir>", "repo": "src/third_party/<dir-or-nested-path>" }
```
## 5. Validate with `e sync --3`
```bash
e sync --3 2>&1 | tee /tmp/bp_sync3.log
```
On `Patch failed at NNNN <subject>`:
- `cd` into the failing repo, inspect `git diff` for conflict markers.
- **Test-only files** (e.g. `web_tests/VirtualTestSuites`, `*_unittest.cc` context drift): take ours (`git checkout --ours -- <file>`) if the security-relevant hunks merged cleanly.
- **Substantive code conflicts**: check whether a target-milestone merge CL exists and swap to it. If none exists upstream and the surrounding code is structurally different, **drop the patch** (delete the file, remove from `.patches` and `config.json`) and note it for a separate manual-port PR — do not improvise security-fix semantics.
- After resolving: `git add <files> && git -c commit.gpgsign=false am --continue`, then `e patches <repo>` to export the resolved patch, then re-run `e sync --3`. Repeat until clean.
## 6. Export → lint → re-apply loop
```bash
e patches all
node script/lint.js --patches # must exit 0
```
If lint reports findings (typically trailing whitespace on `+` content lines), fixing them **changes the bytes the patch writes**, which invalidates the `index <old>..<new>` blob hashes that `e patches` baked in. Hand-editing a `.patch` and pushing it as-is will pass lint locally but fail CI's Apply Patches re-export check with a one-line `index` hash diff.
So whenever lint (or you) modifies any `.patch` file after export, round-trip once more:
```bash
# fix the lint findings in patches/**/*.patch, then:
e sync # re-apply the edited patches (no --3 needed; they applied cleanly last time)
e patches all # re-export so index blob hashes match the edited content
node script/lint.js --patches # must now exit 0
git diff --quiet -- patches/ || { echo "patches changed again — repeat the loop"; }
```
Repeat until `lint --patches` exits 0 **and** `git diff -- patches/` is empty after the final `e patches all`. Only then is the patch set CI-stable.
## 7. Commit, push, PR
```bash
git add patches/
git commit -m "chore: cherry-pick <N> changes from <dirs>"
git push origin HEAD
gh pr create --repo electron/electron --base <branch> --head <this-branch> \
--title "chore: cherry-pick <N> changes from <dirs>" \
--label "<branch>" --label backport-check-skip --label semver/patch --label "security 🔒" \
--body-file /tmp/pr_body.md
```
PR body format:
```markdown
Backports the following changes:
* [`<shortCommit>`](<gerrit-CL-url>) from <patchDir> — <subject> ([<bug>](https://crbug.com/<bug>), CVE-YYYY-NNNN)
* ...
Notes: Security: backported fixes for CVE-YYYY-NNNN, CVE-YYYY-NNNN, ....
```
Short commit links to the **Gerrit CL**; bug links to `crbug.com`; CVE comes from the blog mapping (the patch's own `Bug:` footer may differ); `Notes:` is the last line. Mention any dropped patches (with reason) above the `Notes:` line.
Restore `e use <previous>` when done.

View File

@@ -0,0 +1,184 @@
---
name: electron-chromium-upgrade
description: Guide for performing Chromium version upgrades in the Electron project. Use when working on the roller/chromium/main branch to fix patch conflicts during `e sync --3`. Covers the patch application workflow, conflict resolution, analyzing upstream Chromium changes, and proper commit formatting for patch fixes.
---
# Electron Chromium Upgrade: Phase One
## Summary
Run `e sync --3` repeatedly, fixing patch conflicts as they arise, until it succeeds. Then export patches and commit changes atomically.
## Success Criteria
Phase One is complete when:
- `e sync --3` exits with code 0 (no patch failures)
- All changes are committed per the commit guidelines
Do not stop until these criteria are met.
**CRITICAL** Do not delete or skip patches unless 100% certain the patch is no longer needed. Complicated conflicts or hard to resolve issues should be presented to the user after you have exhausted all other options. Do not delete the patch just because you can't solve it.
**CRITICAL** Never use `git am --skip` and then manually recreate a patch by making a new commit. This destroys the original patch's authorship, commit message, and position in the series. If `git am --continue` reports "No changes", investigate why — the changes were likely absorbed by a prior conflict resolution's 3-way merge. Present this situation to the user rather than skipping and recreating.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (where most patches apply)
- `patches/`: Patch files organized by target
- `docs/development/patches.md`: Patch system documentation
## Pre-flight Checks
Run these once at the start of each upgrade session:
1. **Clear rerere cache** (if enabled): `git rerere clear` in both the electron and `..` repos. Stale recorded resolutions from a prior attempt can silently apply wrong merges.
2. **Ensure pre-commit hooks are installed**: Check that `.git/hooks/pre-commit` exists. If not, run `yarn husky` to install it. The hook runs `lint-staged` which handles clang-format for C++ files.
## Workflow
1. Run `e sync --3` (the `--3` flag enables 3-way merge, always required)
2. If succeeds → skip to step 5
3. If patch fails:
- Identify target repo and patch from error output
- Analyze failure (see references/patch-analysis.md)
- Fix conflict in target repo's working directory
- Run `git am --continue` in affected repo
- Repeat until all patches for that repo apply
- IMPORTANT: Once `git am --continue` succeeds you MUST run `e patches {target}` to export fixes
- Return to step 1
4. When `e sync --3` succeeds, run `e patches all`
5. **Read `references/phase-one-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e sync --3` | Clone deps and apply patches with 3-way merge |
| `git am --continue` | Continue after resolving conflict (run in target repo) |
| `e patches {target}` | Export commits from target repo to patch files |
| `e patches all` | Export all patches from all targets |
| `e patches {target} --commit-updates` | Export patches and auto-commit trivial changes |
| `e patches --list-targets` | List targets and config paths |
## Patch System Mental Model
```
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
## When to Edit Patches
| Situation | Action |
|-----------|--------|
| During active `git am` conflict | Fix in target repo, then `git am --continue` |
| Modifying patch outside conflict | Edit `.patch` file directly |
| Creating new patch (rare, avoid) | Commit in target repo, then `e patches {target}` |
Fix existing patches 99% of the time rather than creating new ones.
## Patch Fixing Rules
1. **Preserve authorship**: Keep original author in TODO comments (from patch `From:` field)
2. **Never change TODO assignees**: `TODO(name)` must retain original name
3. **Update descriptions**: If upstream changed (e.g., `DCHECK``CHECK_IS_TEST`), update patch commit message to reflect current state
4. **Never skip-and-recreate a patch**: If `git am --continue` says "No changes — did you forget to use 'git add'?", do NOT run `git am --skip` and create a replacement commit. The patch's changes were already absorbed by a prior 3-way merge resolution. This means an earlier conflict resolution pulled in too many changes. Present the situation to the user for guidance — the correct fix may require re-doing an earlier resolution more carefully to keep each patch's changes separate.
# Electron Chromium Upgrade: Phase Two
## Summary
Run `e build -k 999 -- --quiet` repeatedly, fixing build issues as they arise, until it succeeds. Then run `e start --version` to validate Electron launches and commit changes atomically.
Run Phase Two immediately after Phase One is complete.
## Success Criteria
Phase Two is complete when:
- `e build -k 999 -- --quiet` exits with code 0 (no build failures)
- `e start --version` has been run to check Electron launches
- All changes are committed per the commit guidelines
Do not stop until these criteria are met. Do not delete code or features, never comment out code in order to take short cut. Make all existing code, logic and intention work.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions. Chromium APIs frequently are renamed or refactored. In every case the code in Electron must be updated to account for the change in Chromium, strongly avoid making changes to the code in chromium to fix Electrons build.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (do not touch this code to fix build issues, just read it to obtain context)
## Workflow
1. Run `e build -k 999 -- --quiet` (the `--quiet` flag suppresses per-target status lines, showing only errors and the final result)
2. If succeeds → skip to step 6
3. If build fails:
- Identify underlying file in "electron" from the compilation error message
- Analyze failure
- Fix build issue by adapting Electron's code for the change in Chromium
- Run `e build -t {target_that_failed}.o` to build just the failed target we were specifically fixing
- You can identify the target_that_failed from the failure line in the build log. E.g. `FAILED: 2e506007-8d5d-4f38-bdd1-b5cd77999a77 "./obj/electron/chromium_src/chrome/process_singleton_posix.o" CXX obj/electron/chromium_src/chrome/process_singleton_posix.o` the target name is `obj/electron/chromium_src/chrome/process_singleton_posix.o`
- **Read `references/phase-two-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
- Return to step 1
4. **CRITICAL**: After ANY commit (especially patch commits), immediately run `git status` in the electron repo
- Look for other modified `.patch` files that only have index/hunk header changes
- These are dependent patches affected by your fix
- Commit them immediately with: `git commit -am "chore: update patches (trivial only)"`
5. Return to step 1
6. When `e build` succeeds, run `e start --version`
7. Check if you have any pending changes in the Chromium repo by running `git status`
- If you have changes follow the instructions below in "A. Patch Fixes" to correctly commit those modifications into the appropriate patch file
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e build -k 999 -- --quiet` | Build Electron, continue on errors, suppress status lines |
| `e build -t {target}.o` | Build just one specific target to verify a fix |
| `e start --version` | Validate Electron launches after successful build |
## Two Types of Build Fixes
### A. Patch Fixes (for files in chromium_src or patched Chromium files)
When the error is in a file that Electron patches (check with `grep -l "filename" patches/chromium/*.patch`):
1. Edit the file in the Chromium source tree (e.g., `/src/chrome/browser/...`)
2. Create a fixup commit targeting the original patch commit:
```bash
cd .. # to chromium repo
git add <modified-file>
git commit --fixup=<original-patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
```
3. Export the updated patch: `e patches chromium`
4. Commit the updated patch file following `references/phase-one-commit-guidelines.md`.
To find the original patch commit to fixup: `git log --oneline | grep -i "keyword from patch name"`
The base commit for rebase is the Chromium commit before patches were applied. Find it by checking the `refs/patches/upstream-head` ref.
### B. Electron Code Fixes (for files in shell/, electron/, etc.)
When the error is in Electron's own source code:
1. Edit files directly in the electron repo
2. Commit directly (no patch export needed)
# Critical: Read Before Committing
- Before ANY Phase One commits: Read `references/phase-one-commit-guidelines.md`
- Before ANY Phase Two commits: Read `references/phase-two-commit-guidelines.md`
# Skill Directory Structure
This skill has additional reference files in `references/`:
- patch-analysis.md - How to analyze patch failures
- phase-one-commit-guidelines.md - Commit format for Phase One
- phase-two-commit-guidelines.md - Commit format for Phase Two
Read these when referenced in the workflow steps.

View File

@@ -0,0 +1,119 @@
# Analyzing Patch Failures
## Investigation Steps
1. **Read the patch file** at `patches/{target}/{patch_name}.patch`
2. **Examine current state** of the file in Chromium at mentioned line numbers
3. **Check recent upstream changes:**
```bash
cd .. # or relevant target repo
git log --oneline -10 -- {file}
```
4. **Find Chromium CL** in commit messages:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/{CL_NUMBER}
```
## Critical: Resolve by Intent, Not by Mechanical Merge
When resolving a patch conflict, do NOT blindly preserve the patch's old code. Instead:
1. **Understand the upstream CL's full scope** — not just the conflicting hunk.
Run `git show <commit> --stat` and read diffs for all affected files.
Upstream may have removed structs, members, or methods that the patch
references in other hunks or files.
2. **Re-read the patch commit message** to understand its *intent* — what
behavior does it need to preserve or add?
3. **Implement the intent against the new upstream code.** If the patch's
purpose is "add a feature flag guard", add only the guard — don't also
restore old code inside the guard that upstream separately removed.
### Lesson: Upstream Removals Break Patch References
- **Trigger:** Patch conflict involves an upstream refactor (not just context drift)
- **Strategy:** After identifying the upstream CL, check its full diff for
removed types, members, and methods. If the patch's old code references
something removed, the resolution must use the new upstream mechanism.
- **Evidence:** An upstream CL removed a `HeadlessModeWindow` struct from a
header, but the conflict was only in a `.mm` file. Mechanically keeping the
patch's old line (`headless_mode_window_ = ...`) produced code referencing
a nonexistent type — caught only on review, not at patch-apply time.
### Lesson: Separate Patch Purpose from Patch Implementation
- **Trigger:** Conflict between "upstream simplified code" vs "patch has older code"
- **Strategy:** Identify the *minimal* change the patch needs. If the patch
wraps code in a conditional, only add the conditional — don't restore old
code that was inside the conditional but was separately cleaned up upstream.
- **Evidence:** An occlusion patch needed only a feature flag check, but the
old patch also contained a version check that upstream intentionally removed.
Mechanically preserving the old patch code re-added the removed check.
### Lesson: Finish the Adaptation at Conflict Time
- **Trigger:** A patch conflict involves an upstream API removal or replacement
- **Strategy:** When resolving the conflict, fully adapt the patch to use the
new API in the same commit. Don't remove the old code and leave behind stale
references that will "be fixed in Phase Two." Each patch fix commit should be
a complete resolution.
- **Evidence:** A safestorage patch conflicted because Chromium removed Keychain V1.
The conflict was resolved by removing V1 hunks, but the remaining code still
called V1 methods (`FindGenericPassword` with 3 args, `ItemDelete` with
`SecKeychainItemRef`). These should have been adapted to V2 APIs in the same
commit, not deferred.
## Common Failure Patterns
| Pattern | Cause | Solution |
|---------|-------|----------|
| Context lines don't match | Surrounding code changed | Update context in patch |
| File not found | File renamed/moved | Update patch target path |
| Function not found | Refactored upstream | Find new function name |
| `DCHECK` → `CHECK_IS_TEST` | Macro change | Update to new macro |
| Deleted code | Feature removed | Verify patch still needed |
## Using Git Blame
To find the CL that changed specific lines:
```bash
cd ..
git blame -L {start},{end} -- {file}
git log -1 {commit_sha} # Look for Reviewed-on: line
```
## Verifying Patch Necessity
Before deleting a patch, verify:
1. The patched functionality was intentionally removed upstream
2. Electron doesn't need the patch for other reasons
3. No other code depends on the patched behavior
When in doubt, keep the patch and adapt it.
## Phase Two: Build-Time Patch Issues
Sometimes patches that applied successfully in Phase One cause build errors in Phase Two. This can happen when:
1. **Incomplete types**: A patch disables a header include, but new upstream code uses the type
2. **Missing members**: A patch modifies a class, but upstream added new code referencing the original
### Finding Which Patch Affects a File
```bash
grep -l "filename.cc" patches/chromium/*.patch
```
Matching Existing Patch Patterns
When fixing build errors in patched files, examine the existing patch to understand its style:
- Does it use #if 0 / #endif guards?
- Does it use #if BUILDFLAG(...) conditionals?
- What's the pattern for disabled functionality?
Apply fixes consistent with the existing patch style.

View File

@@ -0,0 +1,102 @@
# Phase One Commit Guidelines
Only follow these instructions if there are uncommitted changes to `patches/` after Phase One succeeds.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Each Commit Must Be Complete
When resolving a patch conflict, fully adapt the patch to the new upstream code in the same commit. If the upstream change removes an API the patch uses, update the patch to use the replacement API now — don't leave stale references knowing they'll need fixing later. The goal is that each commit represents a finished resolution, not a partial one that defers known work to a future phase.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
### Patch conflict fixes
Use `fix(patch):` prefix. The title should name the upstream change, not your response to it:
```
fix(patch): {topic headline}
Ref: {Chromium CL link}
Co-Authored-By: <AI model attribution>
```
Only add a description body if it provides clarity beyond the title. For straightforward context drift or simple API renames, the title + Ref is sufficient.
Examples:
- `fix(patch): constant moved to header`
- `fix(patch): headless mode refactor upstream`
- `fix(patch): V1 Keychain removal`
### Upstreamed patch removal
When patches are no longer needed (applied cleanly with "already applied" or confirmed upstreamed), group ALL removals into a single commit:
```
chore: remove upstreamed patch
```
or (if multiple):
```
chore: remove upstreamed patches
```
If the patch file did NOT contain a `Reviewed-on: https://chromium-review.googlesource.com/c/chromium/...` link, add a `Ref:` in the commit. If it did (i.e. cherry-picks), no `Ref:` is needed.
### Trivial patch updates
After all fix commits, stage remaining trivial changes (index, line numbers, context only):
```bash
git add patches
git commit -m "chore: update patches (trivial only)"
```
**Conflict resolution can produce trivial results.** A `git am` conflict doesn't always mean the patch content changed — context drift alone can cause a conflict. After resolving and exporting, inspect the patch diff: if only index hashes, line numbers, and context lines changed (not the patch's own `+`/`-` lines), it's trivial and belongs here, not in a `fix(patch):` commit.
## Atomic Commits
Each patch conflict fix gets its own commit with its own Ref.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
## Finding CL References
Use `git log` or `git blame` on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Example Commits
### Patch conflict fix (simple — title is sufficient)
```
fix(patch): constant moved to header
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483
Co-Authored-By: <AI model attribution>
```
### Patch conflict fix (complex — description adds value)
```
fix(patch): V1 Keychain removal
Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted
keychain_password_mac.mm to use KeychainV2 APIs.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447
Co-Authored-By: <AI model attribution>
```

View File

@@ -0,0 +1,84 @@
# Phase Two Commit Guidelines
Only follow these instructions if there are uncommitted changes in the Electron repo after any fixes are made during Phase Two that result a target that was failing, successfully building.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters. Exception: upstream Chromium CL titles are used verbatim even if longer.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
## Two Commit Types
### For Electron Source Changes (shell/, electron/, etc.)
```
{CL-Number}: {upstream CL's original title}
Ref: {Chromium CL link}
Co-Authored-By: <AI model attribution>
```
Use the **upstream CL's original commit title** — do not paraphrase or rewrite it. To find it: `git log -1 --format=%s <chromium-commit-hash>`.
Only add a description body if it provides clarity beyond what the title already says (e.g., when Electron's adaptation is non-obvious). For simple renames, method additions, or straightforward API updates, the title + Ref link is sufficient.
Each change should have its own commit and its own Ref. Logically group into commits that make sense rather than one giant commit. You may include multiple "Ref" links if required.
For a CL link in the format `https://chromium-review.googlesource.com/c/chromium/src/+/2958369` the "CL-Number" is `2958369`.
IMPORTANT: Try really hard to find the CL reference. Each change you made should in theory have been in response to a change in Chromium. Do not give up easily.
### For Patch Updates (patches/chromium/*.patch)
Use the same fixup workflow as Phase One and follow `references/phase-one-commit-guidelines.md` for the commit message format (`fix(patch):` prefix, topic style).
## Dependent Patch Header Updates
After any patch modification, check for other affected patches:
```bash
git status
# If other .patch files show as modified with only index, line number, and context changes:
git add patches/
git commit -m "chore: update patches (trivial only)"
```
## Finding CL References
Use git log or git blame on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Example Commits
### Electron Source Fix (simple — title is self-explanatory)
```
7535923: Rename ozone buildflags
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923
Co-Authored-By: <AI model attribution>
```
### Electron Source Fix (complex — description adds value)
```
7534194: Convert some functions in ui::Clipboard to async
Adapted ExtractCustomPlatformNames calls to use RunLoop pattern
consistent with existing ReadImage implementation, since upstream
converted the API from synchronous return to callback-based.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194
Co-Authored-By: <AI model attribution>
```

View File

@@ -0,0 +1,323 @@
---
name: electron-node-upgrade
description: Guide for performing Node.js version upgrades in the Electron project. Use when working on the roller/node/main branch to fix patch conflicts during `e sync --3`. Covers the patch application workflow, conflict resolution, analyzing upstream Node.js changes, building, running the Node.js test suite, and proper commit formatting for patch fixes.
---
# Electron Node.js Upgrade: Phase One
## Summary
Run `e sync --3` repeatedly, fixing patch conflicts as they arise, until it succeeds. Then export patches and commit changes atomically.
## Success Criteria
Phase One is complete when:
- `e sync --3` exits with code 0 (no patch failures)
- All changes are committed per the commit guidelines
Do not stop until these criteria are met.
**CRITICAL** Do not delete or skip patches unless 100% certain the patch is no longer needed. For major version upgrades, patches that shim deprecated V8 APIs or backport upstream changes are often deletable because the new Node.js version already incorporates them — but verify before removing. Complicated conflicts or hard to resolve issues should be presented to the user after you have exhausted all other options. Do not delete the patch just because you can't solve it.
**CRITICAL** Never use `git am --skip` and then manually recreate a patch by making a new commit. This destroys the original patch's authorship, commit message, and position in the series. If `git am --continue` reports "No changes", investigate why — the changes were likely absorbed by a prior conflict resolution's 3-way merge. Present this situation to the user rather than skipping and recreating.
## Context
The `roller/node/main` branch is created by automation to update Electron's Node.js dependency version in `DEPS`. No work has been done to handle breaking changes between the old and new versions.
There are two types of Node.js version updates:
- **Bumps** (patch/minor): Automated by `electron-roller[bot]` with commit title `chore: bump node to v{version}`. Trivial patch index updates are handled automatically by `patchup[bot]`. These often land cleanly, but may require manual patch fixes.
- **Major upgrades** (e.g., v22 → v24): Manual, large PRs with commit title `chore: upgrade Node.js to v{X}.{Y}.{Z}`. These typically involve deleting obsolete patches, adapting many others, and updating `@types/node` in `package.json`.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `../third_party/electron_node`: Node.js repo (where patches apply)
- `patches/node/`: Patch files for Node.js
- `docs/development/patches.md`: Patch system documentation
## Pre-flight Checks
Run these once at the start of each upgrade session:
1. **Clear rerere cache** (if enabled): `git rerere clear` in both the electron and `../third_party/electron_node` repos. Stale recorded resolutions from a prior attempt can silently apply wrong merges.
2. **Ensure pre-commit hooks are installed**: Check that `.git/hooks/pre-commit` exists. If not, run `yarn husky` to install it. The hook runs `lint-staged` which handles clang-format for C++ files.
## Workflow
1. Run `e sync --3` (the `--3` flag enables 3-way merge, always required)
2. If succeeds → skip to step 5
3. If patch fails:
- Identify target repo and patch from error output
- Analyze failure (see references/patch-analysis.md)
- Fix conflict in `../third_party/electron_node` working directory
- Run `git am --continue` in `../third_party/electron_node`
- Repeat until all patches for that repo apply
- IMPORTANT: Once `git am --continue` succeeds you MUST run `e patches node` to export fixes
- Return to step 1
4. When `e sync --3` succeeds, run `e patches all`
5. **Read `references/phase-one-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e sync --3` | Clone deps and apply patches with 3-way merge |
| `git am --continue` | Continue after resolving conflict (run in node repo) |
| `e patches node` | Export commits from node repo to patch files |
| `e patches all` | Export all patches from all targets |
| `e patches node --commit-updates` | Export patches and auto-commit trivial changes |
| `e patches --list-targets` | List targets and config paths |
## Patch System Mental Model
```
patches/node/*.patch → [e sync --3] → ../third_party/electron_node commits
← [e patches] ←
```
## When to Edit Patches
| Situation | Action |
|-----------|--------|
| During active `git am` conflict | Fix in node repo, then `git am --continue` |
| Modifying patch outside conflict | Edit `.patch` file directly |
| Creating new patch (rare, avoid) | Commit in node repo, then `e patches node` |
Fix existing patches 99% of the time rather than creating new ones.
## Patch Fixing Rules
1. **Preserve authorship**: Keep original author in TODO comments (from patch `From:` field)
2. **Never change TODO assignees**: `TODO(name)` must retain original name
3. **Update descriptions**: If upstream changed APIs or macros, update patch commit message to reflect current state
4. **Never skip-and-recreate a patch**: If `git am --continue` says "No changes — did you forget to use 'git add'?", do NOT run `git am --skip` and create a replacement commit. The patch's changes were already absorbed by a prior 3-way merge resolution. This means an earlier conflict resolution pulled in too many changes. Present the situation to the user for guidance — the correct fix may require re-doing an earlier resolution more carefully to keep each patch's changes separate.
# Electron Node.js Upgrade: Phase Two
## Summary
Run `e build -k 999 -- --quiet` repeatedly, fixing build issues as they arise, until it succeeds. Then run `e start --version` to validate Electron launches and commit changes atomically.
Run Phase Two immediately after Phase One is complete.
## Success Criteria
Phase Two is complete when:
- `e build -k 999 -- --quiet` exits with code 0 (no build failures)
- `e start --version` has been run to check Electron launches
- All changes are committed per the commit guidelines
Do not stop until these criteria are met. Do not delete code or features, never comment out code in order to take short cut. Make all existing code, logic and intention work.
## Context
The `roller/node/main` branch is created by automation to update Electron's Node.js dependency version in `DEPS`. No work has been done to handle breaking changes between the old and new versions. Node.js APIs (especially internal V8 integration, OpenSSL/BoringSSL compatibility, and build system files) frequently change between versions. In every case the code in Electron must be updated to account for the change in Node.js, strongly avoid making changes to the code in Node.js to fix Electron's build.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `../third_party/electron_node`: Node.js repo (do not touch this code to fix build issues, just read it to obtain context)
## Workflow
1. Run `e build -k 999 -- --quiet` (the `--quiet` flag suppresses per-target status lines, showing only errors and the final result)
2. If succeeds → skip to step 6
3. If build fails:
- Identify underlying file in "electron" from the compilation error message
- Analyze failure
- Fix build issue by adapting Electron's code for the change in Node.js
- Run `e build -t {target_that_failed}.o` to build just the failed target we were specifically fixing
- You can identify the target_that_failed from the failure line in the build log. E.g. `FAILED: 2e506007-8d5d-4f38-bdd1-b5cd77999a77 "./obj/electron/shell/browser/api/electron_api_utility_process.o" CXX obj/electron/shell/browser/api/electron_api_utility_process.o` the target name is `obj/electron/shell/browser/api/electron_api_utility_process.o`
- **Read `references/phase-two-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
- Return to step 1
4. **CRITICAL**: After ANY commit (especially patch commits), immediately run `git status` in the electron repo
- Look for other modified `.patch` files that only have index/hunk header changes
- These are dependent patches affected by your fix
- Commit them immediately with: `git commit -am "chore: update patches (trivial only)"`
5. Return to step 1
6. When `e build` succeeds, run `e start --version`
7. Check if you have any pending changes in the Node.js repo by running `git status` in `../third_party/electron_node`
- If you have changes follow the instructions below in "A. Patch Fixes" to correctly commit those modifications into the appropriate patch file
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e build -k 999 -- --quiet` | Build Electron, continue on errors, suppress status lines |
| `e build -t {target}.o` | Build just one specific target to verify a fix |
| `e start --version` | Validate Electron launches after successful build |
## Two Types of Build Fixes
### A. Patch Fixes (for files in patched Node.js files)
When the error is in a file that Electron patches (check with `grep -l "filename" patches/node/*.patch`):
1. Edit the file in the Node.js source tree (`../third_party/electron_node/...`)
2. Create a fixup commit targeting the original patch commit:
```bash
cd ../third_party/electron_node
git add <modified-file>
git commit --fixup=<original-patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
```
3. Export the updated patch: `e patches node`
4. Commit the updated patch file following `references/phase-one-commit-guidelines.md`.
To find the original patch commit to fixup: `git log --oneline | grep -i "keyword from patch name"`
The base commit for rebase is the Node.js commit before patches were applied. Find it by checking the `refs/patches/upstream-head` ref.
### B. Electron Code Fixes (for files in shell/, electron/, etc.)
When the error is in Electron's own source code:
1. Edit files directly in the electron repo
2. Commit directly (no patch export needed)
# Electron Node.js Upgrade: Phase Three
## Summary
Run the Node.js test suite via `script/node-spec-runner.js`, fix failing tests, and commit fixes until all tests pass. Certain tests are permanently disabled (listed in `script/node-disabled-tests.json`) and should not be run.
Run Phase Three immediately after Phase Two is complete.
## Success Criteria
Phase Three is complete when:
- `node script/node-spec-runner.js --default` exits with zero failures
- All changes are committed per the commit guidelines
Do not stop until these criteria are met.
## Context
Electron runs a subset of Node.js's upstream test suite using a custom runner (`script/node-spec-runner.js`). Tests are executed with the built Electron binary via `ELECTRON_RUN_AS_NODE=true`. Many tests need adaptation because Electron uses BoringSSL (not OpenSSL) and Chromium's V8 (which may differ from Node.js's bundled V8).
**Key files:**
- `script/node-spec-runner.js` — Test runner script
- `script/node-disabled-tests.json` — Permanently disabled tests (do not try to fix these)
- `../third_party/electron_node/test/` — Node.js test files (where patches apply)
- `patches/node/fix_crypto_tests_to_run_with_bssl.patch` — BoringSSL crypto test adaptations
- `patches/node/test_formally_mark_some_tests_as_flaky.patch` — Flaky test list
## Workflow
1. Run `node script/node-spec-runner.js --default` from the electron repo
2. If all tests pass → Phase Three is complete
3. If tests fail:
- Identify the failing test file(s) from the output
- Analyze each failure (see "Common Failure Patterns" below)
- Fix the test in `../third_party/electron_node/test/...`
- Re-run the specific failing test to verify: `node script/node-spec-runner.js {test-path}`
- The test path is relative to the node `test/` directory, e.g. `test/parallel/test-crypto-key-objects-raw.js`
- Do NOT use `--default` when running specific tests — it adds the full suite flags
- Do NOT run tests directly with `ELECTRON_RUN_AS_NODE` — the runner handles environment setup (e.g. temporarily switching `package.json` from ESM to CommonJS)
- Commit the fix using the fixup workflow and commit guidelines
- Return to step 1
## Commands Reference
| Command | Purpose |
|---------|---------|
| `node script/node-spec-runner.js --default` | Run full Node.js test suite |
| `node script/node-spec-runner.js test/parallel/test-foo.js` | Run a single test |
| `NODE_REGENERATE_SNAPSHOTS=1 node script/node-spec-runner.js test/test-runner/test-foo.mjs` | Regenerate snapshot for a snapshot-based test |
## Common Failure Patterns
### BoringSSL incompatibilities
Electron uses BoringSSL (via Chromium) instead of OpenSSL. Many crypto features are missing or behave differently:
| Unsupported in BoringSSL | Guard pattern |
|--------------------------|---------------|
| ChaCha20-Poly1305 | `if (!process.features.openssl_is_boringssl)` |
| AES-CCM (aes-128-ccm, aes-256-ccm) | `if (ciphers.includes('aes-128-ccm'))` |
| AES-KW (key wrapping) | `if (!process.features.openssl_is_boringssl)` |
| DSA keys | `if (!process.features.openssl_is_boringssl)` |
| Ed448 / X448 curves | `if (!process.features.openssl_is_boringssl)` |
| DH key PEM loading | `if (!process.features.openssl_is_boringssl)` |
| PQC algorithms (ML-KEM, ML-DSA, SLH-DSA) | `if (hasOpenSSL(3, 5))` (already guards these) |
When guarding tests, prefer checking cipher availability (`ciphers.includes(algo)`) over blanket BoringSSL checks where possible, as it's more precise and self-documenting.
New upstream tests that exercise these features will need guards added to the `fix_crypto_tests_to_run_with_bssl` patch.
### Snapshot test mismatches
Some tests compare output against committed `.snapshot` files using `assert.strictEqual` — these are NOT wildcard comparisons. When Chromium's V8 produces different output (e.g. different stack traces due to V8 enhancements), the snapshot must be regenerated:
```bash
NODE_REGENERATE_SNAPSHOTS=1 node script/node-spec-runner.js test/test-runner/test-foo.mjs
```
Then inspect the diff to verify the changes are expected, and commit the updated snapshot into the appropriate patch.
### V8 behavioral differences
Chromium's V8 may be ahead of Node.js's bundled V8. This can cause:
- Different stack trace formats (e.g. thenable async stack frames)
- Different error messages
- Features available in Chromium V8 that aren't in stock Node.js V8 (or vice versa)
## Two Types of Test Fixes
### A. Patch Fixes (most common for test failures)
Most test fixes go into existing patches in `patches/node/`. Use the fixup workflow:
1. Edit the test file in `../third_party/electron_node/test/...`
2. Find the relevant patch commit: `git log --oneline | grep -i "keyword"`
- Crypto/BoringSSL tests → `fix crypto tests to run with bssl`
- Snapshot tests → the specific snapshot patch (e.g. `test: accomodate V8 thenable`)
- Flaky tests → `test: formally mark some tests as flaky`
3. Create a fixup commit:
```bash
cd ../third_party/electron_node
git add test/path/to/test.js
git commit --fixup=<patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
```
4. Export: `e patches node`
5. **Read `references/phase-three-commit-guidelines.md` NOW**, then commit the updated patch file.
### B. New Patches (rare)
Only create a new patch when the fix doesn't belong in any existing patch. The new patch commit in `../third_party/electron_node` must include a description explaining why the patch exists and when it can be removed — the lint check enforces this.
## Adding to Disabled Tests
Only add a test to `script/node-disabled-tests.json` as a **last resort** — when the test is fundamentally incompatible with Electron's architecture (not just a BoringSSL difference that can be guarded). Tests disabled here are completely skipped and never run.
# Critical: Read Before Committing
- Before ANY Phase One commits: Read `references/phase-one-commit-guidelines.md`
- Before ANY Phase Two commits: Read `references/phase-two-commit-guidelines.md`
- Before ANY Phase Three commits: Read `references/phase-three-commit-guidelines.md`
# High-Churn Patches
These patches consistently require the most work during Node.js upgrades:
- **`fix_handle_boringssl_and_openssl_incompatibilities.patch`** — Electron uses BoringSSL (via Chromium) while Node.js expects OpenSSL. This patch is large and complex, and upstream OpenSSL API changes frequently break it.
- **`fix_crypto_tests_to_run_with_bssl.patch`** — Companion to the above; adapts Node.js crypto tests for BoringSSL. Can grow significantly during major upgrades.
- **`support_v8_sandboxed_pointers.patch`** — V8 sandbox pointer support requires careful adaptation when V8 APIs change.
- **`build_add_gn_build_files.patch`** — The GN build file patch is large and touches many build targets. Upstream build system changes frequently conflict.
# Major Version Upgrades
Major Node.js version transitions (e.g., v22 → v24) are significantly more involved than patch bumps:
1. **Expect patch deletions.** Electron uses Chromium's V8, which is often ahead of the V8 version bundled in Node.js. Many patches exist to bridge this gap — shimming newer V8 APIs that Chromium's V8 has but Node.js' older V8 doesn't. When Node.js bumps to a newer major version, its V8 catches up to Chromium's, and those bridge patches can be deleted. In the v22 → v24 upgrade, 17 patches were deleted for this reason.
2. **Update `@types/node`** in `package.json` to match the new major version.
3. **Post-upgrade regressions are expected.** Even after the upgrade lands, follow-up fix PRs for edge cases (ESM path handling, certificate loading, platform-specific issues) are normal.
# Skill Directory Structure
This skill has additional reference files in `references/`:
- patch-analysis.md - How to analyze patch failures
- phase-one-commit-guidelines.md - Commit format for Phase One
- phase-two-commit-guidelines.md - Commit format for Phase Two
- phase-three-commit-guidelines.md - Commit format for Phase Three
Read these when referenced in the workflow steps.

View File

@@ -0,0 +1,112 @@
# Analyzing Patch Failures
## Investigation Steps
1. **Read the patch file** at `patches/node/{patch_name}.patch`
2. **Examine current state** of the file in the Node.js repo at mentioned line numbers
3. **Check recent upstream changes:**
```bash
cd ../third_party/electron_node
git log --oneline -10 -- {file}
```
4. **Find Node.js PR** in commit messages:
```
PR-URL: https://github.com/nodejs/node/pull/{PR_NUMBER}
```
## Critical: Resolve by Intent, Not by Mechanical Merge
When resolving a patch conflict, do NOT blindly preserve the patch's old code. Instead:
1. **Understand the upstream commit's full scope** — not just the conflicting hunk.
Run `git show <commit> --stat` and read diffs for all affected files.
Upstream may have removed structs, members, or methods that the patch
references in other hunks or files.
2. **Re-read the patch commit message** to understand its *intent* — what
behavior does it need to preserve or add?
3. **Implement the intent against the new upstream code.** If the patch's
purpose is "add BoringSSL compatibility", add only the compatibility
layer — don't also restore old code that upstream separately removed.
### Lesson: Upstream Removals Break Patch References
- **Trigger:** Patch conflict involves an upstream refactor (not just context drift)
- **Strategy:** After identifying the upstream commit, check its full diff for
removed types, members, and methods. If the patch's old code references
something removed, the resolution must use the new upstream mechanism.
### Lesson: Separate Patch Purpose from Patch Implementation
- **Trigger:** Conflict between "upstream simplified code" vs "patch has older code"
- **Strategy:** Identify the *minimal* change the patch needs. If the patch
wraps code in a conditional, only add the conditional — don't restore old
code that was inside the conditional but was separately cleaned up upstream.
### Lesson: Finish the Adaptation at Conflict Time
- **Trigger:** A patch conflict involves an upstream API removal or replacement
- **Strategy:** When resolving the conflict, fully adapt the patch to use the
new API in the same commit. Don't remove the old code and leave behind stale
references that will "be fixed in Phase Two." Each patch fix commit should be
a complete resolution.
## Common Failure Patterns
| Pattern | Cause | Solution |
|---------|-------|----------|
| Context lines don't match | Surrounding code changed | Update context in patch |
| File not found | File renamed/moved | Update patch target path |
| Function not found | Refactored upstream | Find new function name |
| OpenSSL → BoringSSL mismatch | Crypto API change | Update to BoringSSL-compatible API |
| GYP/GN build change | Build system refactor | Adapt build patch to new structure |
| Deleted code | Feature removed | Verify patch still needed |
| V8 API bridge patch conflicts | Node.js caught up to Chromium's V8 | Patch may be deletable — verify the API is now in Node.js' V8 natively |
## Using Git Blame
To find the commit that changed specific lines:
```bash
cd ../third_party/electron_node
git blame -L {start},{end} -- {file}
git log -1 {commit_sha} # Look for PR-URL: line
```
## Verifying Patch Necessity
Before deleting a patch, verify:
1. The patched functionality was intentionally removed upstream
2. Electron doesn't need the patch for other reasons
3. No other code depends on the patched behavior
**V8 bridge patches:** Electron uses Chromium's V8, which is often ahead of the V8 bundled in Node.js. Many patches exist to bridge this version gap — adapting Node.js code to work with newer V8 APIs that Chromium's V8 exposes. During major Node.js upgrades, Node.js' V8 catches up to Chromium's, and these bridge patches often become unnecessary. Check whether the API the patch shims is now available natively in the new Node.js version's V8.
When in doubt, keep the patch and adapt it.
## Phase Two: Build-Time Patch Issues
Sometimes patches that applied successfully in Phase One cause build errors in Phase Two. This can happen when:
1. **Incomplete types**: A patch disables a header include, but new upstream code uses the type
2. **Missing members**: A patch modifies a class, but upstream added new code referencing the original
### Finding Which Patch Affects a File
```bash
grep -l "filename.cc" patches/node/*.patch
```
### Matching Existing Patch Patterns
When fixing build errors in patched files, examine the existing patch to understand its style:
- Does it use `#if 0` / `#endif` guards?
- Does it use `#if BUILDFLAG(...)` conditionals?
- Does it use `#ifndef` / `#ifdef` guards for BoringSSL vs OpenSSL?
- What's the pattern for disabled functionality?
Apply fixes consistent with the existing patch style.

View File

@@ -0,0 +1,111 @@
# Phase One Commit Guidelines
Only follow these instructions if there are uncommitted changes to `patches/` after Phase One succeeds.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Each Commit Must Be Complete
When resolving a patch conflict, fully adapt the patch to the new upstream code in the same commit. If the upstream change removes an API the patch uses, update the patch to use the replacement API now — don't leave stale references knowing they'll need fixing later. The goal is that each commit represents a finished resolution, not a partial one that defers known work to a future phase.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
### Patch conflict fixes
Use `fix(patch):` prefix. The title should name the upstream change, not your response to it:
```
fix(patch): {topic headline}
Ref: {Node.js commit or issue link}
Co-Authored-By: <AI model attribution>
```
Only add a description body if it provides clarity beyond the title. For straightforward context drift or simple API renames, the title + Ref is sufficient.
Examples:
- `fix(patch): stop using v8::PropertyCallbackInfo<T>::This()`
- `fix(patch): BoringSSL and OpenSSL incompatibilities`
- `fix(patch): refactor module_wrap.cc FixedArray::Get params`
### Upstreamed patch removal
When patches are no longer needed (applied cleanly with "already applied" or confirmed upstreamed), group ALL removals into a single commit:
```
chore: remove upstreamed patch
```
or (if multiple):
```
chore: remove upstreamed patches
```
Most Node.js patches in Electron are Electron-authored (no upstream `PR-URL:`). If the patch originated from an upstream Node.js PR, no extra `Ref:` is needed. Otherwise, add a `Ref:` pointing to the relevant Node.js issue or commit if one exists.
### Trivial patch updates
After all fix commits, stage remaining trivial changes (index, line numbers, context only):
```bash
git add patches
git commit -m "chore: update patches (trivial only)"
```
**Conflict resolution can produce trivial results.** A `git am` conflict doesn't always mean the patch content changed — context drift alone can cause a conflict. After resolving and exporting, inspect the patch diff: if only index hashes, line numbers, and context lines changed (not the patch's own `+`/`-` lines), it's trivial and belongs here, not in a `fix(patch):` commit.
## Atomic Commits
Each patch conflict fix gets its own commit with its own Ref.
IMPORTANT: Try really hard to find the PR or commit reference per the instructions below. Each change you made should in theory have been in response to a change made in Node.js that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
## Finding Commit/Issue References
Use `git log` or `git blame` on Node.js source files in `../third_party/electron_node`. Look for:
```
PR-URL: https://github.com/nodejs/node/pull/XXXXX
```
or issue references in the patch itself:
```
Refs: https://github.com/nodejs/node/issues/XXXXX
```
Note: Most Node.js patches in Electron are Electron-authored and won't have upstream references. In that case, check `git log` in the Node.js repo to find which upstream commit caused the conflict.
If no reference found after searching: `Ref: Unable to locate reference`
## Example Commits
### Patch conflict fix (simple — title is sufficient)
```
fix(patch): stop using v8::PropertyCallbackInfo<T>::This()
Ref: https://github.com/nodejs/node/issues/60616
Co-Authored-By: <AI model attribution>
```
### Patch conflict fix (complex — description adds value)
```
fix(patch): BoringSSL and OpenSSL incompatibilities
Upstream updated OpenSSL APIs that diverge from BoringSSL. Adapted
the compatibility shims in crypto patches to use the BoringSSL
equivalents.
Ref: Unable to locate reference
Co-Authored-By: <AI model attribution>
```

View File

@@ -0,0 +1,80 @@
# Phase Three Commit Guidelines
Only follow these instructions if there are uncommitted changes after fixing a test failure during Phase Three.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
## Commit Types
### Patch updates (most test fixes)
Test fixes go into existing patches via the fixup workflow. Use `fix(patch):` prefix with a descriptive topic:
```
fix(patch): {topic headline}
Ref: {Node.js commit or issue link}
Co-Authored-By: <AI model attribution>
```
Examples:
- `fix(patch): guard DH key test for BoringSSL`
- `fix(patch): adapt new crypto tests for BoringSSL`
- `fix(patch): correct thenable snapshot for Chromium V8`
- `fix(patch): skip AES-KW tests with BoringSSL`
Group related test fixes into a single commit when they address the same root cause (e.g., multiple crypto tests all needing BoringSSL guards for the same missing cipher). Don't create one commit per test file if they share the same fix pattern.
### Snapshot regeneration
When a snapshot test fails because Chromium's V8 produces different output, regenerate it:
```bash
NODE_REGENERATE_SNAPSHOTS=1 node script/node-spec-runner.js test/test-runner/test-foo.mjs
```
Then commit the updated snapshot patch with a title describing what changed:
```
fix(patch): correct {name} snapshot for Chromium V8
Ref: {V8 CL or issue link if known}
Co-Authored-By: <AI model attribution>
```
### Trivial patch updates
After any patch modification, check for dependent patches that only have index/hunk header changes:
```bash
git status
# If other .patch files show as modified with only trivial changes:
git add patches/
git commit -m "chore: update patches (trivial only)"
```
## Finding References
For BoringSSL-related test fixes, the reference is typically the upstream Node.js PR that added the new test:
```bash
cd ../third_party/electron_node
git log --oneline -5 -- test/parallel/test-crypto-foo.js
git log -1 <commit> --format="%B" | grep "PR-URL"
```
For V8 behavioral differences, reference the Chromium CL:
```
Ref: https://chromium-review.googlesource.com/c/v8/v8/+/NNNNNNN
```
If no reference found after searching: `Ref: Unable to locate reference`

View File

@@ -0,0 +1,96 @@
# Phase Two Commit Guidelines
Only follow these instructions if there are uncommitted changes in the Electron repo after any fixes are made during Phase Two that result a target that was failing, successfully building.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters. Exception: upstream Node.js PR titles are used verbatim even if longer.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
## Two Commit Types
### For Electron Source Changes (shell/, electron/, etc.)
When the upstream Node.js commit has a `PR-URL:`:
```
node#{PR-Number}: {upstream PR's original title}
Ref: {Node.js PR link}
Co-Authored-By: <AI model attribution>
```
When there is no `PR-URL:` but there is an issue reference or commit:
```
fix: {description of the adaptation}
Ref: {Node.js issue or commit link}
Co-Authored-By: <AI model attribution>
```
Use the **upstream commit's original title** when available — do not paraphrase or rewrite it. To find it: check the commit message in `../third_party/electron_node` for `PR-URL:` or `Refs:` lines.
Only add a description body if it provides clarity beyond what the title already says (e.g., when Electron's adaptation is non-obvious). For simple renames, method additions, or straightforward API updates, the title + Ref link is sufficient.
Each change should have its own commit and its own Ref. Logically group into commits that make sense rather than one giant commit. You may include multiple "Ref" links if required.
IMPORTANT: Try really hard to find a reference. Each change you made should in theory have been in response to a change in Node.js. Check `git log` and `git blame` in the Node.js repo. Do not give up easily.
### For Patch Updates (patches/node/*.patch)
Use the same fixup workflow as Phase One and follow `references/phase-one-commit-guidelines.md` for the commit message format (`fix(patch):` prefix, topic style).
## Dependent Patch Header Updates
After any patch modification, check for other affected patches:
```bash
git status
# If other .patch files show as modified with only index, line number, and context changes:
git add patches/
git commit -m "chore: update patches (trivial only)"
```
## Finding References
Use `git log` or `git blame` on Node.js source files in `../third_party/electron_node`. Look for:
```
PR-URL: https://github.com/nodejs/node/pull/XXXXX
Refs: https://github.com/nodejs/node/issues/XXXXX
```
Note: Many Node.js patches in Electron are Electron-authored and won't have upstream `PR-URL:` lines. Check the patch's own commit message for `Refs:` lines, or use `git log` in the Node.js repo to find which upstream commit caused the build break.
If no reference found after searching: `Ref: Unable to locate reference`
## Example Commits
### Electron Source Fix (with upstream PR)
```
node#61898: src: stop using v8::PropertyCallbackInfo<T>::This()
Ref: https://github.com/nodejs/node/pull/61898
Co-Authored-By: <AI model attribution>
```
### Electron Source Fix (with issue reference, no PR)
```
fix: adapt to v8::PropertyCallbackInfo<T>::This() removal
Updated NodeBindings to use HolderV2() after upstream Node.js
stopped using the deprecated This() API.
Ref: https://github.com/nodejs/node/issues/60616
Co-Authored-By: <AI model attribution>
```

View File

@@ -35,7 +35,7 @@
"ms-vscode.cpptools",
"mutantdino.resourcemonitor",
"dsanders11.vscode-electron-build-tools",
"dbaeumer.vscode-eslint",
"oxc.oxc-vscode",
"shakram02.bash-beautify",
"marshallofsound.gnls-electron"
],

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:424eedbf277ad9749ffa9219068aa72ed4a5e373
image: ghcr.io/electron/devcontainer:eac3529546ea8f3aa356d31e345715eef342233b
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -48,7 +48,8 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
\"gen\": {
\"args\": [
\"import(\\\"//electron/build/args/testing.gn\\\")\",
\"use_remoteexec = true\"
\"use_remoteexec = true\",
\"use_siso=true\"
],
\"out\": \"Testing\"
},
@@ -58,13 +59,13 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
},
\"\$schema\": \"file:///home/builduser/.electron_build_tools/evm-config.schema.json\",
\"configValidationLevel\": \"strict\",
\"reclient\": \"$1\",
\"preserveXcode\": 5
\"remoteBuild\": \"siso\",
\"preserveSDK\": 5
}
" >$buildtools/configs/evm.testing.json
}
write_config remote_exec
write_config
e use testing
else

View File

@@ -1,79 +0,0 @@
{
"root": true,
"extends": "standard",
"parser": "@typescript-eslint/parser",
"plugins": ["@typescript-eslint"],
"env": {
"browser": true
},
"rules": {
"semi": ["error", "always"],
"no-var": "error",
"no-unused-vars": "off",
"guard-for-in": "error",
"@typescript-eslint/no-unused-vars": ["error", {
"vars": "all",
"args": "after-used",
"ignoreRestSiblings": true
}],
"prefer-const": ["error", {
"destructuring": "all"
}],
"n/no-callback-literal": "off",
"import/newline-after-import": "error",
"import/order": ["error", {
"alphabetize": {
"order": "asc"
},
"newlines-between": "always",
"pathGroups": [
{
"pattern": "@electron/internal/**",
"group": "external",
"position": "before"
},
{
"pattern": "@electron/**",
"group": "external",
"position": "before"
},
{
"pattern": "{electron,electron/**}",
"group": "external",
"position": "before"
}
],
"pathGroupsExcludedImportTypes": [],
"distinctGroup": true,
"groups": [
"external",
"builtin",
["sibling", "parent"],
"index",
"type"
]
}]
},
"parserOptions": {
"ecmaVersion": 6,
"sourceType": "module"
},
"overrides": [
{
"files": "*.ts",
"rules": {
"no-undef": "off",
"no-redeclare": "off",
"@typescript-eslint/no-redeclare": ["error"],
"no-use-before-define": "off"
}
},
{
"files": "*.d.ts",
"rules": {
"no-useless-constructor": "off",
"@typescript-eslint/no-unused-vars": "off"
}
}
]
}

1
.github/CODEOWNERS vendored
View File

@@ -19,6 +19,7 @@ DEPS @electron/wg-upgrades
/lib/renderer/security-warnings.ts @electron/wg-security
# Infra WG
/.claude/ @electron/wg-infra
/.github/actions/ @electron/wg-infra
/.github/workflows/*-publish.yml @electron/wg-infra
/.github/workflows/build.yml @electron/wg-infra

View File

@@ -58,6 +58,16 @@ body:
label: Last Known Working Electron version
description: What is the last version of Electron this worked in, if applicable?
placeholder: 16.0.0
- type: dropdown
attributes:
label: Does the issue also appear in Chromium / Google Chrome?
description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
options:
- I don't know how to test
- "Yes"
- "No"
validations:
required: true
- type: textarea
attributes:
label: Expected Behavior

View File

@@ -1,14 +0,0 @@
name: Maintainer Issue (not for public use)
description: Only to be created by Electron maintainers
body:
- type: checkboxes
attributes:
label: Confirmation
options:
- label: I am a [maintainer](https://github.com/orgs/electron/people) of the Electron project. (If not, please create a [different issue type](https://github.com/electron/electron/issues/new/).)
required: true
- type: textarea
attributes:
label: Description
validations:
required: true

View File

@@ -5,12 +5,18 @@ Thank you for your Pull Request. Please provide a description above and review
the requirements below.
Contributors guide: https://github.com/electron/electron/blob/main/CONTRIBUTING.md
Using a coding agent / AI? Read the policy: https://github.com/electron/governance/blob/main/policy/ai.md
NOTE: PRs submitted that do not follow this template will be automatically closed.
-->
#### Checklist
<!-- Remove items that do not apply. For completed items, change [ ] to [x]. -->
- [ ] PR description included and stakeholders cc'd
- [ ] I have built and tested this change
- [ ] I have filled out the PR description
- [ ] [I have reviewed and verified the changes](https://github.com/electron/governance/blob/main/policy/ai.md)
- [ ] `npm test` passes
- [ ] tests are [changed or added](https://github.com/electron/electron/blob/main/docs/development/testing.md)
- [ ] relevant API documentation, tutorials, and examples are updated and follow the [documentation style guide](https://github.com/electron/electron/blob/main/docs/development/style-guide.md)

View File

@@ -17,9 +17,6 @@ inputs:
is-release:
description: 'Is release build'
required: true
strip-binaries:
description: 'Strip binaries (Linux only)'
required: false
generate-symbols:
description: 'Generate symbols'
required: true
@@ -29,6 +26,9 @@ inputs:
is-asan:
description: 'The ASan Linux build'
required: false
upload-out-gen-artifacts:
description: 'Whether to upload the out/${dir}/gen artifacts'
required: false
runs:
using: "composite"
steps:
@@ -38,7 +38,27 @@ runs:
run: |
GN_APPENDED_ARGS="$GN_EXTRA_ARGS target_cpu=\"x64\" v8_snapshot_toolchain=\"//build/toolchain/mac:clang_x64\""
echo "GN_EXTRA_ARGS=$GN_APPENDED_ARGS" >> $GITHUB_ENV
- name: Set GN_EXTRA_ARGS for Windows
shell: bash
if: ${{inputs.target-arch != 'x64' && inputs.target-platform == 'win' }}
run: |
GN_APPENDED_ARGS="$GN_EXTRA_ARGS target_cpu=\"${{ inputs.target-arch }}\""
echo "GN_EXTRA_ARGS=$GN_APPENDED_ARGS" >> $GITHUB_ENV
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Download previous object checksums
shell: bash
if: ${{ (github.event_name == 'push' || github.event_name == 'pull_request') && inputs.is-asan != 'true' }}
env:
GITHUB_TOKEN: ${{ github.token }}
ARTIFACT_NAME: object-checksums.${{ inputs.artifact-platform }}_${{ inputs.target-arch }}.json
SEARCH_BRANCH: ${{ case(github.event_name == 'push', github.ref_name, github.event.pull_request.base.ref) }}
REPO: ${{ github.repository }}
OUTPUT_PATH: src/previous-object-checksums.json
run: node src/electron/.github/actions/build-electron/download-previous-object-checksums.mjs
- name: Build Electron ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
rm -rf "src/out/Default/Electron Framework.framework"
@@ -54,22 +74,80 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build -j $NUMBER_OF_NINJA_PROCESSES
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Strip Electron Binaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.strip-binaries == 'true' }}
# Build stats and object checksums
BUILD_STATS_ARGS="out/Default/siso.INFO --out-dir out/Default --output-object-checksums object-checksums.${{ inputs.artifact-platform }}_${{ inputs.target-arch }}.json"
if [ -f previous-object-checksums.json ]; then
BUILD_STATS_ARGS="$BUILD_STATS_ARGS --input-object-checksums previous-object-checksums.json"
fi
if ! [ -z "$DD_API_KEY" ]; then
BUILD_STATS_ARGS="$BUILD_STATS_ARGS --upload-stats"
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
node electron/script/build-stats.mjs $BUILD_STATS_ARGS || true
- name: Build Electron (Windows) ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
cd src
electron/script/copy-debug-symbols.py --target-cpu="${{ inputs.target-arch }}" --out-dir=out/Default/debug --compress
electron/script/strip-binaries.py --target-cpu="${{ inputs.target-arch }}" --verbose
electron/script/add-debug-link.py --target-cpu="${{ inputs.target-arch }}" --debug-dir=out/Default/debug
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
cd src\electron
git pack-refs
cd ..
# Pre-create the ThinLTO cache directory so lld-link does not need to
# call CreateDirectoryW through the bindflt filter driver, which can
# return ERROR_INVALID_PARAMETER under concurrent I/O on ARC runners.
# Discover the path from GN instead of hardcoding it so we stay in
# sync with `cache_dir` in build/config/compiler/BUILD.gn; skip the
# pre-create when ThinLTO is disabled (non-official builds).
$env:ELECTRON_DEPOT_TOOLS_DISABLE_LOG = "1"
$ltoFlag = e d gn desc out/Default //electron:electron_app ldflags 2>$null |
Select-String -Pattern '^/lldltocache:(.+)$' |
Select-Object -First 1
if ($ltoFlag) {
$cachePath = Join-Path 'out\Default' $ltoFlag.Matches[0].Groups[1].Value
New-Item -ItemType Directory -Force -Path $cachePath | Out-Null
}
$env:NINJA_SUMMARIZE_BUILD = 1
if ("${{ inputs.is-release }}" -eq "true") {
e build --target electron:release_build
} else {
e build --target electron:testing_build
}
if ($LASTEXITCODE -ne 0) {
Write-Host "e build failed with exit code $LASTEXITCODE"
exit $LASTEXITCODE
}
Copy-Item out\Default\.ninja_log out\electron_ninja_log
node electron\script\check-symlinks.js
# Build stats and object checksums
$statsArgs = @("out\Default\siso.exe.INFO", "--out-dir", "out\Default", "--output-object-checksums", "object-checksums.${{ inputs.artifact-platform }}_${{ inputs.target-arch }}.json")
if (Test-Path previous-object-checksums.json) {
$statsArgs += @("--input-object-checksums", "previous-object-checksums.json")
}
if ($env:DD_API_KEY) {
$statsArgs += "--upload-stats"
} else {
Write-Host "Skipping build-stats.mjs upload because DD_API_KEY is not set"
}
try {
& node electron\script\build-stats.mjs @statsArgs ; $LASTEXITCODE = 0
} catch {
Write-Host "Build stats failed, continuing..."
}
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip -j $NUMBER_OF_NINJA_PROCESSES -d explain
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
@@ -77,11 +155,10 @@ runs:
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot -j $NUMBER_OF_NINJA_PROCESSES
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
@@ -90,21 +167,10 @@ runs:
fi
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--reorder-builtins/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--warn-about-builtin-profile-data/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--abort-on-bad-builtin-profile-data/d' out/Default/mksnapshot_args
if [ "${{ inputs.target-platform }}" = "linux" ]; then
if [ "${{ inputs.target-arch }}" = "arm" ]; then
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x86_v8_arm/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x86_v8_arm/v8_context_snapshot_generator
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x64_v8_arm64/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x64_v8_arm64/v8_context_snapshot_generator
else
electron/script/strip-binaries.py --file $PWD/out/Default/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/v8_context_snapshot_generator
fi
fi
e build --target electron:electron_mksnapshot_zip -j $NUMBER_OF_NINJA_PROCESSES
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
@@ -138,13 +204,15 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:electron_chromedriver_zip
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:node_headers
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
target_os="${target_os}_mas"
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
@@ -164,17 +232,11 @@ runs:
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -185,29 +247,31 @@ runs:
if: ${{ inputs.is-release == 'true' }}
run: |
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg -j $NUMBER_OF_NINJA_PROCESSES
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
# Reuse the hermetic mac_sdk_path that `e build` wrote for out/Default so
# out/ffmpeg builds against the same SDK instead of the runner's system Xcode.
# The path has to live under root_build_dir, so copy the symlink tree and
# rewrite Default -> ffmpeg.
MAC_SDK_ARG=""
if [ "$(uname)" = "Darwin" ]; then
mkdir -p out/ffmpeg
cp -a out/Default/xcode_links out/ffmpeg/
MAC_SDK_ARG=$(sed -n 's|^\(mac_sdk_path = "//out/\)Default/|\1ffmpeg/|p' out/Default/args.gn)
fi
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $MAC_SDK_ARG $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Remove Clang problem matcher
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip -j $NUMBER_OF_NINJA_PROCESSES
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:libcxxabi_headers_zip -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:libcxx_objects_zip -j $NUMBER_OF_NINJA_PROCESSES
run: echo "::remove-matcher owner=clang::"
- name: Generate TypeScript Definitions ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -218,7 +282,34 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash
run: |
cd src
e d siso report -C out/Default > siso_report.txt
SISO_REPORT_PATH=$(grep -o '/.*siso-report-[^ ]*' siso_report.txt)
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH" >> $GITHUB_ENV
cat siso_report.txt
echo "SISO REPORT AT $SISO_REPORT_PATH"
- name: Generate siso report (Windows)
if: ${{ inputs.target-platform == 'win' && !cancelled() }}
shell: powershell
run: |
cd src
e d siso report -C out\Default > siso_report.txt
$SISO_REPORT_PATH = Get-Content "siso_report.txt" | Select-String "report file:\s*(.+)" | ForEach-Object {
$_.Matches.Groups[1].Value.Trim()
}
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH"
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH" >> $env:GITHUB_ENV
- name: Generate Artifact Key
if: always() && !cancelled()
shell: bash
run: |
if [ "${{ inputs.is-asan }}" = "true" ]; then
@@ -230,15 +321,30 @@ runs:
# The current generated_artifacts_<< artifact.key >> name was taken from CircleCI
# to ensure we don't break anything, but we may be able to improve that.
- name: Move all Generated Artifacts to Upload Folder ${{ inputs.step-suffix }}
if: always() && !cancelled()
shell: bash
run: ./src/electron/script/actions/move-artifacts.sh
- name: Upload Generated Artifacts ${{ inputs.step-suffix }}
uses: actions/upload-artifact@65462800fd760344b1a7b4382951275a0abb4808
if: always() && !cancelled()
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
- name: Upload Src Artifacts ${{ inputs.step-suffix }}
uses: actions/upload-artifact@65462800fd760344b1a7b4382951275a0abb4808
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
- name: Upload Out Gen Artifacts ${{ inputs.step-suffix }}
if: ${{ inputs.upload-out-gen-artifacts == 'true' }}
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: out_gen_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src/out/Default/gen
- name: Upload Object Checksums ${{ inputs.step-suffix }}
if: ${{ always() && !cancelled() && inputs.is-asan != 'true' }}
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f # v7.0.0
with:
name: object_checksums_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
path: ./src/object-checksums.${{ inputs.artifact-platform }}_${{ inputs.target-arch }}.json
archive: false

View File

@@ -0,0 +1,82 @@
import { Octokit } from '@octokit/rest';
import { writeFileSync } from 'node:fs';
const token = process.env.GITHUB_TOKEN;
const repo = process.env.REPO;
const artifactName = process.env.ARTIFACT_NAME;
const branch = process.env.SEARCH_BRANCH;
const outputPath = process.env.OUTPUT_PATH;
const required = { GITHUB_TOKEN: token, REPO: repo, ARTIFACT_NAME: artifactName, SEARCH_BRANCH: branch, OUTPUT_PATH: outputPath };
const missing = Object.entries(required).filter(([, v]) => !v).map(([k]) => k);
if (missing.length > 0) {
console.error(`Missing required environment variables: ${missing.join(', ')}`);
process.exit(1);
}
const [owner, repoName] = repo.split('/');
const octokit = new Octokit({ auth: token });
async function main () {
console.log(`Searching for artifact '${artifactName}' on branch '${branch}'...`);
// Resolve the "Build" workflow name to an ID, mirroring how `gh run list --workflow` works
// under the hood (it uses /repos/{owner}/{repo}/actions/workflows/{id}/runs).
const { data: workflows } = await octokit.actions.listRepoWorkflows({ owner, repo: repoName });
const buildWorkflow = workflows.workflows.find((w) => w.name === 'Build');
if (!buildWorkflow) {
console.log('Could not find "Build" workflow, continuing without previous checksums');
return;
}
const { data: runs } = await octokit.actions.listWorkflowRuns({
owner,
repo: repoName,
workflow_id: buildWorkflow.id,
branch,
status: 'completed',
event: 'push',
per_page: 20,
exclude_pull_requests: true
});
for (const run of runs.workflow_runs) {
const { data: artifacts } = await octokit.actions.listWorkflowRunArtifacts({
owner,
repo: repoName,
run_id: run.id,
name: artifactName
});
if (artifacts.artifacts.length > 0) {
const artifact = artifacts.artifacts[0];
console.log(`Found artifact in run ${run.id} (artifact ID: ${artifact.id}), downloading...`);
// Non-archived artifacts are still downloaded from the /zip endpoint
const response = await octokit.actions.downloadArtifact({
owner,
repo: repoName,
artifact_id: artifact.id,
archive_format: 'zip'
});
if (response.headers['content-type'] !== 'application/json') {
console.error(`Unexpected content type for artifact download: ${response.headers['content-type']}`);
console.error('Expected application/json, continuing without previous checksums');
return;
}
writeFileSync(outputPath, JSON.stringify(response.data));
console.log('Downloaded previous object checksums successfully');
return;
}
}
console.log(`No previous object checksums found in last ${runs.workflow_runs.length} runs, continuing without them`);
}
main().catch((err) => {
console.error('Failed to download previous object checksums, continuing without them:', err.message);
process.exit(0);
});

View File

@@ -0,0 +1,83 @@
name: 'Build Git Cache'
description: 'Runs a gclient sync to build the git cache for Electron'
inputs:
target-platform:
description: 'Target platform, should be linux, win, macos'
runs:
using: "composite"
steps:
- name: Set GIT_CACHE_PATH to make gclient to use the cache
shell: bash
run: |
echo "GIT_CACHE_PATH=$(pwd)/git-cache" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Set up cache drive
shell: bash
run: |
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "CACHE_DRIVE=/mnt/win-cache" >> $GITHUB_ENV
else
echo "CACHE_DRIVE=/mnt/cross-instance-cache" >> $GITHUB_ENV
fi
- name: Check cross instance cache disk space
shell: bash
run: |
# if there is less than 35 GB free space then creating the cache might fail so exit early
freespace=`df -m $CACHE_DRIVE | grep -w $CACHE_DRIVE | awk '{print $4}'`
freespace_human=`df -h $CACHE_DRIVE | grep -w $CACHE_DRIVE | awk '{print $4}'`
if [ $freespace -le 35000 ]; then
echo "The cross mount cache has $freespace_human free space which is not enough - exiting"
exit 1
else
echo "The cross mount cache has $freespace_human free space - continuing"
fi
- name: Restore gitcache
shell: bash
run: |
GIT_CACHE_TAR="$CACHE_DRIVE/gitcache.tar"
if [ ! -f "$GIT_CACHE_TAR" ]; then
echo "Git cache tar file does not exist, skipping restore"
exit 0
fi
echo "Restoring git cache from $GIT_CACHE_TAR to $GIT_CACHE_PATH"
mkdir -p $GIT_CACHE_PATH
tar -xf $GIT_CACHE_TAR -C $GIT_CACHE_PATH
- name: Gclient Sync
shell: bash
run: |
e d gclient config \
--name "src/electron" \
--unmanaged \
${GCLIENT_EXTRA_ARGS} \
"$GITHUB_SERVER_URL/$GITHUB_REPOSITORY"
if [ "$TARGET_OS" != "" ]; then
echo "target_os=['$TARGET_OS']" >> ./.gclient
fi
ELECTRON_USE_THREE_WAY_MERGE_FOR_PATCHES=1 e d gclient sync --with_branch_heads --with_tags --nohooks -vv
- name: Compress Git Cache Directory
shell: bash
run: |
echo "Uncompressed gitcache size: $(du -sh $GIT_CACHE_PATH | cut -f1 -d' ')"
cd $GIT_CACHE_PATH
tar -cf ../gitcache.tar .
cd ..
echo "Compressed gitcache to $(du -sh gitcache.tar | cut -f1 -d' ')"
# remove the old cache file if it exists
if [ -f $CACHE_DRIVE/gitcache.tar ]; then
echo "Removing old gitcache.tar from $CACHE_DRIVE"
rm $CACHE_DRIVE/gitcache.tar
fi
cp ./gitcache.tar $CACHE_DRIVE/
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done

View File

@@ -0,0 +1,24 @@
name: 'Build Image SHA'
description: 'Single source of truth for the ghcr.io/electron/build image SHA'
inputs:
override:
description: 'Optional override SHA (e.g. from a workflow_dispatch input)'
required: false
default: ''
outputs:
build-image-sha:
description: 'The electron/build image SHA to use'
value: ${{ steps.set.outputs.build-image-sha }}
runs:
using: 'composite'
steps:
- id: set
shell: bash
env:
OVERRIDE: ${{ inputs.override }}
run: |
if [ -n "$OVERRIDE" ]; then
echo "build-image-sha=$OVERRIDE" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=daad061f4b99a0ae1c841be4aa09188280a9c8a4" >> "$GITHUB_OUTPUT"
fi

View File

@@ -28,7 +28,7 @@ runs:
shell: bash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH="v1-src-cache-$(cat src/electron/.depshash)"
DEPSHASH="v2-src-cache-$(cat src/electron/.depshash)"
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_FILE=$DEPSHASH.tar" >> $GITHUB_ENV
if [ "${{ inputs.target-platform }}" = "win" ]; then
@@ -40,10 +40,10 @@ runs:
if: ${{ inputs.generate-sas-token == 'true' }}
shell: bash
run: |
curl --unix-socket /var/run/sas/sas.sock --fail "http://foo/$CACHE_FILE?platform=${{ inputs.target-platform }}" > sas-token
curl --unix-socket /var/run/sas/sas.sock --fail "http://foo/$CACHE_FILE?platform=${{ inputs.target-platform }}&getAccountName=true" > sas-token
- name: Save SAS Key
if: ${{ inputs.generate-sas-token == 'true' }}
uses: actions/cache/save@d4323d4df104b026a6aa633fdb11d772146be0bf
uses: actions/cache/save@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
with:
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-${{ github.run_attempt }}
@@ -80,6 +80,21 @@ runs:
else
echo "The cross mount cache has $freespace_human free space - continuing"
fi
- name: Add patch conflict problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/patch-conflict.json"
- name: Restore gitcache
if: steps.check-cache.outputs.cache_exists == 'false'
shell: bash
run: |
GIT_CACHE_TAR="$CACHE_DRIVE/gitcache.tar"
if [ ! -f "$GIT_CACHE_TAR" ]; then
echo "Git cache tar file does not exist, skipping restore"
exit 0
fi
echo "Restoring git cache from $GIT_CACHE_TAR to $GIT_CACHE_PATH"
mkdir -p $GIT_CACHE_PATH
tar -xf $GIT_CACHE_TAR -C $GIT_CACHE_PATH
- name: Gclient Sync
if: steps.check-cache.outputs.cache_exists == 'false'
shell: bash
@@ -94,7 +109,7 @@ runs:
echo "target_os=['$TARGET_OS']" >> ./.gclient
fi
ELECTRON_USE_THREE_WAY_MERGE_FOR_PATCHES=1 e d gclient sync --with_branch_heads --with_tags -vv
ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=0 DEPOT_TOOLS_WIN_TOOLCHAIN=0 ELECTRON_USE_THREE_WAY_MERGE_FOR_PATCHES=1 e d gclient sync --with_branch_heads --with_tags
if [[ "${{ inputs.is-release }}" != "true" ]]; then
# Re-export all the patches to check if there were changes.
python3 src/electron/script/export_all_patches.py src/electron/patches/config.json
@@ -102,12 +117,7 @@ runs:
git update-index --refresh || true
if ! git diff-index --quiet HEAD --; then
# There are changes to the patches. Make a git commit with the updated patches
git add patches
GIT_COMMITTER_NAME="PatchUp" GIT_COMMITTER_EMAIL="73610968+patchup[bot]@users.noreply.github.com" git commit -m "chore: update patches" --author="PatchUp <73610968+patchup[bot]@users.noreply.github.com>"
# Export it
mkdir -p ../../patches
git format-patch -1 --stdout --keep-subject --no-stat --full-index > ../../patches/update-patches.patch
if node ./script/push-patch.js; then
if node ./script/patch-up.js; then
echo
echo "======================================================================"
echo "Changes to the patches when applying, we have auto-pushed the diff to the current branch"
@@ -115,6 +125,11 @@ runs:
echo "======================================================================"
exit 1
else
git add patches
GIT_COMMITTER_NAME="PatchUp" GIT_COMMITTER_EMAIL="73610968+patchup[bot]@users.noreply.github.com" git commit -m "chore: update patches" --author="PatchUp <73610968+patchup[bot]@users.noreply.github.com>"
# Export it
mkdir -p ../../patches
git format-patch -1 --stdout --keep-subject --no-stat --full-index > ../../patches/update-patches.patch
echo
echo "======================================================================"
echo "There were changes to the patches when applying."
@@ -128,7 +143,17 @@ runs:
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD
@@ -148,7 +173,6 @@ runs:
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src
@@ -163,21 +187,35 @@ runs:
shell: bash
run: |
echo "Uncompressed src size: $(du -sh src | cut -f1 -d' ')"
tar -cf $CACHE_FILE src
# Named .tar but zstd-compressed; the sas-sidecar's filename allowlist
# only permits .tar/.tgz so we keep the extension and decode on restore.
tar -cf - src | zstd -T0 --long=30 -f -o $CACHE_FILE
echo "Compressed src to $(du -sh $CACHE_FILE | cut -f1 -d' ')"
cp ./$CACHE_FILE $CACHE_DRIVE/
- name: Persist Src Cache
if: ${{ steps.check-cache.outputs.cache_exists == 'false' && inputs.use-cache == 'true' }}
shell: bash
run: |
final_cache_path=$CACHE_DRIVE/$CACHE_FILE
# Upload to a run-unique temp name first so concurrent readers never
# observe a partially-written file, and an interrupted copy can't leave
# a truncated file at the final path. Orphaned temp files get swept by
# the clean-orphaned-cache-uploads workflow.
tmp_cache_path=$final_cache_path.upload-${GITHUB_RUN_ID}-${GITHUB_RUN_ATTEMPT}
echo "Uploading to temp path: $tmp_cache_path"
cp ./$CACHE_FILE $tmp_cache_path
echo "Using cache key: $DEPSHASH"
echo "Checking path: $final_cache_path"
if [ -f "$final_cache_path" ]; then
echo "Cache already persisted at $final_cache_path by a concurrent run; discarding ours"
rm -f $tmp_cache_path
else
mv -f $tmp_cache_path $final_cache_path
echo "Cache key persisted in $final_cache_path"
fi
if [ ! -f "$final_cache_path" ]; then
echo "Cache key not found"
exit 1
else
echo "Cache key persisted in $final_cache_path"
fi
- name: Wait for active SSH sessions
shell: bash

View File

@@ -14,27 +14,58 @@ inputs:
description: 'Target platform, should be linux, win, macos'
package:
description: 'Package to install'
dependency-version:
description: 'Version of the dependency to install'
default: ''
runs:
using: "composite"
steps:
- name: Delete wrong ${{ inputs.dependency }}
shell: bash
env:
CIPD_ROOT_PREFIX: ${{ inputs.cipd-root-prefix-path }}
INSTALLATION_DIR: ${{ inputs.installation-dir }}
run : |
rm -rf ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }}
rm -rf "${CIPD_ROOT_PREFIX}${INSTALLATION_DIR}"
- name: Create ensure file for ${{ inputs.dependency }}
if: ${{ inputs.dependency-version == '' }}
shell: bash
env:
PACKAGE: ${{ inputs.package }}
DEPS_FILE: ${{ inputs.deps-file }}
INSTALLATION_DIR: ${{ inputs.installation-dir }}
DEPENDENCY: ${{ inputs.dependency }}
run: |
echo '${{ inputs.package }}' `e d gclient getdep --deps-file=${{ inputs.deps-file }} -r '${{ inputs.installation-dir }}:${{ inputs.package }}'` > ${{ inputs.dependency }}_ensure_file
cat ${{ inputs.dependency }}_ensure_file
echo "$PACKAGE" $(e d gclient getdep --deps-file="$DEPS_FILE" -r "${INSTALLATION_DIR}:${PACKAGE}") > "${DEPENDENCY}_ensure_file"
cat "${DEPENDENCY}_ensure_file"
- name: Create ensure file for ${{ inputs.dependency }} from dependency-version
if: ${{ inputs.dependency-version != '' }}
shell: bash
env:
PACKAGE: ${{ inputs.package }}
DEPENDENCY_VERSION: ${{ inputs.dependency-version }}
DEPENDENCY: ${{ inputs.dependency }}
run: |
echo "$PACKAGE $DEPENDENCY_VERSION" > "${DEPENDENCY}_ensure_file"
cat "${DEPENDENCY}_ensure_file"
- name: CIPD installation of ${{ inputs.dependency }} (macOS)
if: ${{ inputs.target-platform == 'macos' }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
env:
CIPD_ROOT_PREFIX: ${{ inputs.cipd-root-prefix-path }}
INSTALLATION_DIR: ${{ inputs.installation-dir }}
DEPENDENCY: ${{ inputs.dependency }}
run: |
echo "ensuring ${{ inputs.dependency }} on macOS"
e d cipd ensure --root ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }} -ensure-file ${{ inputs.dependency }}_ensure_file
echo "ensuring $DEPENDENCY"
e d cipd ensure --root "${CIPD_ROOT_PREFIX}${INSTALLATION_DIR}" -ensure-file "${DEPENDENCY}_ensure_file"
- name: CIPD installation of ${{ inputs.dependency }} (Windows)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
env:
CIPD_ROOT_PREFIX: ${{ inputs.cipd-root-prefix-path }}
INSTALLATION_DIR: ${{ inputs.installation-dir }}
DEPENDENCY: ${{ inputs.dependency }}
run: |
echo "ensuring ${{ inputs.dependency }} on Windows"
e d cipd ensure --root ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }} -ensure-file ${{ inputs.dependency }}_ensure_file
echo "ensuring $env:DEPENDENCY on Windows"
e d cipd ensure --root "$env:CIPD_ROOT_PREFIX$env:INSTALLATION_DIR" -ensure-file "$($env:DEPENDENCY)_ensure_file"

View File

@@ -19,12 +19,17 @@ inputs:
runs:
using: "composite"
steps:
- name: Fix clang
- name: Fix llvm toolchain
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
rm -rf src/third_party/llvm-build
python3 src/tools/clang/scripts/update.py
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6667681
python3 src/tools/clang/scripts/update.py --package objdump
python3 src/tools/clang/scripts/update.py --package clang-tidy
- name: Fix esbuild
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
@@ -33,7 +38,24 @@ runs:
installation-dir: third_party/esbuild
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/esbuild/${platform}
- name: Fix rollup
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
dependency: rollup_libs
deps-file: src/third_party/devtools-frontend/src/DEPS
installation-dir: third_party/rollup_libs
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/rollup_libs/${platform}
- name: Sync native rollup libs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/devtools-frontend/src
python3 scripts/deps/sync_rollup_libs.py
- name: Fix rustc
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
rm -rf src/third_party/rust-toolchain
@@ -57,6 +79,7 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: gn/gn/windows-amd64
- name: Fix reclient
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: reclient
@@ -65,6 +88,7 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: infra/rbe/client/${platform}
- name: Configure reclient configs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
python3 src/buildtools/reclient_cfgs/configure_reclient_cfgs.py --rbe_instance "projects/rbe-chrome-untrusted/instances/default_instance" --reproxy_cfg_template reproxy.cfg.template --rewrapper_cfg_project "" --skip_remoteexec_cfg_fetch
@@ -82,6 +106,7 @@ runs:
python3 src/third_party/depot_tools/download_from_google_storage.py --no_resume --no_auth --bucket chromium-browser-clang -s $DSYM_SHA_FILE -o src/tools/clang/dsymutil/bin/dsymutil
fi
- name: Fix ninja
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: ninja
@@ -90,15 +115,25 @@ runs:
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/ninja/${platform}
- name: Set ninja in path
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
echo "$(pwd)/src/third_party/ninja" >> $GITHUB_PATH
- name: Fix siso
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: siso
deps-file: src/DEPS
installation-dir: src/third_party/siso/cipd
target-platform: ${{ inputs.target-platform }}
package: build/siso/${platform}
- name: Fixup angle git
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/angle
rm -f .git/objects/info/alternates
git remote set-url origin https://chromium.googlesource.com/angle/angle.git
git remote set-url origin https://github.com/google/angle.git
cp .git/config .git/config.backup
git remote remove origin
mv .git/config.backup .git/config

View File

@@ -6,6 +6,8 @@ runs:
- name: Free Space on MacOS
shell: bash
run: |
echo "Disk usage before cleanup:"
df -h
sudo mkdir -p $TMPDIR/del-target
tmpify() {
@@ -15,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -57,9 +61,31 @@ runs:
sudo rm -rf $TMPDIR/del-target
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
sudo mdutil -a -i off

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -11,15 +11,22 @@ runs:
git config --global core.autocrlf false
git config --global branch.autosetuprebase always
git config --global core.fscache true
git config --global core.longpaths true
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=6e8526315ea3b4828882497e532b8340e64e053c
export BUILD_TOOLS_SHA=1b7bd25dae4a780bb3170fff56c9327b53aaf7eb
npm i -g @electron/build-tools
# Update depot_tools to ensure python
e d update_depot_tools
e auto-update disable
# Disable further updates of depot_tools
e d auto-update disable
if [ "$(expr substr $(uname -s) 1 10)" == "MSYS_NT-10" ]; then
e d cipd.bat --version
cp "C:\Python311\python.exe" "C:\Python311\python3.exe"
echo "C:\Users\ContainerAdministrator\.electron_build_tools\third_party\depot_tools" >> $GITHUB_PATH
else
echo "$HOME/.electron_build_tools/third_party/depot_tools" >> $GITHUB_PATH
echo "$HOME/.electron_build_tools/third_party/depot_tools/python-bin" >> $GITHUB_PATH
fi
echo "$HOME/.electron_build_tools/third_party/depot_tools" >> $GITHUB_PATH
echo "$HOME/.electron_build_tools/third_party/depot_tools/python-bin" >> $GITHUB_PATH

View File

@@ -6,8 +6,8 @@ runs:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn cache dir)" >> $GITHUB_OUTPUT
- uses: actions/cache@1bd1e32a3bdc45362d1e726936510720a7c30a57
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
id: yarn-cache
with:
path: ${{ steps.yarn-cache-dir-path.outputs.dir }}
@@ -18,4 +18,31 @@ runs:
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile --prefer-offline
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
ARCH=$(uname -m)
node script/yarn.js install --immutable --mode=skip-build
# if running on linux arm skip yarn Builds
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
else
# Pre-seed the node-gyp header cache so the parallel native-addon
# builds below don't race on a cold cache. Linux build containers
# already ship a warm cache (electron/build-images#68), so only do
# this on macOS / Windows runners.
if [ "$(uname -s)" != "Linux" ]; then
for i in 1 2 3; do
if node node_modules/node-gyp/bin/node-gyp.js install; then
break
fi
if [ "$i" = "3" ]; then
echo "node-gyp header pre-seed failed after 3 attempts" >&2
exit 1
fi
echo "node-gyp header pre-seed failed (attempt $i), retrying in 5s..." >&2
sleep 5
done
fi
node script/yarn.js install --immutable
fi

View File

@@ -31,7 +31,7 @@ runs:
fi
mkdir temp-cache
tar -xf $cache_path -C temp-cache
zstd -d --long=30 -c $cache_path | tar -xf - -C temp-cache
echo "Unzipped cache is $(du -sh temp-cache/src | cut -f1)"
if [ -d "temp-cache/src" ]; then

View File

@@ -8,14 +8,14 @@ runs:
steps:
- name: Obtain SAS Key
continue-on-error: true
uses: actions/cache/restore@d4323d4df104b026a6aa633fdb11d772146be0bf
uses: actions/cache/restore@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
with:
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-1
enableCrossOsArchive: true
- name: Obtain SAS Key
continue-on-error: true
uses: actions/cache/restore@d4323d4df104b026a6aa633fdb11d772146be0bf
uses: actions/cache/restore@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
with:
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-${{ github.run_attempt }}
@@ -24,7 +24,7 @@ runs:
# The cache will always exist here as a result of the checkout job
# Either it was uploaded to Azure in the checkout job for this commit
# or it was uploaded in the checkout job for a previous commit.
uses: nick-fields/retry@7152eba30c6575329ac0576536151aca5a72780e # v3.0.0
uses: nick-fields/retry@ad984534de44a9489a53aefd81eb77f87c70dc60 # v4.0.0
with:
timeout_minutes: 30
max_attempts: 3
@@ -32,22 +32,23 @@ runs:
shell: bash
command: |
sas_token=$(cat sas-token)
if [ -z $sas-token ]; then
if [ -z "$sas_token" ]; then
echo "SAS Token not found; exiting src cache download early..."
exit 1
else
sas_token=$(jq -r '.sasToken' sas-token)
account_name=$(jq -r '.accountName' sas-token)
if [ "${{ inputs.target-platform }}" = "win" ]; then
azcopy copy --log-level=ERROR \
"https://${{ env.AZURE_AKS_CACHE_STORAGE_ACCOUNT }}.file.core.windows.net/${{ env.AZURE_AKS_WIN_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
"https://$account_name.file.core.windows.net/${{ env.AZURE_AKS_WIN_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
else
azcopy copy --log-level=ERROR \
"https://${{ env.AZURE_AKS_CACHE_STORAGE_ACCOUNT }}.file.core.windows.net/${{ env.AZURE_AKS_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
"https://$account_name.file.core.windows.net/${{ env.AZURE_AKS_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
fi
fi
env:
AZURE_AKS_CACHE_STORAGE_ACCOUNT: f723719aa87a34622b5f7f3
AZURE_AKS_CACHE_SHARE_NAME: pvc-f6a4089f-b082-4bee-a3f9-c3e1c0c02d8f
AZURE_AKS_WIN_CACHE_SHARE_NAME: pvc-71dec4f2-0d44-4fd1-a2c3-add049d70bdf
AZURE_AKS_CACHE_SHARE_NAME: linux-cache
AZURE_AKS_WIN_CACHE_SHARE_NAME: windows-cache
- name: Clean SAS Key
shell: bash
run: rm -f sas-token
@@ -60,9 +61,9 @@ runs:
echo "Cache is empty - exiting"
exit 1
fi
mkdir temp-cache
tar -xf $DEPSHASH.tar -C temp-cache
zstd -d --long=30 -c $DEPSHASH.tar | tar -xf - -C temp-cache
echo "Unzipped cache is $(du -sh temp-cache/src | cut -f1)"
if [ -d "temp-cache/src" ]; then
@@ -84,23 +85,21 @@ runs:
- name: Unzip and Ensure Src Cache (Windows)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
shell: bash
run: |
$src_cache = "$env:DEPSHASH.tar"
$cache_size = $(Get-Item $src_cache).length
Write-Host "Downloaded cache is $cache_size"
if ($cache_size -eq 0) {
Write-Host "Cache is empty - exiting"
echo "Downloaded cache is $(du -sh $DEPSHASH.tar | cut -f1)"
if [ `du $DEPSHASH.tar | cut -f1` = "0" ]; then
echo "Cache is empty - exiting"
exit 1
}
fi
$TEMP_DIR=New-Item -ItemType Directory -Path temp-cache
$TEMP_DIR_PATH = $TEMP_DIR.FullName
C:\ProgramData\Chocolatey\bin\7z.exe -y x $src_cache -o"$TEMP_DIR_PATH"
mkdir temp-cache
zstd -d --long=30 -c $DEPSHASH.tar | tar -xf - -C temp-cache
rm -f $DEPSHASH.tar
- name: Move Src Cache (Windows)
if: ${{ inputs.target-platform == 'win' }}
uses: nick-fields/retry@7152eba30c6575329ac0576536151aca5a72780e # v3.0.0
uses: nick-fields/retry@ad984534de44a9489a53aefd81eb77f87c70dc60 # v4.0.0
with:
timeout_minutes: 30
max_attempts: 3
@@ -111,9 +110,6 @@ runs:
Write-Host "Relocating Cache"
Remove-Item -Recurse -Force src
Move-Item temp-cache\src src
Write-Host "Deleting zip file"
Remove-Item -Force $src_cache
}
if (-Not (Test-Path "src\third_party\blink")) {
Write-Host "Cache was not correctly restored - exiting"

View File

@@ -7,7 +7,7 @@ runs:
if: ${{ runner.os != 'Windows' }}
shell: bash
run: |
if [[ -z "${{ env.CHROMIUM_GIT_COOKIE }}" ]]; then
if [[ -z "$CHROMIUM_GIT_COOKIE" ]]; then
echo "CHROMIUM_GIT_COOKIE is not set - cannot authenticate."
exit 0
fi
@@ -18,9 +18,7 @@ runs:
git config --global http.cookiefile ~/.gitcookies
tr , \\t <<\__END__ >>~/.gitcookies
${{ env.CHROMIUM_GIT_COOKIE }}
__END__
echo "$CHROMIUM_GIT_COOKIE" | tr , \\t >>~/.gitcookies
eval 'set -o history' 2>/dev/null || unsetopt HIST_IGNORE_SPACE 2>/dev/null
RESPONSE=$(curl -s -b ~/.gitcookies https://chromium-review.googlesource.com/a/accounts/self)
@@ -42,7 +40,7 @@ runs:
)
git config --global http.cookiefile "%USERPROFILE%\.gitcookies"
powershell -noprofile -nologo -command Write-Output "${{ env.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}" >>"%USERPROFILE%\.gitcookies"
powershell -noprofile -nologo -command Write-Output $env:CHROMIUM_GIT_COOKIE_WINDOWS_STRING >>"%USERPROFILE%\.gitcookies"
curl -s -b "%USERPROFILE%\.gitcookies" https://chromium-review.googlesource.com/a/accounts/self > response.txt

20
.github/actions/ssh-debug/action.yml vendored Normal file
View File

@@ -0,0 +1,20 @@
name: Debug via SSH
description: Setup a SSH server with a tunnel to access it to debug via SSH.
inputs:
tunnel:
description: 'Enable SSH tunneling via cloudflared'
required: true
default: 'false'
timeout:
description: 'SSH session timeout in seconds'
required: false
type: number
default: 3600
runs:
using: composite
steps:
- run: $GITHUB_ACTION_PATH/setup-ssh.sh
shell: bash
env:
TUNNEL: ${{ inputs.tunnel }}
TIMEOUT: ${{ inputs.timeout }}

4
.github/actions/ssh-debug/bashrc vendored Normal file
View File

@@ -0,0 +1,4 @@
# If we're in an interactive SSH session and we're not already in tmux and there's no explicit SSH command, auto attach tmux
if [ -n "$SSH_TTY" ] && [ -z "$TMUX" ] && [ -z "$SSH_ORIGINAL_COMMAND" ]; then
exec tmux attach || exec tmux
fi

146
.github/actions/ssh-debug/setup-ssh.sh vendored Executable file
View File

@@ -0,0 +1,146 @@
#!/bin/bash -e
if [ "${TUNNEL}" != "true" ]; then
echo "SSH tunneling is disabled. Set enable-tunnel: true to enable remote access."
echo "Local SSH server would be available on localhost:2222 if this were a local environment."
exit 0
fi
echo ::group::Configuring Tunnel
echo "SSH tunneling enabled. Setting up remote access..."
EXTERNAL_DEPS="curl jq ssh-keygen"
for dep in $EXTERNAL_DEPS; do
if ! command -v "${dep}" > /dev/null 2>&1; then
echo "Command ${dep} not installed on the system!" >&2
exit 1
fi
done
cd "$GITHUB_ACTION_PATH"
bashrc_path=$(pwd)/bashrc
# Source `bashrc` to auto start tmux on SSH login.
if ! grep -q "${bashrc_path}" ~/.bash_profile; then
echo >> ~/.bash_profile # On macOS runner there's no newline at the end of the file
echo "source \"${bashrc_path}\"" >> ~/.bash_profile
fi
OS=$(uname -s | tr '[:upper:]' '[:lower:]')
ARCH=$(uname -m)
if [ "${ARCH}" = "x86_64" ]; then
ARCH="amd64"
elif [ "${ARCH}" = "aarch64" ]; then
ARCH="arm64"
fi
if [ "${OS}" = "darwin" ] && ! command -v tmux > /dev/null 2>&1; then
echo "Installing tmux..."
brew install tmux
fi
if [ "$OS" = "darwin" ]; then
cloudflared_url="https://github.com/cloudflare/cloudflared/releases/latest/download/cloudflared-${OS}-${ARCH}.tgz"
echo "Downloading \`cloudflared\` from <$cloudflared_url>..."
curl --location --silent --output cloudflared.tgz "${cloudflared_url}"
tar xf cloudflared.tgz
rm cloudflared.tgz
fi
chmod +x cloudflared
echo 'Creating SSH server key...'
ssh-keygen -q -f ssh_host_rsa_key -N ''
echo 'Creating SSH server config...'
sed "s,\$PWD,${PWD},;s,\$USER,${USER}," sshd_config.template > sshd_config
echo 'Starting SSH server...'
sudo /usr/sbin/sshd -f sshd_config -D &
sshd_pid=$!
echo "SSH server started successfully (PID: ${sshd_pid})"
echo 'Starting tmux session...'
(cd "${GITHUB_WORKSPACE}" && tmux new-session -d -s debug)
mkdir ~/.cloudflared
CLEAN_TUNNEL_CERT=$(printf '%s\n' "${CLOUDFLARE_TUNNEL_CERT}" | tr -d '\r' | sed '/^[[:space:]]*$/d')
echo "${CLEAN_TUNNEL_CERT}" > ~/.cloudflared/cert.pem
CLEAN_USER_CA_CERT=$(printf '%s\n' "${CLOUDFLARE_USER_CA_CERT}" | tr -d '\r' | sed '/^[[:space:]]*$/d')
echo "${CLEAN_USER_CA_CERT}" | sudo tee /etc/ssh/ca.pub > /dev/null
sudo chmod 644 /etc/ssh/ca.pub
random_suffix=$(openssl rand -hex 5 | cut -c1-10)
tunnel_name="${GITHUB_SHA}-${GITHUB_RUN_ID}-${random_suffix}"
tunnel_url="${tunnel_name}.${CLOUDFLARE_TUNNEL_HOSTNAME}"
if ./cloudflared tunnel list | grep -q "${tunnel_name}"; then
echo "Deleting existing tunnel: ${tunnel_name}"
./cloudflared tunnel delete ${tunnel_name}
fi
echo "Creating new cloudflare tunnel: ${tunnel_name}"
./cloudflared tunnel create ${tunnel_name}
credentials_file=$(find ~/.cloudflared -name "*.json" | head -n 1)
if [ -z "${credentials_file}" ]; then
echo "Error: Could not find tunnel credentials file"
exit 1
fi
echo "Found credentials file: ${credentials_file}"
echo 'Creating tunnel configuration...'
cat > tunnel_config.yml << EOF
tunnel: ${tunnel_name}
credentials-file: ${credentials_file}
ingress:
- hostname: ${tunnel_url}
service: ssh://localhost:2222
- service: http_status:404
EOF
echo 'Setting up DNS routing for tunnel...'
./cloudflared tunnel route dns ${tunnel_name} ${tunnel_url}
echo 'Running cloudflare tunnel...'
./cloudflared tunnel --no-autoupdate --config tunnel_config.yml run 2>&1 | tee cloudflared.log | sed -u 's/^/cloudflared: /' &
cloudflared_pid=$!
echo ::endgroup::
echo ::notice title=SSH Debug Session Ready::ssh ${tunnel_url}
(
echo ' '
echo ' '
echo '🔗 SSH Debug Session Ready!'
echo '━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━'
echo ' '
echo '📋 Infra WG can copy and run this command to connect:'
echo ' '
echo "ssh ${tunnel_url}"
echo ' '
echo "⏰ Session expires automatically in ${TIMEOUT} seconds"
echo '━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━'
echo ' '
echo ' '
) | cat
echo ::group::Starting Background Session
echo 'Starting SSH session in background...'
./ssh-session.sh "${sshd_pid}" "${cloudflared_pid}" "${TIMEOUT}" "${tunnel_name}" &
echo 'SSH session is running in background. GitHub Action will continue.'
echo 'Session will auto-cleanup after timeout or when processes end.'
echo ::endgroup::

52
.github/actions/ssh-debug/ssh-session.sh vendored Executable file
View File

@@ -0,0 +1,52 @@
#!/bin/bash
SSHD_PID=$1
CLOUDFLARED_PID=$2
SESSION_TIMEOUT=${3:-10000}
TUNNEL_NAME=$4
cleanup() {
# Kill processes.
for pid in "$SLEEP_PID" "$SSHD_PID" "$CLOUDFLARED_PID"; do
if [ -n "$pid" ] && kill -0 "$pid" 2>/dev/null; then
kill "$pid" 2>/dev/null || true
fi
done
# Clean up tunnel.
if [ -n "$TUNNEL_NAME" ]; then
cd "$GITHUB_ACTION_PATH"
./cloudflared tunnel delete "$TUNNEL_NAME" 2>/dev/null || {
echo "Failed to delete tunnel"
}
fi
echo "Session ended at $(date)"
exit 0
}
# Trap signals to ensure cleanup.
trap cleanup SIGTERM SIGINT SIGQUIT SIGHUP EXIT
# Wait for timeout or until processes die.
sleep "$SESSION_TIMEOUT" &
SLEEP_PID=$!
# Monitor processes
while kill -0 "$SLEEP_PID" 2>/dev/null; do
# Check SSH daemon.
if ! kill -0 "$SSHD_PID" 2>/dev/null; then
echo "SSH daemon died at $(date)"
break
fi
# Check cloudflared,
if ! kill -0 "$CLOUDFLARED_PID" 2>/dev/null; then
echo "Cloudflared died at $(date)"
break
fi
sleep 10
done
cleanup

View File

@@ -0,0 +1,25 @@
Port 2222
HostKey $PWD/ssh_host_rsa_key
PidFile $PWD/sshd.pid
# Connection settings
ClientAliveInterval 30
ClientAliveCountMax 10
MaxStartups 10
LoginGraceTime 120
# Allow TCP forwarding for tunneling
AllowTcpForwarding yes
# Try to prevent timeouts
TCPKeepAlive yes
# Security
TrustedUserCAKeys /etc/ssh/ca.pub
PubkeyAuthentication yes
PasswordAuthentication no
AuthorizedPrincipalsCommand /bin/bash -c "echo '%t %k' | ssh-keygen -L -f - | grep -A1 Principals"
AuthorizedPrincipalsCommandUser nobody
PubkeyAcceptedKeyTypes ssh-rsa,ssh-ed25519,ecdsa-sha2-nistp256,ecdsa-sha2-nistp384,ecdsa-sha2-nistp521,ssh-ed25519-cert-v01@openssh.com,ecdsa-sha2-nistp256-cert-v01@openssh.com,ecdsa-sha2-nistp384-cert-v01@openssh.com,ecdsa-sha2-nistp521-cert-v01@openssh.com,rsa-sha2-256-cert-v01@openssh.com,rsa-sha2-512-cert-v01@openssh.com

122
.github/copilot-instructions.md vendored Normal file
View File

@@ -0,0 +1,122 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

18
.github/problem-matchers/clang.json vendored Normal file
View File

@@ -0,0 +1,18 @@
{
"problemMatcher": [
{
"owner": "clang",
"fromPath": "src/out/Default/args.gn",
"pattern": [
{
"regexp": "^(.+)[(:](\\d+)[:,](\\d+)\\)?:\\s+(warning|fatal error|error):\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"severity": 4,
"message": 5
}
]
}
]
}

View File

@@ -0,0 +1,16 @@
{
"problemMatcher": [
{
"owner": "markdownlint",
"pattern": [
{
"regexp": "^(.+):(\\d+):(\\d+)\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"message": 4
}
]
}
]
}

View File

@@ -0,0 +1,34 @@
{
"problemMatcher": [
{
"owner": "merge-conflict",
"pattern": [
{
"regexp": "^CONFLICT\\s\\(\\S+\\): (Merge conflict in \\S+)$",
"message": 1
}
]
},
{
"owner": "patch-conflict",
"pattern": [
{
"regexp": "^error: (patch failed: (\\S+):(\\d+))$",
"message": 1,
"file": 2,
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

View File

@@ -0,0 +1,47 @@
From 85b561ea4dbc76ba98af020b970f3aa6b20fdb9e Mon Sep 17 00:00:00 2001
From: Samuel Attard <sam@electronjs.org>
Date: Wed, 8 Apr 2026 23:24:15 -0700
Subject: [PATCH] siso: reuse the outer *os.File for chunked ReadAt in
fileParser.readFile
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
The per-chunk goroutine currently re-opens fname to get its own handle
for ReadAt. (*os.File).ReadAt is documented as safe for concurrent
calls on the same File (on Windows it is ReadFile with an OVERLAPPED
offset, so there is no shared seek state), so the extra open is
redundant — the goroutines can share the outer f.
Besides halving the CreateFileW calls per subninja, this avoids an
intermittent 'The parameter is incorrect.' (ERROR_INVALID_PARAMETER)
from bindflt.sys when out/ is a mapped directory inside a Windows
container: bindflt's handle-relative NtCreateFile path races when a
second relative open arrives while the first handle to the same target
is still being set up. Absolute paths and single opens do not trigger
it; see microsoft/Windows-Containers#<tbd>.
---
siso/toolsupport/ninjautil/file_parser.go | 7 -------
1 file changed, 7 deletions(-)
diff --git a/siso/toolsupport/ninjautil/file_parser.go b/siso/toolsupport/ninjautil/file_parser.go
index 8c18d084..63116662 100644
--- a/siso/toolsupport/ninjautil/file_parser.go
+++ b/siso/toolsupport/ninjautil/file_parser.go
@@ -111,13 +111,6 @@ func (p *fileParser) readFile(ctx context.Context, fname string) ([]byte, error)
eg.Go(func() error {
p.sema <- struct{}{}
defer func() { <-p.sema }()
- f, err := os.Open(fname)
- if err != nil {
- return err
- }
- defer func() {
- _ = f.Close()
- }()
for len(chunkBuf) > 0 {
n, err := f.ReadAt(chunkBuf, pos)
if err != nil {
--
2.53.0

View File

@@ -0,0 +1,132 @@
From a8afee1089ec2ae9ab5837b438d07338aefb3bc4 Mon Sep 17 00:00:00 2001
From: Samuel Attard <sam@electronjs.org>
Date: Wed, 22 Apr 2026 16:27:51 -0700
Subject: [PATCH] siso: retry transient ERROR_INVALID_PARAMETER when opening
ninja files on Windows
ManifestParser.Load fans out across all subninja files (~90k in a
Chromium build) at NumCPU parallelism. On Windows builders where out/
is served through a filesystem filter driver (e.g. bindflt/wcifs for
container bind mounts), CreateFileW can intermittently return
ERROR_INVALID_PARAMETER under this concurrent open burst. The previous
patch removes the redundant per-chunk re-open, but the single remaining
open per file can still hit the race; without a retry a single transient
failure aborts the entire manifest load.
Wrap the remaining os.Open call in readFile in a small Windows-only
retry for ERROR_INVALID_PARAMETER (5 attempts, 5-80ms backoff). Each
retry is logged via clog.Warningf and also written to stderr so it is
visible in CI step output where glog warnings are file-only by default.
Other platforms keep the direct os.Open path.
---
siso/toolsupport/ninjautil/file_parser.go | 3 +-
siso/toolsupport/ninjautil/openfile_other.go | 18 +++++++
.../toolsupport/ninjautil/openfile_windows.go | 50 +++++++++++++++++++
3 files changed, 69 insertions(+), 2 deletions(-)
create mode 100644 siso/toolsupport/ninjautil/openfile_other.go
create mode 100644 siso/toolsupport/ninjautil/openfile_windows.go
diff --git a/siso/toolsupport/ninjautil/file_parser.go b/siso/toolsupport/ninjautil/file_parser.go
index 6311666..324528d 100644
--- a/siso/toolsupport/ninjautil/file_parser.go
+++ b/siso/toolsupport/ninjautil/file_parser.go
@@ -7,7 +7,6 @@ package ninjautil
import (
"context"
"fmt"
- "os"
"runtime/trace"
"sync"
"time"
@@ -91,7 +90,7 @@ func (p *fileParser) parseFile(ctx context.Context, fname string) error {
// readFile reads a file of fname in parallel.
func (p *fileParser) readFile(ctx context.Context, fname string) ([]byte, error) {
defer trace.StartRegion(ctx, "ninja.read").End()
- f, err := os.Open(fname)
+ f, err := openFile(ctx, fname)
if err != nil {
return nil, err
}
diff --git a/siso/toolsupport/ninjautil/openfile_other.go b/siso/toolsupport/ninjautil/openfile_other.go
new file mode 100644
index 0000000..9fca690
--- /dev/null
+++ b/siso/toolsupport/ninjautil/openfile_other.go
@@ -0,0 +1,18 @@
+// Copyright 2026 The Chromium Authors
+// Use of this source code is governed by a BSD-style license that can be
+// found in the LICENSE file.
+
+//go:build !windows
+
+package ninjautil
+
+import (
+ "context"
+ "os"
+)
+
+// openFile opens fname for reading.
+// See openfile_windows.go for the Windows variant with transient-error retry.
+func openFile(ctx context.Context, fname string) (*os.File, error) {
+ return os.Open(fname)
+}
diff --git a/siso/toolsupport/ninjautil/openfile_windows.go b/siso/toolsupport/ninjautil/openfile_windows.go
new file mode 100644
index 0000000..f9d8e9d
--- /dev/null
+++ b/siso/toolsupport/ninjautil/openfile_windows.go
@@ -0,0 +1,50 @@
+// Copyright 2026 The Chromium Authors
+// Use of this source code is governed by a BSD-style license that can be
+// found in the LICENSE file.
+
+//go:build windows
+
+package ninjautil
+
+import (
+ "context"
+ "errors"
+ "fmt"
+ "os"
+ "time"
+
+ "golang.org/x/sys/windows"
+
+ "go.chromium.org/build/siso/o11y/clog"
+)
+
+// openFile opens fname for reading, retrying transient
+// ERROR_INVALID_PARAMETER failures.
+//
+// On Windows, CreateFileW can intermittently return
+// ERROR_INVALID_PARAMETER when the target lives behind a filesystem
+// filter driver (e.g. bindflt/wcifs for container bind mounts) under
+// highly concurrent opens. loadFile fans out across ~90k subninja
+// files at NumCPU parallelism, so a single transient failure would
+// otherwise abort the whole manifest load.
+func openFile(ctx context.Context, fname string) (*os.File, error) {
+ const maxAttempts = 5
+ delay := 5 * time.Millisecond
+ for i := 0; ; i++ {
+ f, err := os.Open(fname)
+ if err == nil {
+ return f, nil
+ }
+ if i+1 >= maxAttempts || !errors.Is(err, windows.ERROR_INVALID_PARAMETER) {
+ return nil, err
+ }
+ clog.Warningf(ctx, "open %s: %v; retrying (%d/%d) after %s", fname, err, i+1, maxAttempts, delay)
+ fmt.Fprintf(os.Stderr, "siso: open %s: %v; retrying (%d/%d) after %s\n", fname, err, i+1, maxAttempts, delay)
+ select {
+ case <-time.After(delay):
+ case <-ctx.Done():
+ return nil, context.Cause(ctx)
+ }
+ delay *= 2
+ }
+}
--
2.53.0

85
.github/workflows/apply-patches.yml vendored Normal file
View File

@@ -0,0 +1,85 @@
name: Apply Patches
on:
pull_request:
permissions: {}
concurrency:
group: apply-patches-${{ github.ref }}
cancel-in-progress: true
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
has-patches: ${{ steps.filter.outputs.patches }}
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
persist-credentials: false
ref: ${{ github.event.pull_request.head.sha }}
# Use dorny/paths-filter instead of the path filter under the on: pull_request: block
# so that the output can be used to conditionally run the apply-patches job, which lets
# the job be marked as a required status check (conditional skip counts as a success).
- uses: dorny/paths-filter@fbd0ab8f3e69293af611ebaee6363fc25e6d187d # v4.0.1
id: filter
with:
filters: |
patches:
- DEPS
- 'patches/**'
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
apply-patches:
needs: setup
if: ${{ needs.setup.outputs.has-patches == 'true' }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
persist-credentials: false
ref: ${{ github.event.pull_request.base.ref }}
- name: Merge PR HEAD
working-directory: src/electron
env:
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
git config user.email "electron@github.com"
git config user.name "Electron Bot"
git fetch origin refs/pull/${PR_NUMBER}/head
git merge --squash FETCH_HEAD
git commit -n -m "Squashed commits"
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux
- name: Upload Patch Conflict Fix
if: ${{ failure() }}
uses: actions/upload-artifact@043fb46d1a93c77aae656e7c1c64a875d1fc6a0a # v7.0.1
with:
name: update-patches
path: patches/update-patches.patch
if-no-files-found: ignore
archive: false

View File

@@ -3,31 +3,39 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@48b55a011bda9f5d6aeb4c2d9c7362e8dae4041e
with:
node-version: 20.11.x
node-version: 24.12.x
- name: Setting Up Dig Site
env:
CLONE_URL: ${{ github.event.pull_request.head.repo.clone_url }}
HEAD_SHA: ${{ github.event.pull_request.head.sha }}
BASE_REF: ${{ github.event.pull_request.base.ref }}
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
echo "sha ${{ github.event.pull_request.head.sha }}"
echo "base ref ${{ github.event.pull_request.base.ref }}"
git clone https://github.com/electron/electron.git electron
echo "remote: $CLONE_URL"
echo "sha $HEAD_SHA"
echo "base ref $BASE_REF"
git clone https://github.com/electron/electron.git electron
cd electron
mkdir -p artifacts
git remote add fork ${{ github.event.pull_request.head.repo.clone_url }} && git fetch fork
git checkout ${{ github.event.pull_request.head.sha }}
git merge-base origin/${{ github.event.pull_request.base.ref }} HEAD > .dig-old
echo ${{ github.event.pull_request.head.sha }} > .dig-new
git remote add fork "$CLONE_URL" && git fetch fork
git checkout "$HEAD_SHA"
git merge-base "origin/$BASE_REF" HEAD > .dig-old
echo "$HEAD_SHA" > .dig-new
cp .dig-old artifacts
- name: Generating Types for SHA in .dig-new
@@ -41,7 +49,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 #v4.6.2
uses: actions/upload-artifact@043fb46d1a93c77aae656e7c1c64a875d1fc6a0a #v7.0.1
with:
name: artifacts
path: electron/artifacts

165
.github/workflows/audit-branch-ci.yml vendored Normal file
View File

@@ -0,0 +1,165 @@
name: Audit CI on Branches
on:
workflow_dispatch:
schedule:
# Run every 2 hours
- cron: '0 */2 * * *'
permissions: {}
jobs:
audit_branch_ci:
name: Audit CI on Branches
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@48b55a011bda9f5d6aeb4c2d9c7362e8dae4041e # v6.4.0
with:
node-version: 22.17.x
- name: Sparse checkout repository
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@3a2844b7e9c422d3c10d287c895573f7108da1b3 # v9.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
const runsWithErrors = [];
// Only want the most recent workflow run that wasn't skipped or cancelled
const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
const versions = await ElectronVersions.create({ ignoreCache: true });
const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
for (const branch of ["main", ...branches]) {
const latestCheckRuns = new Map();
const allCheckRuns = await github.paginate(github.rest.checks.listForRef, {
owner: "electron",
repo: "electron",
ref: branch,
status: 'completed',
});
// Sort the check runs by completed_at so that multiple check runs on the
// same ref (like a scheduled workflow) only looks at the most recent one
for (const checkRun of allCheckRuns.filter(
(run) => !['skipped', 'cancelled'].includes(run.conclusion),
).sort((a, b) => new Date(b.completed_at) - new Date(a.completed_at))) {
if (!latestCheckRuns.has(checkRun.name)) {
latestCheckRuns.set(checkRun.name, checkRun);
}
}
// Check for runs which had error annotations
for (const checkRun of Array.from(latestCheckRuns.values())) {
if (checkRun.name === "Audit CI on Branches") {
continue; // Skip the audit workflow itself
}
const annotations = (await github.rest.checks.listAnnotations({
owner: "electron",
repo: "electron",
check_run_id: checkRun.id,
})).data ?? [];
if (
annotations.find(
({ annotation_level, message }) =>
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!message.startsWith("The action 'Run Electron Tests' has timed out") &&
!message.startsWith("The operation was canceled") &&
!message.startsWith("Canceling since") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)
) {
checkRun.hasErrorAnnotations = true;
} else {
continue;
}
// Check if this is a known failure from a previous audit run
const cacheKey = `check-run-error-annotations-${checkRun.id}`;
const cacheHit =
(await cache.restoreCache(['/dev/null'], cacheKey, undefined, {
lookupOnly: true,
})) !== undefined;
if (cacheHit) {
checkRun.isStale = true;
}
checkRun.branch = branch;
runsWithErrors.push(checkRun);
// Create a cache entry (only the name matters) to keep track of
// failures we've seen from previous runs to mark them as stale
if (!cacheHit) {
await cache.saveCache(['/dev/null'], cacheKey);
}
}
}
if (runsWithErrors.length > 0) {
core.summary.addHeading('⚠️ Runs with Errors');
core.summary.addTable([
[
{ data: 'Branch', header: true },
{ data: 'Workflow Run', header: true },
{ data: 'Status', header: true },
],
...runsWithErrors
.sort(
(a, b) =>
a.branch.localeCompare(b.branch) ||
a.name.localeCompare(b.name),
)
.map((run) => [
run.branch,
`<a href="${run.html_url}">${run.name}</a>`,
run.isStale
? '📅 Stale'
: run.hasErrorAnnotations
? '⚠️ Errors'
: '✅ Succeeded',
]),
]);
// Set this as failed so it's easy to scan runs to find failures
if (runsWithErrors.find((run) => !run.isStale)) {
core.setOutput('errorsFound', true);
process.exitCode = 1;
}
} else {
core.summary.addRaw('🎉 No runs with errors');
}
await core.summary.write();
- name: Send Slack message if errors
if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
uses: slackapi/slack-github-action@af78098f536edbc4de71162a307590698245be95 # v3.0.1
with:
payload: |
link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"
webhook: ${{ secrets.CI_ERRORS_SLACK_WEBHOOK_URL }}
webhook-type: webhook-trigger

View File

@@ -14,7 +14,7 @@ permissions: {}
jobs:
release-branch-created:
name: Release Branch Created
if: ${{ github.event_name == 'workflow_dispatch' || (github.event.ref_type == 'branch' && endsWith(github.event.ref, '-x-y') && !startsWith(github.event.ref, 'roller')) }}
if: ${{ github.repository == 'electron/electron' && (github.event_name == 'workflow_dispatch' || (github.event.ref_type == 'branch' && endsWith(github.event.ref, '-x-y') && !startsWith(github.event.ref, 'roller'))) }}
permissions:
contents: read
pull-requests: write
@@ -31,16 +31,46 @@ jobs:
else
echo "Not a release branch: $BRANCH_NAME"
fi
- name: Determine Next Unsupported Major Version
id: determine-next-unsupported-major
if: ${{ steps.check-major-version.outputs.MAJOR }}
env:
MAJOR: ${{ steps.check-major-version.outputs.MAJOR }}
run: |
# Fetch the release schedule
SCHEDULE=$(curl -s https://releases.electronjs.org/schedule.json)
# Get the stableDate for the current major version
STABLE_DATE=$(echo "$SCHEDULE" | jq -r --arg major "${MAJOR}.0.0" '.[] | select(.version == $major) | .stableDate')
if [[ -z "$STABLE_DATE" || "$STABLE_DATE" == "null" ]]; then
echo "Could not find stableDate for version $MAJOR"
exit 1
fi
# Find the oldest version where eolDate >= stableDate of the new major
# This gives us the oldest supported version when the new major goes stable
NEXT_UNSUPPORTED_MAJOR=$(echo "$SCHEDULE" | jq -r --arg stableDate "$STABLE_DATE" '
[.[] | select(.eolDate != null and .eolDate >= $stableDate)] | sort_by(.version | split(".")[0] | tonumber) | first | .version | split(".")[0]
')
if [[ -z "$NEXT_UNSUPPORTED_MAJOR" || "$NEXT_UNSUPPORTED_MAJOR" == "null" ]]; then
echo "Could not determine oldest supported version"
exit 1
fi
echo "SCHEDULE=$SCHEDULE" >> "$GITHUB_OUTPUT"
echo "NEXT_UNSUPPORTED_MAJOR=$NEXT_UNSUPPORTED_MAJOR" >> "$GITHUB_OUTPUT"
- name: New Release Branch Tasks
if: ${{ steps.check-major-version.outputs.MAJOR }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
GH_REPO: electron/electron
MAJOR: ${{ steps.check-major-version.outputs.MAJOR }}
NUM_SUPPORTED_VERSIONS: 3
NEXT_UNSUPPORTED_MAJOR: ${{ steps.determine-next-unsupported-major.outputs.NEXT_UNSUPPORTED_MAJOR }}
run: |
PREVIOUS_MAJOR=$((MAJOR - 1))
UNSUPPORTED_MAJOR=$((MAJOR - NUM_SUPPORTED_VERSIONS - 1))
UNSUPPORTED_MAJOR=$((NEXT_UNSUPPORTED_MAJOR - 1))
# Create new labels
gh label create $MAJOR-x-y --color 8d9ee8 || true
@@ -68,21 +98,45 @@ jobs:
done
- name: Generate GitHub App token
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@3a2844b7e9c422d3c10d287c895573f7108da1b3 # v9.0.0
id: generate-project-metadata
env:
MAJOR: ${{ steps.check-major-version.outputs.MAJOR }}
NEXT_UNSUPPORTED_MAJOR: ${{ steps.determine-next-unsupported-major.outputs.NEXT_UNSUPPORTED_MAJOR }}
SCHEDULE: ${{ steps.determine-next-unsupported-major.outputs.SCHEDULE }}
with:
script: |
const major = ${{ steps.check-major-version.outputs.MAJOR }}
const schedule = JSON.parse(process.env.SCHEDULE)
const major = parseInt(process.env.MAJOR)
const nextMajor = major + 1
const prevMajor = major - 1
const { betaDate, stableDate } = schedule.find(v => v.version === `${major}.0.0`)
const betaPrepWeek = new Date(betaDate)
betaPrepWeek.setDate(betaPrepWeek.getDate() - 8)
const betaPrepWeekEnd = new Date(betaPrepWeek)
betaPrepWeekEnd.setDate(betaPrepWeekEnd.getDate() + 4)
const stablePrepWeek = new Date(stableDate)
stablePrepWeek.setDate(stablePrepWeek.getDate() - 8)
const stablePrepWeekEnd = new Date(stablePrepWeek)
stablePrepWeekEnd.setDate(stablePrepWeekEnd.getDate() + 4)
const stableWeek = new Date(stableDate)
stableWeek.setDate(stableWeek.getDate() - 1)
const nextAlphaDate = new Date(stableDate)
nextAlphaDate.setDate(nextAlphaDate.getDate() + 2)
core.setOutput("major", major)
core.setOutput("next-major", nextMajor)
core.setOutput("prev-major", prevMajor)
@@ -91,10 +145,19 @@ jobs:
major,
"next-major": nextMajor,
"prev-major": prevMajor,
"ending-support-major": parseInt(process.env.NEXT_UNSUPPORTED_MAJOR),
"beta-date": betaDate,
"beta-prep-week": betaPrepWeek.toISOString().split('T')[0],
"beta-prep-week-end": betaPrepWeekEnd.toISOString().split('T')[0],
"stable-week": stableWeek.toISOString().split('T')[0],
"stable-prep-week": stablePrepWeek.toISOString().split('T')[0],
"stable-prep-week-end": stablePrepWeekEnd.toISOString().split('T')[0],
"stable-date": stableDate,
"next-alpha-date": nextAlphaDate.toISOString().split('T')[0],
}))
- name: Create Release Project Board
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: dsanders11/project-actions/copy-project@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/copy-project@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
id: create-release-board
with:
drafts: true
@@ -107,6 +170,60 @@ jobs:
template-view: ${{ steps.generate-project-metadata.outputs.template-view }}
title: ${{ steps.generate-project-metadata.outputs.major }}-x-y
token: ${{ steps.generate-token.outputs.token }}
- name: Randomly Assign Draft Issues to Release WG Members
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: dsanders11/project-actions/github-script@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
env:
PROJECT_ID: ${{ steps.create-release-board.outputs.id }}
with:
token: ${{ steps.generate-token.outputs.token }}
script: |
const { data: members } = await github.rest.teams.listMembersInOrg({
org: 'electron',
team_slug: 'wg-releases',
});
const excludedLogins = ['nikwen'];
const memberLogins = new Set(members.map(m => m.login));
for (const login of excludedLogins) {
if (!memberLogins.has(login)) {
core.warning(`Excluded member "${login}" is not in @electron/wg-releases`);
}
}
const eligible = members.filter(m => !excludedLogins.includes(m.login));
if (eligible.length === 0) {
core.warning('No eligible members found in @electron/wg-releases team');
return;
}
const projectId = process.env.PROJECT_ID;
const draftIssues = await actions.getDraftIssues(projectId);
if (draftIssues.length === 0) {
core.info('No draft issues found in the project');
return;
}
// Fisher-Yates shuffle for uniform random assignment
const shuffled = [...eligible];
for (let i = shuffled.length - 1; i > 0; i--) {
const j = Math.floor(Math.random() * (i + 1));
[shuffled[i], shuffled[j]] = [shuffled[j], shuffled[i]];
}
// Assign draft issues round-robin across team members
for (let i = 0; i < draftIssues.length; i++) {
const member = shuffled[i % shuffled.length];
const draftIssue = draftIssues[i];
core.info(`Assigning "${draftIssue.content.title}" to ${member.login}`);
await actions.editItem(projectId, draftIssue.content.id, {
assignees: [member.login],
});
}
core.info(`Assigned ${draftIssues.length} draft issues to ${eligible.length} team members`);
- name: Dump Release Project Board Contents
if: ${{ steps.check-major-version.outputs.MAJOR }}
run: gh project item-list ${{ steps.create-release-board.outputs.number }} --owner electron --format json | jq
@@ -114,7 +231,7 @@ jobs:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
- name: Find Previous Release Project Board
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: dsanders11/project-actions/find-project@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/find-project@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
id: find-prev-release-board
with:
fail-if-project-not-found: false
@@ -122,7 +239,7 @@ jobs:
token: ${{ steps.generate-token.outputs.token }}
- name: Close Previous Release Project Board
if: ${{ steps.find-prev-release-board.outputs.number }}
uses: dsanders11/project-actions/close-project@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/close-project@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
project-number: ${{ steps.find-prev-release-board.outputs.number }}
token: ${{ steps.generate-token.outputs.token }}

97
.github/workflows/build-git-cache.yml vendored Normal file
View File

@@ -0,0 +1,97 @@
name: Build Git Cache
# This workflow updates git cache on the cross-instance cache volumes
# It runs daily at midnight.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
outputs:
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
build-git-cache-linux:
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Build Git Cache
uses: ./src/electron/.github/actions/build-git-cache
with:
target-platform: linux
build-git-cache-windows:
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_win=True'
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Build Git Cache
uses: ./src/electron/.github/actions/build-git-cache
with:
target-platform: win
build-git-cache-macos:
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: [setup, build-git-cache-linux]
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Build Git Cache
uses: ./src/electron/.github/actions/build-git-cache
with:
target-platform: macos

View File

@@ -6,8 +6,8 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '424eedbf277ad9749ffa9219068aa72ed4a5e373'
required: true
default: ''
required: false
skip-macos:
type: boolean
description: 'Skip macOS builds'
@@ -28,6 +28,11 @@ on:
description: 'Skip lint check'
default: false
required: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
push:
branches:
- main
@@ -38,36 +43,45 @@ defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
runs-on: ubuntu-latest
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
src: ${{ steps.filter.outputs.src }}
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 #v4.0.2
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
- uses: dorny/paths-filter@fbd0ab8f3e69293af611ebaee6363fc25e6d187d # v4.0.1
id: filter
with:
filters: |
docs:
- 'docs/**'
- '.claude/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
- '!{docs,.claude}/**'
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
with:
override: ${{ inputs.build-image-sha }}
- name: Set Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=424eedbf277ad9749ffa9219068aa72ed4a5e373" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
echo "docs-only=${{ steps.filter.outputs.docs == 'true' && steps.filter.outputs.src == 'false' }}" >> "$GITHUB_OUTPUT"
# Lint Jobs
@@ -75,24 +89,30 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
# Docs Only Jobs
docs-only:
needs: setup
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
# Checkout Jobs
checkout-macos:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-linux-amd64-32core
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -106,7 +126,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -119,8 +139,10 @@ jobs:
checkout-linux:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-linux}}
runs-on: electron-arc-linux-amd64-32core
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -129,24 +151,29 @@ jobs:
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
PATCH_UP_APP_CREDS: ${{ secrets.PATCH_UP_APP_CREDS }}
outputs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux
checkout-windows:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-linux-amd64-32core
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
@@ -163,7 +190,7 @@ jobs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -174,35 +201,51 @@ jobs:
generate-sas-token: 'true'
target-platform: win
# Build a patched siso binary for Windows CI in parallel with checkout-windows.
# The Windows build jobs download the resulting artifact and use it via SISO_PATH.
build-siso-windows:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
uses: ./.github/workflows/pipeline-segment-build-siso-windows.yml
permissions:
contents: read
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-14
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
target-platform: linux
target-archs: x64 arm arm64
check-runs-on: electron-arc-linux-amd64-8core
check-runs-on: electron-arc-centralus-linux-amd64-8core
check-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
gn-build-type: testing
secrets: inherit
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
target-archs: x64 x86 arm64
check-runs-on: electron-arc-linux-amd64-8core
check-runs-on: electron-arc-centralus-linux-amd64-8core
check-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-windows.outputs.build-image-sha }}","options":"--user root --device /dev/fuse --cap-add SYS_ADMIN","volumes":["/mnt/win-cache:/mnt/win-cache"]}'
gn-build-type: testing
secrets: inherit
@@ -216,14 +259,15 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
test-runs-on: macos-13
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
enable-ssh: ${{ inputs.enable-ssh || false }}
secrets: inherit
macos-arm64:
@@ -231,17 +275,19 @@ jobs:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
uses: ./.github/workflows/pipeline-electron-build-and-tidy-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
test-runs-on: macos-14
build-runs-on: macos-15-xlarge
clang-tidy-runs-on: macos-15-large
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
enable-ssh: ${{ inputs.enable-ssh || false }}
secrets: inherit
linux-x64:
@@ -249,12 +295,15 @@ jobs:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test-and-nan.yml
uses: ./.github/workflows/pipeline-electron-build-and-tidy-and-test-and-nan.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
test-runs-on: electron-arc-linux-amd64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
clang-tidy-runs-on: electron-arc-centralus-linux-amd64-8core
test-runs-on: electron-arc-centralus-linux-amd64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
clang-tidy-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
target-arch: x64
@@ -271,9 +320,10 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
test-runs-on: electron-arc-linux-amd64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-amd64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
@@ -292,11 +342,12 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
test-runs-on: electron-arc-linux-arm64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -312,9 +363,10 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
test-runs-on: electron-arc-linux-arm64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: ubuntu-22.04-arm
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm64v8-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
@@ -324,18 +376,32 @@ jobs:
generate-symbols: false
upload-to-storage: '0'
secrets: inherit
test-linux-arm64-64k:
uses: ./.github/workflows/pipeline-segment-electron-test-64k.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: [checkout-linux, linux-arm64]
with:
test-runs-on: ubuntu-22.04-arm
test-container: '{"image":"ghcr.io/electron/test:arm64v8-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
secrets: inherit
windows-x64:
permissions:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-windows
uses: ./.github/workflows/pipeline-electron-build-and-tidy-and-test.yml
needs: [checkout-windows, build-siso-windows]
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-windows-amd64-16core
build-runs-on: electron-arc-centralus-windows-amd64-32core
clang-tidy-runs-on: electron-arc-centralus-linux-amd64-8core
test-runs-on: windows-latest
clang-tidy-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-windows.outputs.build-image-sha }}","options":"--user root --device /dev/fuse --cap-add SYS_ADMIN","volumes":["/mnt/win-cache:/mnt/win-cache"]}'
target-platform: win
target-arch: x64
is-release: false
@@ -350,10 +416,10 @@ jobs:
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-windows
needs: [checkout-windows, build-siso-windows]
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-windows-amd64-16core
build-runs-on: electron-arc-centralus-windows-amd64-32core
test-runs-on: windows-latest
target-platform: win
target-arch: x86
@@ -369,11 +435,11 @@ jobs:
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-windows
needs: [checkout-windows, build-siso-windows]
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-windows-amd64-16core
test-runs-on: electron-hosted-windows-arm64-4core
build-runs-on: electron-arc-centralus-windows-amd64-32core
test-runs-on: windows-11-arm
target-platform: win
target-arch: arm64
is-release: false
@@ -385,9 +451,14 @@ jobs:
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && !contains(needs.*.result, 'failure')
steps:
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, build-siso-windows, windows-x64, windows-x86, windows-arm64]
if: always() && github.repository == 'electron/electron'
steps:
- name: Fail if any needed job failed or was cancelled
if: contains(needs.*.result, 'failure') || contains(needs.*.result, 'cancelled')
run: exit 1
- name: GitHub Actions Jobs Done
run: |
echo "All GitHub Actions Jobs are done"

View File

@@ -0,0 +1,45 @@
name: Clean Orphaned Cache Uploads
# Description:
# Sweeps orphaned in-flight upload temp files left on the src-cache volumes
# by checkout/action.yml when its cp-to-share step dies before the rename.
# A successful upload finishes in minutes, so anything older than 4h is dead.
on:
schedule:
- cron: "0 */4 * * *"
workflow_dispatch:
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
outputs:
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
clean-orphaned-uploads:
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /mnt/win-cache:/mnt/win-cache
steps:
- name: Remove Orphaned Upload Temp Files
shell: bash
run: |
find /mnt/cross-instance-cache -maxdepth 1 -type f -name '*.tar.upload-*' -mmin +240 -print -delete
find /mnt/win-cache -maxdepth 1 -type f -name '*.tar.upload-*' -mmin +240 -print -delete

View File

@@ -1,29 +1,168 @@
name: Clean Source Cache
description: |
This workflow cleans up the source cache on the cross-instance cache volume
to free up space. It runs daily at midnight and clears files older than 15 days.
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
outputs:
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
clean-src-cache:
runs-on: electron-arc-linux-amd64-32core
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /mnt/win-cache:/mnt/win-cache
steps:
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /mnt/cross-instance-cache
df -h /mnt/win-cache
CROSS_FREE_BEFORE=$(df -k /mnt/cross-instance-cache | tail -1 | awk '{print $4}')
CROSS_TOTAL=$(df -k /mnt/cross-instance-cache | tail -1 | awk '{print $2}')
WIN_FREE_BEFORE=$(df -k /mnt/win-cache | tail -1 | awk '{print $4}')
WIN_TOTAL=$(df -k /mnt/win-cache | tail -1 | awk '{print $2}')
echo "cross_free_kb=$CROSS_FREE_BEFORE" >> $GITHUB_OUTPUT
echo "cross_total_kb=$CROSS_TOTAL" >> $GITHUB_OUTPUT
echo "win_free_kb=$WIN_FREE_BEFORE" >> $GITHUB_OUTPUT
echo "win_total_kb=$WIN_TOTAL" >> $GITHUB_OUTPUT
- name: Cleanup Source Cache
shell: bash
run: |
df -h /mnt/cross-instance-cache
find /mnt/cross-instance-cache -type f -mtime +15 -delete
find /mnt/win-cache -type f -mtime +15 -delete
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /mnt/cross-instance-cache
df -h /mnt/win-cache
find /mnt/win-cache -type f -mtime +15 -delete
df -h /mnt/win-cache
CROSS_FREE_AFTER=$(df -k /mnt/cross-instance-cache | tail -1 | awk '{print $4}')
WIN_FREE_AFTER=$(df -k /mnt/win-cache | tail -1 | awk '{print $4}')
echo "cross_free_kb=$CROSS_FREE_AFTER" >> $GITHUB_OUTPUT
echo "win_free_kb=$WIN_FREE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
CROSS_FREE_BEFORE: ${{ steps.disk-before.outputs.cross_free_kb }}
CROSS_FREE_AFTER: ${{ steps.disk-after.outputs.cross_free_kb }}
CROSS_TOTAL: ${{ steps.disk-before.outputs.cross_total_kb }}
WIN_FREE_BEFORE: ${{ steps.disk-before.outputs.win_free_kb }}
WIN_FREE_AFTER: ${{ steps.disk-after.outputs.win_free_kb }}
WIN_TOTAL: ${{ steps.disk-before.outputs.win_total_kb }}
run: |
TIMESTAMP=$(date +%s)
CROSS_FREE_BEFORE_GB=$(awk "BEGIN {printf \"%.2f\", $CROSS_FREE_BEFORE / 1024 / 1024}")
CROSS_FREE_AFTER_GB=$(awk "BEGIN {printf \"%.2f\", $CROSS_FREE_AFTER / 1024 / 1024}")
CROSS_FREED_GB=$(awk "BEGIN {printf \"%.2f\", ($CROSS_FREE_AFTER - $CROSS_FREE_BEFORE) / 1024 / 1024}")
CROSS_TOTAL_GB=$(awk "BEGIN {printf \"%.2f\", $CROSS_TOTAL / 1024 / 1024}")
WIN_FREE_BEFORE_GB=$(awk "BEGIN {printf \"%.2f\", $WIN_FREE_BEFORE / 1024 / 1024}")
WIN_FREE_AFTER_GB=$(awk "BEGIN {printf \"%.2f\", $WIN_FREE_AFTER / 1024 / 1024}")
WIN_FREED_GB=$(awk "BEGIN {printf \"%.2f\", ($WIN_FREE_AFTER - $WIN_FREE_BEFORE) / 1024 / 1024}")
WIN_TOTAL_GB=$(awk "BEGIN {printf \"%.2f\", $WIN_TOTAL / 1024 / 1024}")
echo "cross-instance-cache: free before=${CROSS_FREE_BEFORE_GB}GB, after=${CROSS_FREE_AFTER_GB}GB, freed=${CROSS_FREED_GB}GB, total=${CROSS_TOTAL_GB}GB"
echo "win-cache: free before=${WIN_FREE_BEFORE_GB}GB, after=${WIN_FREE_AFTER_GB}GB, freed=${WIN_FREED_GB}GB, total=${WIN_TOTAL_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.src_cache.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${CROSS_FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:cross-instance-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${CROSS_FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:cross-instance-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${CROSS_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:cross-instance-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.total_space_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${CROSS_TOTAL_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:cross-instance-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${WIN_FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:win-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${WIN_FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:win-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${WIN_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:win-cache", "platform:linux"]
},
{
"metric": "electron.src_cache.disk.total_space_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${WIN_TOTAL_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["volume:win-cache", "platform:linux"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -1,4 +1,4 @@
name: Issue Commented
name: Issue / Pull Request Commented
on:
issue_comment:
@@ -8,19 +8,81 @@ on:
permissions: {}
jobs:
issue-commented:
blocked-issue-commented:
name: Remove blocked/{need-info,need-repro} on comment
if: ${{ (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-latest
if: ${{ !github.event.issue.pull_request && (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-slim
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: &get-author-association |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Remove label
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
ISSUE_URL: ${{ github.event.issue.html_url }}
run: |
gh issue edit $ISSUE_URL --remove-label 'blocked/need-repro','blocked/need-info ❌'
pr-reviewer-requested:
name: Maintainer requested reviewer on PR
if: ${{ github.event.issue.pull_request && startsWith(github.event.comment.body, '/request-review') && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-slim
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: *get-author-association
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
if: ${{ contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Request reviewer
if: ${{ contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
PR_URL: ${{ github.event.issue.html_url }}
COMMENT_BODY: ${{ github.event.comment.body }}
run: |
RAW=$(echo "$COMMENT_BODY" | head -n 1 | sed 's|/request-review\s*||' | xargs)
if [ -z "$RAW" ]; then
echo "::warning::No username provided. Usage: /request-review <username>[,<username>,...]"
exit 0
fi
IFS=',' read -ra USERS <<< "$RAW"
for USER in "${USERS[@]}"; do
NAME=$(echo "$USER" | sed 's/@//g' | xargs)
if [ -z "$NAME" ]; then
continue
fi
# Strip "electron/" prefix if present to get the bare name
BARE_NAME=$(echo "$NAME" | sed 's|^electron/||')
# If the original name contained "electron/" or looks like a team slug, treat as team
if [ "$NAME" != "$BARE_NAME" ]; then
gh pr edit $PR_URL --add-reviewer "electron/$BARE_NAME"
else
if ! gh api /orgs/electron/public_members/$BARE_NAME --silent > /dev/null 2>&1; then
echo "::warning::$BARE_NAME is not a public member of the electron organization."
continue
fi
gh pr edit $PR_URL --add-reviewer "$BARE_NAME"
fi
done

View File

@@ -4,23 +4,24 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Set status
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/edit-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90
@@ -31,15 +32,17 @@ jobs:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Set status
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/edit-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90
@@ -58,21 +61,22 @@ jobs:
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
GH_REPO: electron/electron
ISSUE_NUMBER: ${{ github.event.issue.number }}
run: |
set -eo pipefail
COMMENT_COUNT=$(gh issue view ${{ github.event.issue.number }} --comments --json comments | jq '[ .comments[] | select(.author.login == "electron-issue-triage" or .authorAssociation == "OWNER" or .authorAssociation == "MEMBER") | select(.body | startswith("<!-- blocked/need-repro -->")) ] | length')
COMMENT_COUNT=$(gh issue view "$ISSUE_NUMBER" --comments --json comments | jq '[ .comments[] | select(.author.login == "electron-issue-triage" or .authorAssociation == "OWNER" or .authorAssociation == "MEMBER") | select(.body | startswith("<!-- blocked/need-repro -->")) ] | length')
if [[ $COMMENT_COUNT -eq 0 ]]; then
echo "SHOULD_COMMENT=1" >> "$GITHUB_OUTPUT"
fi
- name: Generate GitHub App token
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
uses: actions-cool/issues-helper@200c78641dbf33838311e5a1e0c31bbdb92d7cf0 # v3.8.0
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,15 +11,16 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Add to Issue Triage
uses: dsanders11/project-actions/add-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/add-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
field: Reporter
field-value: ${{ github.event.issue.user.login }}
@@ -28,25 +29,37 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install @electron/fiddle-core@1.3.3 mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@3a2844b7e9c422d3c10d287c895573f7108da1b3 # v9.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -60,6 +73,8 @@ jobs:
// It's possible for multiple versions to be listed -
// for now check for comma or space separated version.
const versions = electronVersion.split(/, | /);
let hasSupportedVersion = false;
for (const version of versions) {
const major = semver.coerce(version, { loose: true })?.major;
if (major) {
@@ -75,19 +90,19 @@ jobs:
labelExists = true;
} catch {}
if (labelExists) {
// Check if it's an unsupported major
const { ElectronVersions } = await import('${{ github.workspace }}/node_modules/@electron/fiddle-core/dist/index.js');
const versions = await ElectronVersions.create(undefined, { ignoreCache: true });
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
const validVersions = [...versions.supportedMajors, ...versions.prereleaseMajors];
if (validVersions.includes(major)) {
if (validVersions.includes(major)) {
hasSupportedVersion = true;
if (labelExists) {
labels.push(versionLabel);
}
}
}
}
if (labels.length === 0) {
if (!hasSupportedVersion) {
core.setOutput('unsupportedMajor', true);
labels.push('blocked/need-info ❌');
}
@@ -131,7 +146,7 @@ jobs:
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
uses: actions-cool/issues-helper@200c78641dbf33838311e5a1e0c31bbdb92d7cf0 # v3.8.0
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -10,16 +10,17 @@ jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Remove from issue triage
uses: dsanders11/project-actions/delete-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/delete-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90

View File

@@ -4,33 +4,36 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels
env:
LABELS_JSON: ${{ toJSON(github.event.issue.labels.*.name) }}
run: |
set -eo pipefail
BLOCKED_LABEL_COUNT=$(echo '${{ toJSON(github.event.issue.labels.*.name) }}' | jq '[ .[] | select(startswith("blocked/")) ] | length')
BLOCKED_LABEL_COUNT=$(echo "$LABELS_JSON" | jq '[ .[] | select(startswith("blocked/")) ] | length')
if [[ $BLOCKED_LABEL_COUNT -eq 0 ]]; then
echo "NOT_BLOCKED=1" >> "$GITHUB_OUTPUT"
fi
- name: Generate GitHub App token
if: ${{ steps.check-for-blocked-labels.outputs.NOT_BLOCKED }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Set status
if: ${{ steps.check-for-blocked-labels.outputs.NOT_BLOCKED }}
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/edit-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90

View File

@@ -6,7 +6,8 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '424eedbf277ad9749ffa9219068aa72ed4a5e373'
default: ''
required: false
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,11 +18,31 @@ on:
type: boolean
default: false
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
outputs:
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
with:
override: ${{ inputs.build-image-sha }}
checkout-linux:
runs-on: electron-arc-linux-amd64-32core
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -31,7 +52,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -39,49 +60,61 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
needs: checkout-linux
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: [setup, checkout-linux]
with:
environment: production-release
build-runs-on: electron-arc-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ inputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
build-runs-on: electron-arc-centralus-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
target-platform: linux
target-arch: x64
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
needs: checkout-linux
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: [setup, checkout-linux]
with:
environment: production-release
build-runs-on: electron-arc-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ inputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
build-runs-on: electron-arc-centralus-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
target-platform: linux
target-arch: arm
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
needs: checkout-linux
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: [setup, checkout-linux]
with:
environment: production-release
build-runs-on: electron-arc-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ inputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
build-runs-on: electron-arc-centralus-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
target-platform: linux
target-arch: arm64
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit

105
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,105 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
if: github.repository == 'electron/electron'
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -6,8 +6,8 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '424eedbf277ad9749ffa9219068aa72ed4a5e373'
required: true
default: ''
required: false
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -18,11 +18,31 @@ on:
type: boolean
default: false
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
outputs:
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
with:
override: ${{ inputs.build-image-sha }}
checkout-macos:
runs-on: electron-arc-linux-amd64-32core
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
@@ -32,7 +52,7 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -43,11 +63,16 @@ jobs:
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -58,11 +83,16 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -73,11 +103,16 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -88,11 +123,16 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas

View File

@@ -1,30 +1,46 @@
name: Check for Non-Maintainer Dependency Change
name: Check for Disallowed Non-Maintainer Change
on:
pull_request_target:
paths:
- 'yarn.lock'
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
# SECURITY: This workflow uses pull_request_target and has access to secrets.
# Do NOT checkout or run code from the PR head. All code execution must use
# the base branch only. Adding a ref to PR head would expose secrets to
# untrusted code.
permissions: {}
jobs:
check-for-non-maintainer-dependency-change:
name: Check for non-maintainer dependency change
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.pull_request.author_association) && github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
name: Check for disallowed non-maintainer change
if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
permissions:
contents: read
pull-requests: write
runs-on: ubuntu-latest
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Check for existing review
id: check-for-review
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
set -eo pipefail
REVIEW_COUNT=$(gh pr view $PR_URL --json reviews | jq '[ .reviews[] | select(.author.login == "github-actions") | select(.body | startswith("<!-- no-dependency-change -->")) ] | length')
REVIEW_COUNT=$(gh pr view $PR_URL --json reviews | jq '[ .reviews[] | select(.author.login == "github-actions") | select(.body | startswith("<!-- disallowed-non-maintainer-change -->")) ] | length')
if [[ $REVIEW_COUNT -eq 0 ]]; then
echo "SHOULD_REVIEW=1" >> "$GITHUB_OUTPUT"
fi
@@ -33,5 +49,23 @@ jobs:
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
PR_AUTHOR: ${{ github.event.pull_request.user.login }}
run: |
printf "<!-- no-dependency-change -->\n\nHello @${{ github.event.pull_request.user.login }}! It looks like this pull request touches one of our dependency files, and per [our contribution policy](https://github.com/electron/electron/blob/main/CONTRIBUTING.md#dependencies-upgrades-policy) we do not accept these types of changes in PRs." | gh pr review $PR_URL -r --body-file=-
cat <<'REVIEW_EOF' | sed "s/%AUTHOR%/$PR_AUTHOR/g" | gh pr review $PR_URL -r --body-file=-
<!-- disallowed-non-maintainer-change -->
Hello @%AUTHOR%! It looks like this pull request touches one of our dependency or CI files, and per [our contribution policy](https://github.com/electron/electron/blob/main/CONTRIBUTING.md#dependencies-upgrades-policy) we do not accept these types of changes in PRs.
To move this PR forward, please:
1. Revert the dependency/CI file changes from your branch. (e.g. `yarn.lock`, `.yarn/`, `.yarnrc.yml`, `.github/workflows/`, `.github/actions/`)
2. Ensure your branch [allows maintainer commits](https://docs.github.com/en/pull-requests/collaborating-with-pull-requests/working-with-forks/allowing-changes-to-a-pull-request-branch-created-from-a-fork) so a maintainer can push the necessary dependency changes on your behalf.
3. Leave a comment letting reviewers know the dependency change is still needed.
<details>
<summary>For maintainers</summary>
To land this PR, push a verified commit to the contributor's branch with the required dependency/CI changes, then dismiss this review.
</details>
REVIEW_EOF

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -55,6 +55,8 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -62,6 +64,8 @@ concurrency:
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -74,6 +78,10 @@ jobs:
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -83,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}

View File

@@ -54,19 +54,23 @@ on:
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -76,15 +80,21 @@ jobs:
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan}}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
is-asan: ${{ inputs.is-asan}}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit

View File

@@ -0,0 +1,139 @@
name: Electron Build & Clang Tidy & Test (+ Node + NaN) Pipeline
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux.'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
build-runs-on:
type: string
description: 'What host to run the build'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
build-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
clang-tidy-container:
type: string
description: 'JSON container information to run clang-tidy on'
required: false
default: '{"image":null}'
test-container:
type: string
description: 'JSON container information for testing'
required: false
default: '{"image":null}'
is-release:
description: 'Whether this build job is a release job'
required: true
type: boolean
default: false
gn-build-type:
description: 'The gn build type - testing or release'
required: true
type: string
default: testing
generate-symbols:
description: 'Whether or not to generate symbols'
required: true
type: boolean
default: false
upload-to-storage:
description: 'Whether or not to upload build artifacts to external storage'
required: true
type: string
default: '0'
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
is-release: ${{ inputs.is-release }}
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
upload-out-gen-artifacts: true
secrets: inherit
clang-tidy:
uses: ./.github/workflows/pipeline-segment-electron-clang-tidy.yml
permissions:
contents: read
needs: build
with:
clang-tidy-runs-on: ${{ inputs.clang-tidy-runs-on }}
clang-tidy-container: ${{ inputs.clang-tidy-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
secrets: inherit
test-wayland:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
if: ${{ inputs.target-platform == 'linux' && inputs.target-arch == 'x64' && !inputs.is-asan }}
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
display-server: wayland
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
gn-build-type: ${{ inputs.gn-build-type }}
secrets: inherit

View File

@@ -0,0 +1,121 @@
name: Electron Build & Clang Tidy & Test Pipeline
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
build-runs-on:
type: string
description: 'What host to run the build'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
build-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
clang-tidy-container:
type: string
description: 'JSON container information to run clang-tidy on'
required: false
default: '{"image":null}'
test-container:
type: string
description: 'JSON container information for testing'
required: false
default: '{"image":null}'
is-release:
description: 'Whether this build job is a release job'
required: true
type: boolean
default: false
gn-build-type:
description: 'The gn build type - testing or release'
required: true
type: string
default: testing
generate-symbols:
description: 'Whether or not to generate symbols'
required: true
type: boolean
default: false
upload-to-storage:
description: 'Whether or not to upload build artifacts to external storage'
required: true
type: string
default: '0'
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
concurrency:
group: electron-build-and-tidy-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
is-release: ${{ inputs.is-release }}
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
upload-out-gen-artifacts: true
secrets: inherit
clang-tidy:
uses: ./.github/workflows/pipeline-segment-electron-clang-tidy.yml
permissions:
contents: read
needs: build
with:
clang-tidy-runs-on: ${{ inputs.clang-tidy-runs-on }}
clang-tidy-container: ${{ inputs.clang-tidy-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit

View File

@@ -8,19 +8,42 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
env:
GCLIENT_EXTRA_ARGS: --custom-var=checkout_arm=True --custom-var=checkout_arm64=True
jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-linux-amd64-4core
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v2-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AKS
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -31,12 +54,12 @@ jobs:
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done

View File

@@ -8,6 +8,8 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -18,12 +20,14 @@ env:
jobs:
lint:
name: Lint
runs-on: electron-arc-linux-amd64-4core
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -42,7 +46,11 @@ jobs:
shell: bash
run: |
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
gn_version="$(curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
if [[ ! "$chromium_revision" =~ ^[a-zA-Z0-9._-]+$ ]]; then
echo "::error::Invalid chromium_revision: $chromium_revision"
exit 1
fi
gn_version="$(curl -sL "https://raw.githubusercontent.com/chromium/chromium/refs/tags/${chromium_revision}/DEPS" | grep gn_version | head -n1 | cut -d\' -f4)"
cipd ensure -ensure-file - -root . <<-CIPD
\$ServiceURL https://chrome-infra-packages.appspot.com/
@@ -56,11 +64,19 @@ jobs:
shell: bash
run: |
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
if [[ ! "$chromium_revision" =~ ^[a-zA-Z0-9._-]+$ ]]; then
echo "::error::Invalid chromium_revision: $chromium_revision"
exit 1
fi
mkdir -p src/buildtools
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
curl -sL "https://raw.githubusercontent.com/chromium/chromium/refs/tags/${chromium_revision}/buildtools/DEPS" > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add problem matchers
shell: bash
run: |
echo "::add-matcher::src/electron/.github/problem-matchers/markdownlint.json"
- name: Run Lint
shell: bash
run: |
@@ -71,11 +87,15 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -0,0 +1,98 @@
name: Pipeline Segment - Build Siso (Windows)
# Builds a patched siso binary for Windows CI. Reads the siso revision from
# the Chromium DEPS file at the pinned chromium_version, shallow-clones
# chromium.googlesource.com/build at that revision, applies the patches under
# .github/siso-patches/, cross-compiles siso.exe for windows/amd64, and
# publishes it as the `siso-windows-amd64` artifact. The Windows build jobs
# download it and use it via SISO_PATH. The built binary is cached keyed on
# the siso revision + sha256 of the patch contents, so subsequent runs just
# restore it.
on:
workflow_call: {}
permissions: {}
jobs:
build:
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
fetch-depth: 1
ref: ${{ github.event.pull_request.head.sha }}
sparse-checkout: |
DEPS
.github/siso-patches
- name: Resolve siso revision from Chromium DEPS
id: resolve
run: |
set -euo pipefail
CHROMIUM_VERSION=$(python3 -c "import re; print(re.search(r\"'chromium_version':\s*\n\s*'([^']+)'\", open('DEPS').read()).group(1))")
if ! [[ "$CHROMIUM_VERSION" =~ ^[0-9]+(\.[0-9]+){1,3}$ ]]; then
echo "error: unexpected chromium_version format: $CHROMIUM_VERSION" >&2
exit 1
fi
curl -sfL "https://raw.githubusercontent.com/chromium/chromium/${CHROMIUM_VERSION}/DEPS" -o /tmp/chromium-DEPS
SISO_SHA=$(python3 -c "import re; print(re.search(r\"'siso_version':\s*'git_revision:([0-9a-f]+)'\", open('/tmp/chromium-DEPS').read()).group(1))")
if ! [[ "$SISO_SHA" =~ ^[0-9a-f]{40}$ ]]; then
echo "error: unexpected siso_version SHA: $SISO_SHA" >&2
exit 1
fi
PATCHES_HASH=$(find .github/siso-patches -type f -name '*.patch' | sort | xargs sha256sum | sha256sum | awk '{print $1}')
echo "siso-sha=${SISO_SHA}" >> "$GITHUB_OUTPUT"
echo "patches-hash=${PATCHES_HASH}" >> "$GITHUB_OUTPUT"
echo "Chromium ${CHROMIUM_VERSION} pins siso at ${SISO_SHA}"
echo "Patches hash: ${PATCHES_HASH}"
- name: Restore cached siso binary
id: cache-siso
uses: actions/cache@27d5ce7f107fe9357f9df03efb73ab90386fccae # v5.0.5
with:
path: siso-out/siso.exe
key: siso-windows-amd64-${{ steps.resolve.outputs.siso-sha }}-${{ steps.resolve.outputs.patches-hash }}
- name: Shallow clone chromium build repo at pinned revision
if: steps.cache-siso.outputs.cache-hit != 'true'
env:
SISO_SHA: ${{ steps.resolve.outputs.siso-sha }}
run: |
set -euo pipefail
mkdir chromium-build
cd chromium-build
git init -q
git remote add origin https://chromium.googlesource.com/build
git -c protocol.version=2 fetch --depth=1 origin "$SISO_SHA"
git checkout --detach FETCH_HEAD
- name: Apply in-tree siso patches
if: steps.cache-siso.outputs.cache-hit != 'true'
run: |
set -euo pipefail
cd chromium-build
git -c user.name=electron-ci -c user.email=ci@electronjs.org \
am --3way "${GITHUB_WORKSPACE}/.github/siso-patches"/*.patch
- name: Set up Go
if: steps.cache-siso.outputs.cache-hit != 'true'
uses: actions/setup-go@4a3601121dd01d1626a1e23e37211e3254c1c06c # v6.4.0
with:
go-version-file: chromium-build/siso/go.mod
cache: false
- name: Build siso (windows/amd64)
if: steps.cache-siso.outputs.cache-hit != 'true'
working-directory: chromium-build/siso
env:
CGO_ENABLED: '0'
GOOS: windows
GOARCH: amd64
run: |
mkdir -p "${GITHUB_WORKSPACE}/siso-out"
go build -trimpath -o "${GITHUB_WORKSPACE}/siso-out/siso.exe" .
- name: Upload siso artifact
uses: actions/upload-artifact@043fb46d1a93c77aae656e7c1c64a875d1fc6a0a # v7.0.1
with:
name: siso-windows-amd64
path: siso-out/siso.exe
if-no-files-found: error
retention-days: 1

View File

@@ -48,17 +48,23 @@ on:
required: true
type: string
default: '0'
strip-binaries:
description: 'Strip the binaries before release (Linux only)'
required: false
type: boolean
default: false
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
upload-out-gen-artifacts:
description: 'Whether to upload the src/gen artifacts'
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
@@ -67,12 +73,13 @@ concurrency:
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || inputs.target-platform == 'win' && '--custom-var=checkout_win=True' || '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
@@ -80,20 +87,34 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: 'true'
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
@@ -102,9 +123,9 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@48b55a011bda9f5d6aeb4c2d9c7362e8dae4041e
with:
node-version: 20.11.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
@@ -134,7 +155,7 @@ jobs:
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
DEPSHASH=v2-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
@@ -146,7 +167,7 @@ jobs:
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -160,7 +181,7 @@ jobs:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: |
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }}
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
@@ -170,12 +191,25 @@ jobs:
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Setup Number of Ninja Processes
run: |
echo "NUMBER_OF_NINJA_PROCESSES=${{ inputs.target-platform != 'macos' && '300' || '200' }}" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Download custom siso binary (Windows)
if: ${{ inputs.target-platform == 'win' }}
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c # v8.0.1
with:
name: siso-windows-amd64
path: ${{ runner.temp }}/siso
- name: Set SISO_PATH (Windows)
if: ${{ inputs.target-platform == 'win' }}
run: |
SISO_BIN="${RUNNER_TEMP}/siso/siso.exe"
if [ ! -f "$SISO_BIN" ]; then
echo "error: expected siso binary at $SISO_BIN" >&2
exit 1
fi
echo "SISO_PATH=$SISO_BIN" >> "$GITHUB_ENV"
echo "Using custom siso binary at $SISO_BIN"
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' || inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
@@ -185,9 +219,9 @@ jobs:
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}
is-release: '${{ inputs.is-release }}'
generate-symbols: '${{ inputs.generate-symbols }}'
strip-binaries: '${{ inputs.strip-binaries }}'
upload-to-storage: '${{ inputs.upload-to-storage }}'
is-asan: '${{ inputs.is-asan }}'
upload-out-gen-artifacts: '${{ inputs.upload-out-gen-artifacts }}'
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' || inputs.target-variant == 'mas') }}
run: |

View File

@@ -0,0 +1,178 @@
name: Pipeline Segment - Electron Clang-Tidy
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
clang-tidy-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
permissions: {}
concurrency:
group: electron-clang-tidy-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref }}
cancel-in-progress: true
env:
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || (inputs.target-platform == 'linux' && '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' || '--custom-var=checkout_win=True') }}
ELECTRON_OUT_DIR: Default
jobs:
clang-tidy:
defaults:
run:
shell: bash
runs-on: ${{ inputs.clang-tidy-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.clang-tidy-container) }}
env:
BUILD_TYPE: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
ARTIFACT_KEY: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}_${{ inputs.target-arch }}
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Cleanup disk space on macOS
if: ${{ inputs.target-platform == 'macos' }}
shell: bash
run: |
sudo mkdir -p $TMPDIR/del-target
tmpify() {
if [ -d "$1" ]; then
sudo mv "$1" $TMPDIR/del-target/$(echo $1|shasum -a 256|head -n1|cut -d " " -f1)
fi
}
tmpify /Library/Developer/CoreSimulator
tmpify ~/Library/Developer/CoreSimulator
sudo rm -rf $TMPDIR/del-target
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Enable windows toolchain
if: ${{ inputs.target-platform == 'win' }}
run: |
echo "ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=1" >> $GITHUB_ENV
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v2-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' || inputs.target-platform == 'win' }}
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: ${{ inputs.target-platform }}
- name: Run Electron Only Hooks
run: |
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]" > tmpgclient
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False,'install_sysroot':False,'checkout_win':True},'managed':False}]" > tmpgclient
echo "target_os=['win']" >> tmpgclient
fi
e d gclient runhooks --gclientfile=tmpgclient
# Fix VS Toolchain
if [ "${{ inputs.target-platform }}" = "win" ]; then
rm -rf src/third_party/depot_tools/win_toolchain/vs_files
e d python3 src/build/vs_toolchain.py update --force
fi
- name: Regenerate DEPS Hash
run: |
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Default GN gen
run: |
cd src/electron
git pack-refs
- name: Download Out Gen Artifacts
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: out_gen_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src/out/${{ env.ELECTRON_OUT_DIR }}/gen
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Clang-Tidy
run: |
e init -f --root=$(pwd) --out=${ELECTRON_OUT_DIR} testing --target-cpu ${TARGET_ARCH} --remote-build none
# For macOS use_remoteexec=false will cause GN errors, so even though we're doing no remote build, set it
export GN_EXTRA_ARGS="use_remoteexec=true target_cpu=\"${TARGET_ARCH}\""
if [ "${{ inputs.target-platform }}" = "win" ]; then
export GN_EXTRA_ARGS="$GN_EXTRA_ARGS use_v8_context_snapshot=true target_os=\"win\""
fi
e build --only-gen
# Copy macOS framework headers so clang-tidy can find them via -F.
# This must happen after e build --only-gen since e init -f may
# recreate the output directory.
if [ "${{ inputs.target-platform }}" = "macos" ]; then
OUT=src/out/${ELECTRON_OUT_DIR}
SQRL=src/third_party/squirrel.mac
mkdir -p ${OUT}/{ReactiveObjC,Squirrel,Mantle}.framework/Headers
cp ${SQRL}/vendor/ReactiveObjC/ReactiveObjC/*.h ${OUT}/ReactiveObjC.framework/Headers/
cp ${SQRL}/vendor/ReactiveObjC/ReactiveObjC/extobjc/*.h ${OUT}/ReactiveObjC.framework/Headers/
cp ${SQRL}/Squirrel/*.h ${OUT}/Squirrel.framework/Headers/
cp ${SQRL}/vendor/Mantle/Mantle/include/*.h ${OUT}/Mantle.framework/Headers/
cp ${SQRL}/vendor/Mantle/Mantle/extobjc/include/*.h ${OUT}/Mantle.framework/Headers/
fi
cd src/electron
node script/yarn.js lint:clang-tidy --jobs 8 --out-dir ../out/${ELECTRON_OUT_DIR}
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
if: always() && !cancelled()
shell: bash
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
@@ -41,10 +43,12 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -77,7 +81,7 @@ jobs:
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
DEPSHASH=v2-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
@@ -111,7 +115,7 @@ jobs:
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -126,7 +130,7 @@ jobs:
run: |
for target_cpu in ${{ inputs.target-archs }}
do
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu $target_cpu
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu $target_cpu --remote-build none
cd src
export GN_EXTRA_ARGS="target_cpu=\"$target_cpu\""
if [ "${{ inputs.target-platform }}" = "linux" ]; then

View File

@@ -0,0 +1,258 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
upload-out-gen-artifacts:
description: Whether to upload the src/gen artifacts
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@48b55a011bda9f5d6aeb4c2d9c7362e8dae4041e
with:
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v2-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Download custom siso binary (Windows)
if: ${{ inputs.target-platform == 'win' }}
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: siso-windows-amd64
path: ${{ runner.temp }}/siso
- name: Set SISO_PATH (Windows)
if: ${{ inputs.target-platform == 'win' }}
run: |
SISO_BIN="${RUNNER_TEMP}/siso/siso.exe"
if [ ! -f "$SISO_BIN" ]; then
echo "error: expected siso binary at $SISO_BIN" >&2
exit 1
fi
echo "SISO_PATH=$SISO_BIN" >> "$GITHUB_ENV"
echo "Using custom siso binary at $SISO_BIN"
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
upload-out-gen-artifacts: ${{ inputs.upload-out-gen-artifacts }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -0,0 +1,67 @@
name: Pipeline Segment - Electron Test on Linux ARM64 64k
on:
workflow_call:
inputs:
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
test-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
concurrency:
group: electron-test-linux-64k-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions: {}
env:
ELECTRON_OUT_DIR: Default
jobs:
test-linux-arm64-64k:
env:
BUILD_TYPE: linux
TARGET_ARCH: arm64
defaults:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Download Generated Artifacts
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: generated_artifacts_linux_arm64
path: ./generated_artifacts_linux_arm64
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist
run: |
cd src/out/Default
unzip -:o dist.zip
- name: Run Electron Tests in QEMU 64k Container
shell: bash
env:
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: mocha-junit-reporter, tap
ELECTRON_DISABLE_SECURITY_WARNINGS: 1
DISPLAY: ':99.0'
run: |
container=$(echo '${{ inputs.test-container }}' | jq -r '.image')
src/electron/script/run-qemu-64k.sh --container $container --testfiles "`pwd`/src"

View File

@@ -25,21 +25,31 @@ on:
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
display-server:
description: 'Display backend for Linux tests: x11 or wayland'
required: false
type: string
default: x11
concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ inputs.display-server }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
ELECTRON_OUT_DIR: Default
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
# @sentry/cli is only needed by release upload-symbols.py; skip the ~17MB CDN download on test jobs
SENTRYCLI_SKIP_DOWNLOAD: 1
jobs:
test:
@@ -47,12 +57,16 @@ jobs:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
matrix:
build-type: ${{ inputs.target-platform == 'macos' && fromJSON('["darwin","mas"]') || (inputs.target-platform == 'win' && fromJSON('["win"]') || fromJSON('["linux"]')) }}
shard: ${{ inputs.target-platform == 'linux' && fromJSON('[1, 2, 3]') || fromJSON('[1, 2]') }}
shard: ${{ case(inputs.display-server == 'wayland', fromJSON('[1]'), inputs.target-platform == 'linux', fromJSON('[1, 2, 3]'), inputs.target-platform == 'macos' && inputs.target-arch == 'x64', fromJSON('[1, 2, 3]'), fromJSON('[1, 2]')) }}
env:
BUILD_TYPE: ${{ matrix.build-type }}
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -62,29 +76,16 @@ jobs:
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
- name: Install Git on Windows arm64 runners
if: ${{ inputs.target-arch == 'arm64' && inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
[System.Net.ServicePointManager]::SecurityProtocol = [System.Net.ServicePointManager]::SecurityProtocol -bor 3072
iex ((New-Object System.Net.WebClient).DownloadString('https://community.chocolatey.org/install.ps1'))
choco install -y --no-progress git.install --params "'/GitAndUnixToolsOnPath'"
choco install -y --no-progress git
choco install -y --no-progress python --version 3.11.9
choco install -y --no-progress visualstudio2022-workload-vctools --package-parameters "--add Microsoft.VisualStudio.Component.VC.Tools.ARM64"
echo "C:\Program Files\Git\cmd" | Out-File -FilePath $env:GITHUB_PATH -Encoding utf8 -Append
echo "C:\Program Files\Git\bin" | Out-File -FilePath $env:GITHUB_PATH -Encoding utf8 -Append
echo "C:\Python311" | Out-File -FilePath $env:GITHUB_PATH -Encoding utf8 -Append
cp "C:\Python311\python.exe" "C:\Python311\python3.exe"
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@49933ea5288caeca8642d1e84afbd3f7d6820020
uses: actions/setup-node@48b55a011bda9f5d6aeb4c2d9c7362e8dae4041e
with:
node-version: 20.11.x
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
configure_user_tccdb () {
local values=$1
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
@@ -100,14 +101,17 @@ jobs:
}
userValuesArray=(
"'kTCCServiceMicrophone','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
)
for values in "${userValuesArray[@]}"; do
# Sonoma and higher have a few extra values
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
if [ "$OSTYPE" = "darwin23" ]; then
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
else
@@ -118,12 +122,32 @@ jobs:
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
- name: Set xcode to 16.4
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: 'true'
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Set Chromium Git Cookie
@@ -135,7 +159,9 @@ jobs:
git config --global core.autocrlf false
git config --global branch.autosetuprebase always
git config --global core.fscache true
git config --global core.longpaths true
git config --global core.preloadindex true
git config --global core.longpaths true
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
@@ -149,57 +175,74 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver (win)
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
Expand-Archive -Force chromedriver.zip -DestinationPath ./
Expand-Archive -Force mksnapshot.zip -DestinationPath ./
- name: Unzip Dist, Mksnapshot & Chromedriver (unix)
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
if: ${{ inputs.target-platform == 'macos' }}
run: |
sudo security authorizationdb write com.apple.trust-settings.admin allow
cd src/electron
./script/codesign/generate-identity.sh
- name: Install Datadog CLI
# Sign with our self-signed cert so that macOS system integrations
# (UNNotifications, dock bounce, etc.) work in tests on both architectures.
# Autoupdater tests sign their own fixture copies via signApp().
- name: Sign Electron.app for macOS tests
if: ${{ inputs.target-platform == 'macos' }}
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
identity=$(src/electron/script/codesign/get-trusted-identity.sh)
if [ -n "$identity" ]; then
codesign -s "$identity" --deep --force src/out/Default/Electron.app
fi
- name: Run Electron Tests
shell: bash
timeout-minutes: 60
env:
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: mocha-junit-reporter, tap
ELECTRON_DISABLE_SECURITY_WARNINGS: 1
ELECTRON_SKIP_NATIVE_MODULE_TESTS: true
DISPLAY: ':99.0'
NPM_CONFIG_MSVS_VERSION: '2022'
run: |
cd src/electron
export ELECTRON_TEST_RESULTS_DIR=`pwd`/junit
# Get which tests are on this shard
tests_files=$(node script/split-tests ${{ matrix.shard }} ${{ inputs.target-platform == 'linux' && 3 || 2 }})
tests_files=$(node script/split-tests ${{ matrix.shard }} ${{ case(inputs.display-server == 'wayland', 1, inputs.target-platform == 'linux', 3, inputs.target-platform == 'macos' && inputs.target-arch == 'x64', 3, 2) }})
if [ "${{ inputs.display-server }}" = "wayland" ]; then
allowlist_file=script/wayland-test-allowlist.txt
filtered_tests=""
for test_file in $tests_files; do
if grep -Fxq "$test_file" "$allowlist_file"; then
filtered_tests="$filtered_tests $test_file"
fi
done
tests_files="${filtered_tests# }"
if [ -z "$tests_files" ]; then
echo "No tests matched Wayland filter, skipping."
exit 0
fi
fi
# Run tests
if [ "${{ inputs.target-platform }}" != "linux" ]; then
@@ -212,7 +255,7 @@ jobs:
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -229,11 +272,33 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
if [ "${{ inputs.display-server }}" = "wayland" ]; then
runuser -u builduser -- script/actions/run-tests-wayland.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
fi
- name: Take screenshot on timeout or cancellation
if: ${{ inputs.target-platform != 'linux' && (cancelled() || failure()) }}
shell: bash
run: |
screenshot_dir="src/electron/spec/artifacts"
mkdir -p "$screenshot_dir"
screenshot_file="$screenshot_dir/screenshot-timeout-$(date +%Y%m%d%H%M%S).png"
if [ "${{ inputs.target-platform }}" = "macos" ]; then
screencapture -x "$screenshot_file" || true
elif [ "${{ inputs.target-platform }}" = "win" ]; then
powershell -command "Add-Type -AssemblyName System.Windows.Forms; \$screen = [System.Windows.Forms.Screen]::PrimaryScreen.Bounds; \$bitmap = New-Object System.Drawing.Bitmap(\$screen.Width, \$screen.Height); \$graphics = [System.Drawing.Graphics]::FromImage(\$bitmap); \$graphics.CopyFromScreen(\$screen.Location, [System.Drawing.Point]::Empty, \$screen.Size); \$bitmap.Save('$screenshot_file')" || true
fi
- name: Upload Test results to Datadog
env:
DD_ENV: ci
@@ -243,15 +308,16 @@ jobs:
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
export DATADOG_PATH=`node src/electron/script/yarn global bin`
$DATADOG_PATH/datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always() && !cancelled()
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02
if: always()
uses: actions/upload-artifact@043fb46d1a93c77aae656e7c1c64a875d1fc6a0a #v7.0.1
with:
name: test_artifacts_${{ env.ARTIFACT_KEY }}_${{ matrix.shard }}
name: ${{ inputs.target-platform == 'linux' && format('test_artifacts_{0}_{1}_{2}', env.ARTIFACT_KEY, inputs.display-server, matrix.shard) || format('test_artifacts_{0}_{1}', env.ARTIFACT_KEY, matrix.shard) }}
path: src/electron/spec/artifacts
if-no-files-found: ignore
- name: Wait for active SSH sessions

View File

@@ -26,6 +26,8 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
@@ -34,11 +36,15 @@ env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
ELECTRON_OUT_DIR: Default
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
# @sentry/cli is only needed by release upload-symbols.py; skip the ~17MB CDN download on test jobs
SENTRYCLI_SKIP_DOWNLOAD: 1
jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-linux-amd64-8core
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -46,7 +52,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -61,12 +67,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -92,7 +98,9 @@ jobs:
done
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-linux-amd64-4core
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
@@ -100,7 +108,7 @@ jobs:
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -115,12 +123,12 @@ jobs:
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@d3f86a106a0bac45b974a628896c90dbdf5c8093
uses: actions/download-artifact@3e5f45b2cfb9172054b4087a40e8e0b5a5461e7c
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -132,10 +140,16 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()

64
.github/workflows/pr-template-check.yml vendored Normal file
View File

@@ -0,0 +1,64 @@
name: PR Template Check
on:
pull_request_target:
types: [opened, ready_for_review]
# SECURITY: This workflow uses pull_request_target and has access to secrets.
# Do NOT checkout or run code from the PR head. All code execution must use
# the base branch only. Adding a ref to PR head would expose secrets to
# untrusted code.
permissions: {}
jobs:
check-pr-template:
if: ${{ github.event.pull_request.head.repo.fork && !github.event.pull_request.draft && !startsWith(github.head_ref, 'roller/') }}
name: Check PR Template
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: write
steps:
- name: Checkout
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
sparse-checkout: .github/PULL_REQUEST_TEMPLATE.md
sparse-checkout-cone-mode: false
- name: Check for required sections
uses: actions/github-script@3a2844b7e9c422d3c10d287c895573f7108da1b3 # v9.0.0
with:
script: |
const fs = require('fs');
const template = fs.readFileSync('.github/PULL_REQUEST_TEMPLATE.md', 'utf8');
const requiredSections = [...template.matchAll(/^(#{1,4} .+)$/gm)].map(
(m) => m[1],
);
if (requiredSections.length === 0) {
console.log('No heading sections found in PR template');
return;
}
const body = context.payload.pull_request.body || '';
// Allow through if body contains a valid backport line
const backportRegex = /Backport of (?:#|https:\/\/github.com\/electron\/electron\/pull\/)\d+/i;
if (backportRegex.test(body)) {
console.log('Backport PR detected, skipping required section check.');
return;
}
const missingSections = requiredSections.filter(
(section) => !body.includes(section),
);
if (missingSections.length > 0) {
const list = missingSections.map((s) => `- \`${s}\``).join('\n');
await github.rest.issues.createComment({
owner: context.repo.owner,
repo: context.repo.repo,
issue_number: context.payload.pull_request.number,
body: `This PR was automatically closed because the PR template was not properly filled out. The following required sections are missing:\n\n${list}\n\nPlease update your PR description to include all required sections and reopen the PR.`,
});
await github.rest.pulls.update({
owner: context.repo.owner,
repo: context.repo.repo,
pull_number: context.payload.pull_request.number,
state: 'closed',
});
}

View File

@@ -0,0 +1,56 @@
name: PR Triage Automation
on:
pull_request_target:
types: [synchronize, review_requested]
issue_comment:
types: [created]
# SECURITY: This workflow uses pull_request_target and has access to secrets.
# Do NOT checkout or run code from the PR head. All code execution must use
# the base branch only. Adding a ref to PR head would expose secrets to
# untrusted code.
permissions: {}
jobs:
set-needs-review:
name: Set status to Needs Review
if: >-
(github.event_name == 'pull_request_target'
&& github.event.pull_request.state == 'open'
&& github.event.pull_request.draft != true
&& !contains(github.event.pull_request.labels.*.name, 'wip ⚒')
&& (github.event.action == 'synchronize' || github.event.action == 'review_requested'))
|| (github.event_name == 'issue_comment'
&& github.event.issue.pull_request
&& github.event.issue.state == 'open'
&& !contains(github.event.issue.labels.*.name, 'wip ⚒')
&& github.event.comment.user.login == github.event.issue.user.login)
runs-on: ubuntu-slim
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Get project item status
uses: dsanders11/project-actions/get-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
id: get-item
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 118
fail-if-item-not-found: false
- name: Set status to Needs Review
if: >-
(steps.get-item.outputs.field-status == '🛑 Needs Submitter Response'
|| steps.get-item.outputs.field-status == '🟡 WIP')
uses: dsanders11/project-actions/edit-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 118
field: Status
field-value: 🌀 Needs Review
fail-if-item-not-found: false

View File

@@ -4,6 +4,10 @@ on:
pull_request_target:
types: [labeled]
# SECURITY: This workflow uses pull_request_target and has access to secrets.
# Do NOT checkout or run code from the PR head. All code execution must use
# the base branch only. Adding a ref to PR head would expose secrets to
# untrusted code.
permissions: {}
jobs:
@@ -11,31 +15,68 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@485a9d42d3a73031f12ec201c457e2162c45d02d # v2.0.0
uses: slackapi/slack-github-action@af78098f536edbc4de71162a307590698245be95 # v3.0.1
with:
webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
org: electron
- name: Set status
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/edit-item@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 94
field: Status
field-value: ✅ Reviewed
pull-request-labeled-ai-pr:
name: ai-pr label added
if: github.event.label.name == 'ai-pr' && github.event.pull_request.state != 'closed'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
uses: actions-cool/issues-helper@200c78641dbf33838311e5a1e0c31bbdb92d7cf0 # v3.8.0
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}
issue-number: ${{ github.event.pull_request.number }}
body: |
<!-- ai-pr -->
*AI PR Detected*
Hello @${{ github.event.pull_request.user.login }}. Due to the high amount of AI spam PRs we receive, if a PR is detected to be majority AI-generated without disclosure and untested, we will automatically close the PR.
We welcome the use of AI tools, as long as the PR meets our quality standards and has clearly been built and tested. If you believe your PR was closed in error, we welcome you to resubmit. However, please read our [CONTRIBUTING.md](https://github.com/electron/electron/blob/main/CONTRIBUTING.md) and [AI Tool Policy](https://github.com/electron/governance/blob/main/policy/ai.md) carefully before reopening. Thanks for your contribution.
- name: Close the pull request
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
GH_REPO: electron/electron
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
gh pr close "$PR_NUMBER"

View File

@@ -0,0 +1,46 @@
name: Pull Request Opened/Synchronized
on:
pull_request_target:
types: [opened, synchronize]
# SECURITY: This workflow uses pull_request_target and has access to secrets.
# Do NOT checkout or run code from the PR head. All code execution must use
# the base branch only. Adding a ref to PR head would expose secrets to
# untrusted code.
permissions: {}
jobs:
check-signed-commits:
name: Check signed commits in PR
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: write
steps:
- name: Check signed commits in PR
uses: 1Password/check-signed-commits-action@ed2885f3ed2577a4f5d3c3fe895432a557d23d52 # v1
with:
comment: |
⚠️ This PR contains unsigned commits. This repository enforces [commit signatures](https://docs.github.com/en/authentication/managing-commit-signature-verification)
for all incoming PRs. To get your PR merged, please sign those commits
(`git rebase --exec 'git commit -S --amend --no-edit -n' @{upstream}`) and force push them to this branch
(`git push --force-with-lease`)
For more information on signing commits, see GitHub's documentation on [Telling Git about your signing key](https://docs.github.com/en/authentication/managing-commit-signature-verification/telling-git-about-your-signing-key).
- name: Add needs-signed-commits label
if: ${{ failure() }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
gh pr edit $PR_URL --add-label needs-signed-commits
- name: Remove needs-signed-commits label
if: ${{ success() && contains(github.event.pull_request.labels.*.name, 'needs-signed-commits') }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
gh pr edit $PR_URL --remove-label needs-signed-commits

View File

@@ -0,0 +1,71 @@
name: Rerun PR Apply Patches
on:
push:
branches:
- main
- '[1-9][0-9]-x-y'
paths:
- 'DEPS'
- 'patches/**'
permissions: {}
jobs:
rerun-apply-patches:
runs-on: ubuntu-latest
permissions:
actions: write
checks: read
contents: read
pull-requests: read
steps:
- name: Find PRs and Rerun Apply Patches
env:
GH_REPO: ${{ github.repository }}
GH_TOKEN: ${{ github.token }}
run: |
BRANCH="${GITHUB_REF#refs/heads/}"
# Find all open PRs targeting this branch
PRS=$(gh pr list --base "$BRANCH" --state open --limit 250 --json number)
echo "$PRS" | jq -c '.[]' | while read -r pr; do
PR_NUMBER=$(echo "$pr" | jq -r '.number')
echo "Processing PR #${PR_NUMBER}"
# Find the Apply Patches workflow check for this PR
CHECK=$(gh pr view "$PR_NUMBER" --json statusCheckRollup --jq '[.statusCheckRollup[] | select(.workflowName == "Apply Patches" and .name == "apply-patches")] | first')
if [ -z "$CHECK" ] || [ "$CHECK" = "null" ]; then
echo " No Apply Patches workflow found for PR #${PR_NUMBER}"
continue
fi
CONCLUSION=$(echo "$CHECK" | jq -r '.conclusion')
if [ "$CONCLUSION" = "SKIPPED" ]; then
echo " apply-patches job was skipped for PR #${PR_NUMBER} (no patches)"
continue
fi
LINK=$(echo "$CHECK" | jq -r '.detailsUrl')
# Extract the run ID from the link (format: .../runs/RUN_ID/job/JOB_ID)
RUN_ID=$(echo "$LINK" | grep -oE 'runs/[0-9]+' | cut -d'/' -f2)
if [ -z "$RUN_ID" ]; then
echo " Could not extract run ID from link: ${LINK}"
continue
fi
# Check if the workflow is currently in progress
RUN_STATUS=$(gh run view "$RUN_ID" --json status --jq '.status')
if [ "$RUN_STATUS" = "in_progress" ] || [ "$RUN_STATUS" = "queued" ] || [ "$RUN_STATUS" = "waiting" ]; then
echo " Workflow run ${RUN_ID} is ${RUN_STATUS}, cancelling..."
gh run cancel "$RUN_ID" --force
gh run watch "$RUN_ID"
fi
gh run rerun "$RUN_ID"
done

View File

@@ -13,6 +13,7 @@ permissions: read-all
jobs:
analysis:
name: Scorecards analysis
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
# Needed to upload the results to code-scanning dashboard.
@@ -22,13 +23,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683 # v4.2.2
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@f49aabe0b5af0936a0987cfb85d86b75731b0186 # v2.4.1
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +43,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@ea165f8d65b6e75b540449e92b4886f43607fa02 # v4.6.2
uses: actions/upload-artifact@043fb46d1a93c77aae656e7c1c64a875d1fc6a0a # v7.0.1
with:
name: SARIF file
path: results.sarif
@@ -50,6 +51,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@45775bd8235c68ba998cffa5171334d58593da47 # v3.28.15
uses: github/codeql-action/upload-sarif@95e58e9a2cdfd71adc6e0353d5c52f41a045d225 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:
@@ -19,7 +18,7 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: semantic-pull-request
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
with:

View File

@@ -10,10 +10,12 @@ permissions: {}
jobs:
check-stable-prep-items:
name: Check Stable Prep Items
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
@@ -27,7 +29,7 @@ jobs:
PROJECT_NUMBER=$(gh project list --owner electron --format json | jq -r '.projects | map(select(.title | test("^[0-9]+-x-y$"))) | max_by(.number) | .number')
echo "PROJECT_NUMBER=$PROJECT_NUMBER" >> "$GITHUB_OUTPUT"
- name: Update Completed Stable Prep Items
uses: dsanders11/project-actions/completed-by@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
uses: dsanders11/project-actions/completed-by@4b06452b0128cf601dac14399aa668a8eed2d684 # v2.0.1
with:
field: Prep Status
field-value: ✅ Complete

View File

@@ -9,14 +9,16 @@ permissions: {}
jobs:
stale:
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@b5d41d4e1d5dceea10e7104786b73624c18a190f # tag: v10.2.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,19 +29,20 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
if: ${{ always() }}
permissions: {}
if: ${{ always() && github.repository == 'electron/electron' }}
needs: stale
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@5bef64f19d7facfb25b37b414482c7164d639639 # tag: v9.1.0
- uses: actions/stale@b5d41d4e1d5dceea10e7104786b73624c18a190f # tag: v10.2.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -0,0 +1,39 @@
name: Update Website Docs
on:
release:
types: [published]
permissions: {}
jobs:
update-website-docs:
name: Update Website Docs
runs-on: ubuntu-latest
environment: website-docs-updater
permissions:
contents: read
id-token: write # needed for secret-service-action
steps:
- name: Get GitHub App token
id: secret-service
uses: electron/secret-service-action@3476425e8b30555aac15b1b7096938e254b0e155 # v1.0.0
- name: Check if this release is the latest
id: check-if-latest-release
env:
GH_REPO: electron/electron
GH_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
LATEST_RELEASE_TAG="$(gh release view --json tagName --jq '.tagName')"
if [ "$LATEST_RELEASE_TAG" = "${GITHUB_REF#refs/tags/}" ]; then
echo "isLatestRelease=true" >> $GITHUB_OUTPUT
else
echo "isLatestRelease=false" >> $GITHUB_OUTPUT
fi
- name: Trigger website docs update
if: ${{ steps.check-if-latest-release.outputs.isLatestRelease == 'true' }}
env:
GH_REPO: electron/website
GH_TOKEN: ${{ fromJSON(steps.secret-service.outputs.secrets).WEBSITE_DOCS_UPDATER_APP_TOKEN }}
run: |
gh workflow run update-docs.yml -f sha=$GITHUB_SHA

View File

@@ -6,8 +6,8 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: '424eedbf277ad9749ffa9219068aa72ed4a5e373'
required: true
default: ''
required: false
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -18,11 +18,31 @@ on:
type: boolean
default: false
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
outputs:
build-image-sha: ${{ steps.build-image-sha.outputs.build-image-sha }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
- name: Set Build Image SHA
id: build-image-sha
uses: ./.github/actions/build-image-sha
with:
override: ${{ inputs.build-image-sha }}
checkout-windows:
runs-on: electron-arc-linux-amd64-32core
needs: setup
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
@@ -32,11 +52,9 @@ jobs:
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_win=True'
TARGET_OS: 'win'
ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN: '1'
outputs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@11bd71901bbe5b1630ceea73d27597364c9af683
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -46,12 +64,25 @@ jobs:
generate-sas-token: 'true'
target-platform: win
# Build the patched siso binary in parallel with checkout-windows; the
# publish-*-win jobs consume it via SISO_PATH.
build-siso-windows:
needs: setup
uses: ./.github/workflows/pipeline-segment-build-siso-windows.yml
permissions:
contents: read
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
needs: checkout-windows
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: [checkout-windows, build-siso-windows]
with:
environment: production-release
build-runs-on: electron-arc-windows-amd64-16core
build-runs-on: electron-arc-centralus-windows-amd64-32core
target-platform: win
target-arch: x64
is-release: true
@@ -61,11 +92,16 @@ jobs:
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
needs: checkout-windows
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: [checkout-windows, build-siso-windows]
with:
environment: production-release
build-runs-on: electron-arc-windows-amd64-16core
build-runs-on: electron-arc-centralus-windows-amd64-32core
target-platform: win
target-arch: arm64
is-release: true
@@ -75,11 +111,16 @@ jobs:
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
needs: checkout-windows
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: [checkout-windows, build-siso-windows]
with:
environment: production-release
build-runs-on: electron-arc-windows-amd64-16core
build-runs-on: electron-arc-centralus-windows-amd64-32core
target-platform: win
target-arch: x86
is-release: true

3
.gitignore vendored
View File

@@ -42,6 +42,7 @@ spec/.hash
# Generated native addon files
/spec/fixtures/native-addon/echo/build/
/spec/fixtures/native-addon/dialog-helper/build/
# If someone runs tsc this is where stuff will end up
ts-gen
@@ -53,3 +54,5 @@ ts-gen
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

View File

@@ -1,4 +1 @@
#!/bin/sh
. "$(dirname "$0")/_/husky.sh"
npm run precommit

View File

@@ -1,4 +1 @@
#!/bin/sh
. "$(dirname "$0")/_/husky.sh"
npm run prepack

View File

@@ -1,6 +1,7 @@
{
"config": {
"extends": "@electron/lint-roller/configs/markdownlint.json",
"descriptive-link-text": false,
"link-image-style": {
"autolink": false,
"shortcut": false
@@ -20,12 +21,14 @@
"ul",
"unknown",
"Tabs",
"TabItem"
"TabItem",
"DocCardList",
"kbd"
]
},
"no-newline-in-links": true
},
"customRules": [
"@electron/lint-roller/markdownlint-rules/"
"./node_modules/@electron/lint-roller/markdownlint-rules/index.mjs"
]
}

2
.nvmrc
View File

@@ -1 +1 @@
20
22

47
.oxfmtrc.json Normal file
View File

@@ -0,0 +1,47 @@
{
"$schema": "./node_modules/oxfmt/configuration_schema.json",
"printWidth": 120,
"tabWidth": 2,
"singleQuote": true,
"trailingComma": "none",
"sortImports": {
"newlinesBetween": true,
"groups": [
"electron-internal",
"electron-scoped",
"electron",
"external",
"builtin",
["sibling", "parent"],
"index",
"type",
"unknown"
],
"customGroups": [
{
"groupName": "electron-internal",
"elementNamePattern": ["@electron/internal", "@electron/internal/**"]
},
{
"groupName": "electron-scoped",
"elementNamePattern": ["@electron/**"]
},
{
"groupName": "electron",
"elementNamePattern": ["electron", "electron/**"]
}
]
},
"ignorePatterns": [
"node_modules",
"out",
"ts-gen",
"spec/node_modules",
"spec/fixtures/native-addon",
".github/workflows/node_modules",
"docs/fiddles",
"shell/browser/resources/win/resource.h",
"shell/common/node_includes.h",
"spec/fixtures/pages/jquery-3.6.0.min.js"
]
}

329
.oxlintrc.json Normal file
View File

@@ -0,0 +1,329 @@
{
"$schema": "./node_modules/oxlint/configuration_schema.json",
"plugins": [
"typescript",
"import",
"node",
"promise",
"unicorn"
],
"jsPlugins": [
{
"name": "no-only-tests",
"specifier": "./script/lint-plugins/no-only-tests.mjs"
}
],
"categories": {
"correctness": "off"
},
"options": {
"typeAware": false
},
"env": {
"builtin": true,
"browser": true
},
"ignorePatterns": [
".github/workflows/node_modules",
"spec/node_modules",
"spec/fixtures/native-addon",
"shell/browser/resources/win/resource.h",
"shell/common/node_includes.h",
"spec/fixtures/pages/jquery-3.6.0.min.js"
],
"rules": {
"no-var": "error",
"accessor-pairs": [
"error",
{
"setWithoutGet": true,
"enforceForClassMembers": true
}
],
"array-callback-return": [
"error",
{
"allowImplicit": false,
"checkForEach": false
}
],
"constructor-super": "error",
"curly": [
"error",
"multi-line"
],
"default-case-last": "error",
"eqeqeq": [
"error",
"always",
{
"null": "ignore"
}
],
"new-cap": [
"error",
{
"newIsCap": true,
"capIsNew": false,
"properties": true
}
],
"no-array-constructor": "error",
"no-async-promise-executor": "error",
"no-caller": "error",
"no-case-declarations": "error",
"no-class-assign": "error",
"no-compare-neg-zero": "error",
"no-cond-assign": "error",
"no-const-assign": "error",
"no-constant-condition": [
"error",
{
"checkLoops": false
}
],
"no-control-regex": "error",
"no-debugger": "error",
"no-delete-var": "error",
"no-dupe-class-members": "error",
"no-dupe-keys": "error",
"no-duplicate-case": "error",
"no-useless-backreference": "error",
"no-empty": [
"error",
{
"allowEmptyCatch": true
}
],
"no-empty-character-class": "error",
"no-empty-pattern": "error",
"no-eval": "error",
"no-ex-assign": "error",
"no-extend-native": "error",
"no-extra-bind": "error",
"no-extra-boolean-cast": "error",
"no-fallthrough": "error",
"no-func-assign": "error",
"no-global-assign": "error",
"no-import-assign": "error",
"no-invalid-regexp": "error",
"no-irregular-whitespace": "error",
"no-iterator": "error",
"no-labels": [
"error",
{
"allowLoop": false,
"allowSwitch": false
}
],
"no-lone-blocks": "error",
"no-loss-of-precision": "error",
"no-misleading-character-class": "error",
"no-prototype-builtins": "error",
"no-useless-catch": "error",
"no-useless-constructor": "error",
"no-use-before-define": [
"error",
{
"functions": false,
"classes": false,
"variables": false
}
],
"no-multi-str": "error",
"no-new": "error",
"no-new-func": "error",
"no-new-wrappers": "error",
"no-obj-calls": "error",
"no-proto": "error",
"no-redeclare": [
"error"
],
"no-regex-spaces": "error",
"no-return-assign": [
"error",
"except-parens"
],
"no-self-assign": [
"error",
{
"props": true
}
],
"no-self-compare": "error",
"no-sequences": "error",
"no-shadow-restricted-names": "error",
"no-sparse-arrays": "error",
"no-template-curly-in-string": "error",
"no-this-before-super": "error",
"no-throw-literal": "error",
"no-unexpected-multiline": "error",
"no-unmodified-loop-condition": "error",
"no-unneeded-ternary": [
"error",
{
"defaultAssignment": false
}
],
"no-unreachable": "error",
"no-unsafe-finally": "error",
"no-unsafe-negation": "error",
"no-unused-vars": [
"error",
{
"vars": "all",
"args": "after-used",
"argsIgnorePattern": "^_",
"ignoreRestSiblings": true
}
],
"no-useless-call": "error",
"no-useless-computed-key": "error",
"no-useless-escape": "error",
"no-useless-rename": "error",
"no-useless-return": "error",
"no-void": "error",
"no-with": "error",
"prefer-const": [
"error",
{
"destructuring": "all"
}
],
"prefer-promise-reject-errors": "error",
"symbol-description": "error",
"unicode-bom": [
"error",
"never"
],
"use-isnan": [
"error",
{
"enforceForSwitchCase": true,
"enforceForIndexOf": true
}
],
"valid-typeof": [
"error",
{
"requireStringLiterals": true
}
],
"yoda": [
"error",
"never"
],
"import/export": "error",
"import/first": "error",
"import/no-absolute-path": [
"error",
{
"esmodule": true,
"commonjs": true,
"amd": false
}
],
"import/no-duplicates": "error",
"import/no-named-default": "error",
"import/no-webpack-loader-syntax": "error",
"promise/param-names": "error",
"guard-for-in": "error",
"node/handle-callback-err": [
"error",
"^(err|error)$"
],
"node/no-exports-assign": "error",
"node/no-new-require": "error",
"node/no-path-concat": "error"
},
"overrides": [
{
"files": ["**/*.ts", "**/*.tsx", "**/*.mts", "**/*.cts"],
"rules": {
"no-use-before-define": "off"
}
},
{
"files": ["lib/browser/**", "lib/utility/**"],
"rules": {
"no-restricted-imports": [
"error",
{
"paths": ["electron", "electron/renderer"],
"patterns": [
"./*",
"../*",
"@electron/internal/isolated_renderer/*",
"@electron/internal/renderer/*",
"@electron/internal/sandboxed_worker/*",
"@electron/internal/worker/*"
]
}
]
}
},
{
"files": [
"lib/renderer/**",
"lib/worker/**",
"lib/preload_realm/**",
"lib/sandboxed_renderer/**",
"lib/isolated_renderer/**"
],
"rules": {
"no-restricted-imports": [
"error",
{
"paths": ["electron", "electron/main"],
"patterns": ["./*", "../*", "@electron/internal/browser/*"]
}
]
}
},
{
"files": ["lib/common/**"],
"rules": {
"no-restricted-imports": [
"error",
{
"paths": ["electron", "electron/main", "electron/renderer"],
"patterns": [
"./*",
"../*",
"@electron/internal/browser/*",
"@electron/internal/isolated_renderer/*",
"@electron/internal/renderer/*",
"@electron/internal/sandboxed_worker/*",
"@electron/internal/worker/*"
]
}
]
}
},
{
"files": [
"build/**",
"script/**",
"docs/**",
"default_app/**",
"spec/**"
],
"rules": {
"unicorn/prefer-node-protocol": "error"
}
},
{
"files": ["spec/**/*.ts", "spec/**/*.js", "spec/**/*.mjs"],
"rules": {
"no-only-tests/no-only-tests": "error"
}
},
{
"files": ["**/*.d.ts"],
"rules": {
"no-useless-constructor": "off",
"no-unused-vars": "off"
}
}
]
}

View File

@@ -1,6 +0,0 @@
{
"plugins": [
["remark-lint-code-block-style", "fenced"],
["remark-lint-fenced-code-flag"]
]
}

82
.yarn/README.md Normal file
View File

@@ -0,0 +1,82 @@
# Vendored Yarn release
This directory holds the Yarn release used by this repo (`yarnPath` in
`.yarnrc.yml`). The release file is checked in so every contributor and CI job
runs the exact same Yarn, and so we can carry small local patches when needed.
`releases/yarn-4.12.0.cjs` currently carries one such patch, described below.
If you bump the Yarn version, read the **Upgrading Yarn** section first.
## Patch: use `JsZipImpl` for the node-modules link step
### What changed
Two call sites in `releases/yarn-4.12.0.cjs` are modified so the
`node-modules` linker (and the `pnpm`-loose linker) construct their read-only
`ZipOpenFS` with `customZipImplementation: ST` — Yarn's pure-JS `JsZipImpl`
instead of falling through to the default WASM-backed `LibZipImpl`:
```text
new $f({maxOpenFiles:80,readOnlyArchives:!0})
→ new $f({maxOpenFiles:80,readOnlyArchives:!0,customZipImplementation:ST})
```
A comment block at the top of the `.cjs` file marks the file as patched and
points back here.
### Why
On the `linux-arm` CI test shards we run a 32-bit `arm32v7` container. During
`yarn install`'s **Link step**, Yarn opens up to 80 cache zips concurrently.
With `LibZipImpl`, each open zip is `readFileSync`'d into a Node `Buffer`
**and copied again into the WASM linear memory**, and every file read does a
WASM `_malloc(size)` for the entry. The WASM heap has to grow as a single
contiguous region of the 32-bit address space; once enough zips are resident,
the `_malloc` for a large entry — most often `typescript/lib/typescript.js`
(~9 MB inside a ~22 MB zip) — fails.
Yarn's cross-FS `copyFilePromise` swallows the underlying error and re-throws
a generic one, so CI shows:
```text
YN0001: While persisting .../typescript-patch-...zip/node_modules/typescript/
EINVAL: invalid argument, copyfile '/node_modules/typescript/lib/typescript.js' -> '...'
```
The unmasked form (occasionally seen on `pdfjs-dist`) is the WASM-heap failure
string `Couldn't allocate enough memory`. This started failing ~1-in-3
`linux-arm / test` shards at **Install Dependencies** on 2026-04-13, after
[#50692](https://github.com/electron/electron/pull/50692) grew the cache enough
to push the 32-bit process over the edge nondeterministically — e.g.
[run 24739817558](https://github.com/electron/electron/actions/runs/24739817558/job/72380803746).
`JsZipImpl` avoids the problem entirely: it opens the zip by file descriptor,
reads only the central directory into memory, and `readSync`s individual
entries into ordinary Node `Buffer`s — **no WASM heap involved**. It is
read-only and path-based, which is exactly how the linker uses these archives.
There is no `.yarnrc.yml` setting or environment variable to select the zip
implementation (verified against the bundle), so editing the vendored release
is the only way to switch it short of re-implementing the linker in a plugin.
Upstream references:
[yarnpkg/berry#3972](https://github.com/yarnpkg/berry/issues/3972),
[yarnpkg/berry#6722](https://github.com/yarnpkg/berry/issues/6722),
[yarnpkg/berry#6550](https://github.com/yarnpkg/berry/issues/6550).
### Upgrading Yarn
When bumping `releases/yarn-*.cjs`:
1. Check whether upstream now defaults `readOnlyArchives` opens to `JsZipImpl`,
or exposes a config knob for the zip implementation. If so, drop this patch.
2. Otherwise, re-apply: search the new bundle for
`maxOpenFiles:80,readOnlyArchives:!0` (the surrounding minified identifiers
will differ) and add `,customZipImplementation:<JsZipImpl symbol>` — that
symbol is whatever the new bundle exports as `JsZipImpl` from
`@yarnpkg/libzip`.
3. Re-add the header comment pointing back to this README.
4. Verify with
`rm -rf node_modules spec/node_modules && node script/yarn.js install --immutable --mode=skip-build`
and confirm `node_modules/typescript/lib/typescript.js` is byte-identical to
an unpatched install.

945
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

16
.yarnrc.yml Normal file
View File

@@ -0,0 +1,16 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
httpProxy: "${HTTP_PROXY:-}"
httpsProxy: "${HTTPS_PROXY:-}"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

Some files were not shown because too many files have changed in this diff Show More