Compare commits

..

1923 Commits

Author SHA1 Message Date
trop[bot]
ba46942463 fix: register PrintDialogLinuxFactory on Linux (#50487)
fix: register PrintDialogLinuxFactory on Linux

Chromium 145 refactored Linux print dialog creation to use a factory
pattern instead of directly calling LinuxUi::CreatePrintDialog().
Chrome registers this factory in
ChromeBrowserMainExtraPartsViewsLinux::ToolkitInitialized(), but
Electron did not, causing PrintingContextLinux::EnsurePrintDialog()
to leave print_dialog_ null on every call.

Without a dialog, UseDefaultSettings() and UpdatePrinterSettings()
return success but with empty/unprocessed settings, causing
PrintMsgPrintParamsIsValid() to fail. This broke both window.print()
(no dialog appears) and webContents.print() (callback stuck until
app close with "Invalid printer settings").

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-26 11:48:00 -04:00
trop[bot]
602119ea25 fix: fall back to default DPI when GTK returns 0 on Linux (#50490)
GetDefaultPrinterDPI() creates a blank GtkPrintSettings and reads
its resolution, which returns 0 for uninitialized settings. With
DPI=0, SetPrintableAreaIfValid() computes a zero scale factor,
producing empty page dimensions that fail PrintMsgPrintParamsIsValid().

Fall back to kDefaultPdfDpi (72) when GTK returns 0, matching the
existing Windows fallback pattern when CreateDC fails.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-26 11:47:08 -04:00
trop[bot]
8f0f8401f2 refactor: remove dead named-window lookup from guest-window-manager (#50496)
The frameNamesToWindow map was a holdover from the BrowserWindowProxy
IPC shim. Since nativeWindowOpen became the only code path, Blink's
FrameTree::FindOrCreateFrameForNavigation resolves named window targets
directly in the renderer, scoped to the opener's browsing context
group. When a matching named window exists, Blink navigates it without
ever sending a CreateNewWindow IPC to the browser, so this map was
never consulted in the legitimate same-opener case.

The only time the map found a match was when two unrelated renderers
happened to use the same target name, in which case openGuestWindow
would short-circuit before consuming the guest WebContents that
Chromium had already created for the new window, leaking it.

Adds a test verifying Blink handles same-opener named-target reuse
end-to-end without any browser-side tracking.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sam Attard <sattard@anthropic.com>
2026-03-26 11:46:44 -04:00
trop[bot]
f90dd8d6bd fix: [a11y] fire AXMenuOpened event when ARIA menu is added to DOM (#50504)
* fix: fire AXMenuOpened event when a visible ARIA menu instance is added to the DOM

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: remove redundent FireMenuPopupEndForDeletedMenus

MENU_POPUP_END for deleted menus is already handled by
AXTreeManager::OnNodeWillBeDeleted, which
fires the event directly on the menu node before destruction.

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* chore: add feature flag (kDynamicMenuPopupEvents)

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: update patches

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* chore: update patches

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-03-26 11:45:26 -04:00
trop[bot]
6dfb19210b ci: add functionality for programmatic add/remove needs-signed-commits label (#50503)
* remove comment based label removal

Co-authored-by: Michaela Laurencin <mlaurencin@electronjs.org>

* ci: add functionality for programmatic add/remove needs-signed-commits label

Co-authored-by: Michaela Laurencin <mlaurencin@electronjs.org>

* add new line to pull-request-opened-synchronized

Co-authored-by: Michaela Laurencin <mlaurencin@electronjs.org>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Michaela Laurencin <mlaurencin@electronjs.org>
2026-03-26 09:16:34 -04:00
trop[bot]
119127b23a fix: crash calling OSR shared texture release() after texture GC'd (#50502)
The weak persistent tracking the OffscreenReleaseHolderMonitor was tied
to the texture object, but the release() closure holds a raw pointer to
the monitor via its v8::External data. If JS retained texture.release
while dropping the texture itself, the monitor would be freed on GC and
a later release() call would crash.

Track the release function instead of the texture object. Since the
texture holds release as a property, this keeps the monitor alive as
long as either is reachable.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sam Attard <sattard@anthropic.com>
2026-03-26 00:49:54 -07:00
trop[bot]
a806e3890f fix: crash in clipboard.readImage() on malformed image data (#50494)
gfx::PNGCodec::Decode() returns a null SkBitmap when it fails to decode
the clipboard contents as a PNG. Passing that null bitmap to
gfx::Image::CreateFrom1xBitmap() triggers a crash.

Return an empty gfx::Image instead, matching the existing null-check
pattern in skia_util.cc.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sam Attard <sattard@anthropic.com>
2026-03-25 23:22:43 -07:00
trop[bot]
e48835e4e0 feat: add accessibilityDisplayShouldDifferentiateWithoutColor on macOS (#50409)
feat: add nativeTheme.shouldDifferentiateWithoutColor on macOS

Adds nativeTheme.shouldDifferentiateWithoutColor on macOS that maps to
NSWorkspace.accessibilityDisplayShouldDifferentiateWithoutColor. If true,
the user has indicated that they prefer UI that differentiates items with
something other than color alone. This is useful for users with color
vision deficiency.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Robert Böhnke <robb@robb.is>
2026-03-25 15:50:57 -04:00
trop[bot]
7dfd55b8ea feat: support notification priority on Windows (#50383)
* feat: support notification priority on Windows

Add Windows notifications support urgency/priority levels.
This maps the existing `urgency` option (previously Linux-only) to
Windows toast notification priorities:

- 'critical' maps to ToastNotificationPriority_High, which sorts the
  notification above default-priority items in Action Center.
- 'normal' and 'low' both map to ToastNotificationPriority_Default.

Note that on Windows, 'critical' priority does not prevent the toast
from being auto-dismissed. Users should additionally set `timeoutType`
to 'never' for that behavior.

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: make linter happy

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-25 15:49:53 -04:00
trop[bot]
e02471eba0 chore: remove redundant chromium patches (#50472)
- export_gin_v8platform_pageallocator_for_usage_outside_of_the_gin.patch:
  gin::V8Platform::GetPageAllocator() is now exported upstream via the
  public v8::Platform interface, so we no longer need to patch gin to
  expose a custom accessor. Update javascript_environment.cc to use the
  upstream API instead.

- fix_getcursorscreenpoint_wrongly_returns_0_0.patch: this fix has
  landed upstream in Chromium and is no longer needed as a local patch.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Sam Attard <sattard@anthropic.com>
2026-03-25 13:00:13 -04:00
trop[bot]
83615377dc fix: deprecate ELECTRON_SKIP_BINARY_DOWNLOAD env (#50459)
* fix: remove ELECTRON_SKIP_BINARY_DOWNLOAD

it is redundant as of electron v42
its purpose was to skip the binary download for post install script
but as of electron v42, post install script is gone
and replaced with a lazy download

it was also slated for removal in [this comment](https://github.com/electron/rfcs/pull/22#issuecomment-3387307743)

Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>

* docs: remove ELECTRON_SKIP_BINARY_DOWNLOAD section

the env is redundant as of electron v42
so docs don't have to mention it anymore

Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>

* docs: add ELECTRON_SKIP_BINARY_DOWNLOAD to breaking changes

Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>
2026-03-24 12:32:26 -04:00
trop[bot]
f8eb1b2a31 chore: bump chromium to 148.0.7741.0 (42-x-y) (#50426)
* chore: bump chromium in DEPS to 148.0.7739.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: bump chromium in DEPS to 148.0.7740.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* 7654582: Delete obsolete kEnableServiceWorkersForChromeScheme feature flag.

https://chromium-review.googlesource.com/c/chromium/src/+/7654582

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7664982: Move SharedModuleService to //extensions

https://chromium-review.googlesource.com/c/chromium/src/+/7664982

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump chromium in DEPS to 148.0.7741.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7666060: [CodeHealth] Replace `RequestPermissions` with `RequestPermissionsFromCurrentDocument`

https://chromium-review.googlesource.com/c/chromium/src/+/7666060

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-23 14:23:20 +01:00
trop[bot]
d23fbd5c71 docs: remove postinstall lifecycle warning (#50405)
* docs: change postinstall lifecycle to changed from electron v42

Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>

* docs: remove postinstall lifecycle warning

Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Anirudh Sevugan <sonicforces207@gmail.com>
2026-03-23 10:23:37 +01:00
trop[bot]
e7d473337f ci: update actions to node24 (#50404)
* ci: update actions to node24

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* chore: fixup actions/cache to 5.0.4 everywhere

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-23 09:51:18 +01:00
trop[bot]
1766e229eb fix: don't re-parse URL unnecessarily when handling dialogs (#50398)
* fix: fallback to opaque URL when needed inside dialog callback

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* refactor: remove additional URL parsing entirely when showing dialogs

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* test: add crash test case for URL-less dialogs

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* refactor: exit on events instead of on timeout for dialog crash test

Co-authored-by: Robo <hop2deep@gmail.com>

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: make linter happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* style: make linter actually happy

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* fix: address failing `safeDialogs` tests

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-20 11:31:57 -04:00
trop[bot]
0d0a58cbd4 fix: correct utility process exit code on Windows (#50385)
* fix: correct utility process exit code on Windows

On Windows, process exit codes are 32-bit unsigned integers (DWORD).
When passed from Chromium to Electron as a signed int and then
implicitly converted to uint64_t, values with the high bit set
(e.g., NTSTATUS codes) undergo sign extension, producing incorrect
values.

Cast the exit code to uint32_t before widening to uint64_t to
prevent sign extension and preserve the original Windows exit code.

Fixes #49455

Co-authored-by: João Silva <joaomrsilva@tecnico.ulisboa.pt>

* fix: narrow HandleTermination and Shutdown to uint32_t, add tests

Co-authored-by: João Silva <joaomrsilva@tecnico.ulisboa.pt>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: João Silva <joaomrsilva@tecnico.ulisboa.pt>
2026-03-19 18:47:59 -07:00
trop[bot]
99a6230d6b chore: remove macos hittest workaround patch (#50374)
build: remove macos hittest workaround patch

CL:6574464 changed BridgedContentView::hitTest: to use GetHitTestResult(), which
returns kRootView for any non-null, non-NativeViewHost view — causing
BridgedContentView to absorb all web content mouse events. In BrowserWindow,
content_view_ sits in front of the sibling WebContentsView and covers the full
client area, so it was always found first, breaking all loadURL page interaction.

Fix this by installing a ContentViewTargeterDelegate on content_view_ in
NativeWindowMac::SetContentView that returns nullptr (instead of the view itself)
when no children cover the target point. This makes GetHitTestResult return kOther,
allowing hitTest: to fall through to [super hitTest:] and find
RenderWidgetHostViewCocoa. This also removes the now-unnecessary chromium
partial-revert patch that worked around the same issue.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-19 15:37:42 -04:00
trop[bot]
49a9efa764 ci: output build cache hit rate as GHA annotation (#50371)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-19 12:03:40 -04:00
trop[bot]
1b080d4097 ci: test linux 64k (#50358)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-19 09:31:47 -04:00
trop[bot]
191f673246 fix: always call the original impl in swizzled mousedown impls (#50356)
fix: always call the original implementation in swizzled mousedown implementations

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-18 20:12:01 -07:00
trop[bot]
636e0e26f3 chore: Respect HTTP(S) proxy env variable for Yarn (#50351)
Respect HTTP(S) proxy env variable for Yarn

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Filip Mösner <filip.mosner@seznam.cz>
2026-03-18 19:11:55 -04:00
trop[bot]
a7744df592 fix: ensure WebContents::WasShown runs when window is shown (#50342)
Avoids a freeze when failing to enter fullscreen on macOS.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Beutner <beutner.john@gmail.com>
2026-03-18 17:51:09 -04:00
trop[bot]
b0d5b63477 fix: correctly track BaseWindow::IsActive() on MacOS (#50339)
fix: correctly set IsActive() in BaseWindow on MacOS

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Kyle Cutler <kycutler@microsoft.com>
2026-03-18 14:59:53 -04:00
trop[bot]
0f54cb1d8b chore: bump chromium to 148.0.7738.0 (42-x-y) (#50335)
* chore: bump chromium in DEPS to 148.0.7738.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7664509: Migrate ServiceWorkerInfo to ChildProcessId

https://chromium-review.googlesource.com/c/chromium/src/+/7664509

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-18 14:21:26 -04:00
trop[bot]
4ed6809aaa docs: fix markdown formatting in fuses.md (#50334)
* docs: fix markdown formatting in fuses.md

* Use bulleted list (was being run together on one line)
* Wrap ASCII diagram in code block

Co-authored-by: Ryan Zimmerman <ryan@exodus.io>

* docs: apply suggestions from code review

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>

Co-authored-by: Ryan Zimmerman <ryan@exodus.io>

* docs: fix misapplied suggestion

Co-authored-by: Ryan Zimmerman <ryan@exodus.io>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Ryan Zimmerman <ryan@exodus.io>
2026-03-18 11:01:01 -04:00
trop[bot]
44ebbc11ed refactor: replace CHILD_PLUGIN with CHILD_EMBEDDER_FIRST on macOS (#50321)
refactor: replace CHILD_PLUGIN with CHILD_EMBEDDER_FIRST on macOS

Chromium removed upstream support for child plugin processes without
library validation in https://crbug.com/461717105, which we patched
back via feat_restore_macos_child_plugin_process.patch.

Chromium's CHILD_EMBEDDER_FIRST mechanism already provides the right
extensibility point for this: values > CHILD_EMBEDDER_FIRST are reserved
for embedders and resolved via ContentBrowserClient::GetChildProcessSuffix().
Chrome itself uses this pattern for its Alerts helper process.

This commit replaces the Chromium patch with an Electron-native
implementation.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-18 10:14:05 +01:00
trop[bot]
d1b5d7c9ed chore: bump chromium to 148.0.7737.0 (42-x-y) (#50319)
* chore: bump chromium in DEPS to 148.0.7734.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump chromium in DEPS to 148.0.7736.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: bump chromium in DEPS to 148.0.7737.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>

* chore: fixup patch indices

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* 7666125: Migrate ServiceWorkerContext to ChildProcessId

https://chromium-review.googlesource.com/c/chromium/src/+/7666125

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-17 16:55:38 -04:00
trop[bot]
d5ac7d3f33 ci: update test timeout to 60 minutes (#50315)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-17 12:10:30 -04:00
trop[bot]
17ddcbf01f fix: user resizable transparent windows on win32 (#50299)
test: revert win32 frameless and transparent resizable expectations

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Justin Mayfield <tooker@gmail.com>
2026-03-17 10:05:57 -04:00
trop[bot]
3b3e1e8ef6 feat: add id and groupId options to macOS notifications (#50304)
* feat: add custom `id` property to Notification API (macOS only)

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* feat: add `groupId` property to Notification API (macOS). Notifications with the same groupId will be visually grouped together in Notification Center

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* fix: move validation to construction time, add empty string check, remove setters

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* docs: clarify id/group id properties, make instance properties read-only

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

* test: update tests to reflect read-only properties

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-03-16 22:43:27 +00:00
trop[bot]
045516d598 fix: restore sdk_inputs cross-toolchain deps for macOS (#50303)
fix: restore sdk_inputs cross-toolchain deps for macOS

The change in CL:7652975 restricted sdk_inputs public_deps
to iOS only, to avoid setting up Xcode symlinks for the Linux
toolchain when cross-building chrome/linux on Mac. However, this
also broke cross-arch macOS builds (e.g. ffmpeg with target_cpu=x64)
where the mig target in the clang_arm64 toolchain depends on
sdk_inputs from the default clang_x64 toolchain.

Add target_os == \"mac\" alongside the existing iOS check to preserve
the original intent while restoring the cross-toolchain dependency
for macOS builds.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 22:26:54 +00:00
trop[bot]
1fffaeb481 chore: bump chromium to 148.0.7733.0 (42-x-y) (#50288)
chore: bump chromium to 148.0.7733.0 42-x-y

* chore: bump chromium in DEPS to 147.0.7727.2

* chore: bump chromium in DEPS to 148.0.7728.0

* chore: bump chromium in DEPS to 148.0.7729.0

* chore: bump chromium in DEPS to 148.0.7730.0

* chore: bump chromium in DEPS to 148.0.7732.0

* chore: update WrappablePointerTag patch
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7641766

* chore: update custom protocol patch for removed code
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7653454

* chore: update patches

* fix: cleanup removed CHILD_PLUGIN code
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7653455

* fix: move from int to ChildProcessId
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7621912

* fix: update extensions CreateTab signature
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7644389

* fix: draggable hit region test interface update for mac windows
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7655245

* chore: bump chromium in DEPS to 148.0.7733.0

* feat: restore macos child plugin process
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7653455

* fixup! chore: merge main

* chore: update patches

* fix: replace clipboard IsFormatAvailable with async GetAllAvailableFormats
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7631097

Async API pending RFC https://github.com/electron/rfcs/pull/19

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2026-03-16 21:14:02 +01:00
trop[bot]
88e666f210 test: fix esm issue in node-spec-runner (#50296)
Chromium added a top-level package.json in CL:7485999 that sets
the type to module and breaks commonjs tests run via
node-spec-runner.js. This commit temporarily changes the type to
commonjs while running the tests, then changes it back to module when done.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 14:51:18 -04:00
trop[bot]
90f7796adb docs: update the example of webContents.setWindowOpenHandler to cla… (#50292)
docs: reorganize the comments for clarifying `webContents.setWindowOpenHandler` example

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: z0gSh1u <zx.cs@qq.com>
2026-03-16 12:53:31 -04:00
trop[bot]
e6925bef1f build: remove redundant bits of ncrypto node patch (#50281)
build: remove redundant ncrypto node patch

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 11:50:49 -04:00
trop[bot]
6a5e9fe677 fix: add ASAR support to additional copy methods (#50285)
* fix: add ASAR support for additional copy methods

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

* test: add tests for ASAR support for additional copy messages

Co-authored-by: Noah Gregory <noahmgregory@gmail.com>

---------

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Noah Gregory <noahmgregory@gmail.com>
2026-03-16 11:49:33 -04:00
trop[bot]
270c9e7ce9 fix: prefer browser runtime over node in DevTools HostRuntime detection (#50274)
Upstream DevTools' HostRuntime checks `IS_NODE` before `IS_BROWSER` when
selecting the platform runtime. In Electron, `process` is available in
renderer processes, so `IS_NODE` evaluates to `true` in the DevTools
context. This causes DevTools to dynamically import the Node.js platform
runtime, which uses `node:worker_threads`. DevTools Web Workers running
under the `devtools://` protocol cannot load Node.js built-in modules,
so the import fails and breaks features like the formatter worker.

Fix by swapping the check order to prefer `IS_BROWSER` when both are
true. This is safe because in pure Node.js environments (the only case
where the node runtime is needed), `window` and `self` are both
undefined, so `IS_BROWSER` is always `false` regardless of check order.

Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-03-16 14:41:51 +01:00
Samuel Attard
f4a50a8fde build: skip archiving patch conflict fix artifact (#50251)
The update-patches artifact is a single .patch file, so zipping it
is unnecessary overhead. With archive: false, gh run download fetches
the raw file directly without requiring a decompression step.

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-13 21:49:05 +00:00
Erick Zhao
b35ed6346e docs: point pull requests guide to build tools (#50198)
* docs: point pull requests guide to build tools

* update for `--fork`
2026-03-13 16:01:41 -04:00
Samuel Attard
816e5964fb build: add patch conflict resolution workflow with CI artifacts (#50235)
ci: upload patch conflict fix as artifact in apply-patches

When patch-up.js cannot auto-push the 3-way-merged patch diff (e.g. on
fork PRs), the checkout action already writes patches/update-patches.patch
and tells the user to check CI artifacts — but nothing was uploading it.

This adds the missing upload-artifact step to the apply-patches job so
the resolved diff is available for download, and documents in CLAUDE.md
that pulling this artifact and applying it with `git am` is the fast
path for fixing patch conflicts on PR branches without a full local sync.

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-13 01:46:29 +00:00
Michaela Laurencin
3295d0d4b0 build(deps-dev): replace timers-browserify (#50203)
* build(deps-dev): replace timers-browserify

Co-Authored-By: Claude <noreply@anthropic.com>
Generated-By: GitHub Copilot

* update shim from js to ts

Co-Authored-By: Claude <noreply@anthropic.com>
Generated-By: GitHub Copilot

* remove timers-shim.js

* remove refs from package json and yarn lock

* update process in yarn lock

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-03-12 21:26:34 -04:00
John Kleinschmidt
3e72e2e8dd ci: update actions/cache to 5.0.3 (#50222)
chore: update actions/cache to 5.0.3

Needed due to https://github.blog/changelog/2025-09-19-deprecation-of-node-20-on-github-actions-runners/
2026-03-12 20:45:01 -04:00
Erick Zhao
313e501454 feat: add ELECTRON_INSTALL_ env vars (#49981)
* feat: add `ELECTRON_INSTALL_` env vars

* add tip for available arches

* clarify!

* use `arm` instead of `armv7l`
2026-03-12 15:09:48 +01:00
Erick Zhao
1f6dbb0917 docs: add API history (G-I) (#50194) 2026-03-12 14:43:39 +01:00
Niklas Wenzel
378659c535 build: update NMV to 146 (#50214) 2026-03-11 23:32:42 +00:00
Samuel Attard
6be775ad83 fix: preserve staged update dir when pruning orphaned updates on macOS (#50210)
fix: preserve staged update dir when pruning orphaned update dirs on macOS

The previous squirrel.mac patch cleaned up all staged update directories
before starting a new download. This kept disk usage bounded but broke
quitAndInstall() if called while a subsequent checkForUpdates() was in
flight — the already-staged bundle would be deleted out from under it.

This reworks the patch to read ShipItState.plist and preserve the
directory it references, deleting only truly orphaned update.XXXXXXX
directories. Disk footprint stays bounded (at most 2 dirs: staged +
in-progress) and quitAndInstall() remains safe mid-check.

Also adds test coverage for the quitAndInstall/checkForUpdates race and
a triple-stack scenario where 3 updates arrive without a restart.

Refs https://github.com/electron/electron/issues/50200
2026-03-11 15:42:23 -07:00
Mitchell Cohen
11f28ac3ac fix: improved the appearance of shadows and borders on frameless windows on Wayland (#50007)
* remove painting from linux frame layout

* use chromium csd strategy for frameless windows

* Apply suggestions from code review

Remove unneeded virtual methods

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* removed inline destructors

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-03-11 15:42:09 -04:00
Erick Zhao
5ec589a1de chore: remove remark-cli from markdown linting (#50165)
* chore: remove stale `.remarkrc` file

* build(deps): remove unused deps

* cleanup again
2026-03-11 15:39:38 -04:00
Charles Kerr
4fe3752fae refactor: move electron::api::Tray to cppgc (#50187)
* refactor: migrate electron::api::tray to cppgc

* chore: add Tray to wrappable_pointer_tags.h patch

* fixup! refactor: migrate electron::api::tray to cppgc

clear keep_alive_ if error is thrown in constructor

* refactor: make Tray::menu_ a cppgc::Member<Menu>
2026-03-11 15:38:08 -04:00
Shelley Vohr
c8dd0b99ee fix: prevent traffic light buttons flashing on deminiaturize (#50183)
* fix: prevent traffic light buttons flashing on deminiaturize

When a window with a custom `trafficLightPosition` is minimized and
restored, macOS re-layouts the title bar container during the
deminiaturize animation, causing the traffic light buttons to briefly
appear at their default position before being repositioned.

Fix this by hiding the buttons container in `windowWillMiniaturize` and
restoring them (with a redraw to the correct position) in
`windowDidDeminiaturize`.

* chore: address feedback from review
2026-03-11 13:02:51 -04:00
John Kleinschmidt
55ebdfb26b ci: add timeout to test step (#50186)
Additionally, take a screenshot on timeout so that we can debug why there is a hang
2026-03-11 09:48:47 +01:00
electron-roller[bot]
d6e0c270d1 chore: bump chromium to 147.0.7727.0 (main) (#50115)
* chore: bump chromium in DEPS to 147.0.7724.0

* chore: bump chromium in DEPS to 147.0.7725.0

* chore: bump chromium in DEPS to 147.0.7727.0

* chore: update patches
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7633903

* fix: pass weak-ptr-bound callback to OnCommandsChanged
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7622614

* fix: add missing option to CSS corner smoothing property
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7646628

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
2026-03-10 23:14:36 -04:00
George Xu
c4c6195341 docs: document Wayland frameless window shadow behaviour (#50193)
docs: update linux frameless window docs to account for hasShadow:false
2026-03-10 18:37:38 -07:00
Noah Gregory
f1705eccf8 fix: don't call TaskDialogIndirect with disabled parent windows (#50078) 2026-03-10 14:51:07 -04:00
Brandon Fowler
44b12fbb7b fix: run webRequest handlers for URLs handled by ElectronURLLoaderFactory (#45915)
* fix: continue to run ProxyingURLLoaderFactory for intercepted protocols

* test: webRequest handlers when loading browser windows

* fix: wrap special URL loaders factories with ProxyingURLLoaderFactory

* test: webRequest handlers when using net.fetch

* refactor: remove redundant intercepted protocol handling

AsarURLLoaderFactory is now intercepted by ProxyingURLLoaderFactory, which already handles when the file:// scheme is intercepted.

* fix: check before using saved headers in OnReceiveResponse

* fix: run webRequest handlers when loading file service workers

* test: handlers when loading file service workers

* refactor: add shared CreateURLLoaderFactoryBuilder method

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2026-03-10 12:27:00 -04:00
dependabot[bot]
3691451c71 build(deps): bump github/codeql-action from 4.32.5 to 4.32.6 (#50179)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.5 to 4.32.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](c793b717bc...0d579ffd05)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-10 09:52:19 +01:00
dependabot[bot]
b3e4547acd build(deps): bump fast-xml-parser from 4.5.3 to 4.5.4 in the npm_and_yarn group across 1 directory (#50182)
build(deps): bump fast-xml-parser

Bumps the npm_and_yarn group with 1 update in the / directory: [fast-xml-parser](https://github.com/NaturalIntelligence/fast-xml-parser).


Updates `fast-xml-parser` from 4.5.3 to 4.5.4
- [Release notes](https://github.com/NaturalIntelligence/fast-xml-parser/releases)
- [Changelog](https://github.com/NaturalIntelligence/fast-xml-parser/blob/master/CHANGELOG.md)
- [Commits](https://github.com/NaturalIntelligence/fast-xml-parser/compare/v4.5.3...v4.5.4)

---
updated-dependencies:
- dependency-name: fast-xml-parser
  dependency-version: 4.5.4
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-10 09:51:41 +01:00
dependabot[bot]
bda1becab0 build(deps): bump actions/setup-node from 6.2.0 to 6.3.0 (#50180)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.2.0 to 6.3.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](6044e13b5d...53b83947a5)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.3.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-10 09:42:58 +01:00
Michaela Laurencin
dda92fd53d ci: add workflow to remove 'needs-signed-commits' label (#50103) 2026-03-09 18:45:49 -07:00
Erick Zhao
d4cbd6cd7d docs: fix ipc highlight lines (#50169)
Co-authored-by: Dilukshan <65407969+dilukshann7@users.noreply.github.com>
2026-03-09 17:16:06 -07:00
Kyle Cutler
2ba4872d2c feat: WebContents.getOrCreateDevToolsTargetId() (#49733)
* Feat: support getDevToolsId() on WebContents

* Rename to `getOrCreateDevToolsTargetId`

* build: use spawn instead of spawnSync for build (#49774)

* Fix build

* formatting

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2026-03-09 16:32:52 -04:00
Shelley Vohr
c264402766 fix: validate protocol scheme names in setAsDefaultProtocolClient (#50141)
fix: validate protocol scheme names in setAsDefaultProtocolClient

On Windows, `app.setAsDefaultProtocolClient(protocol)` directly
concatenates the protocol string into the registry key path with no
validation. A protocol name containing `\` could write to an arbitrary
subkey under `HKCU\Software\Classes\`, potentially hijacking existing
protocol handlers.

To fix this, add `Browser::IsValidProtocolScheme()` which validates that a protocol
name conforms to the RFC 3986 scheme grammar:

  scheme = ALPHA *( ALPHA / DIGIT / "+" / "-" / "." )

This rejects backslashes, forward slashes, whitespace, and any other
characters not permitted in URI schemes.
2026-03-09 18:16:34 +00:00
Shelley Vohr
2c6dd1156c fix: use requesting frame origin in permission helper and device choosers (#50052)
* fix: use requesting frame origin instead of top-level URL for permissions

`WebContentsPermissionHelper::RequestPermission` passes
`web_contents_->GetLastCommittedURL()` as the origin to the permission
manager instead of the actual requesting frame's origin. This enables
origin confusion when granting permissions to embedded third-party iframes,
since app permission handlers see the top-level origin instead of the
iframe's. The same pattern exists in the HID, USB, and Serial device
choosers, where grants are keyed to the primary main frame's origin rather
than the requesting frame's.

Fix this by using `requesting_frame->GetLastCommittedOrigin()` in all
affected code paths, renaming `details.requestingUrl` to
`details.requestingOrigin`, and populating it with the serialized
origin only.

* chore: keep requestingUrl name in permission handler details

The previous commit changed the details.requestingUrl field to
details.requestingOrigin in permission request/check handlers. That
field was already populated from the requesting frame's RFH, so the
rename was unnecessary and would break apps that read the existing
property. Revert to requestingUrl to preserve the existing API shape.

The functional changes to use the requesting frame in
WebContentsPermissionHelper and the HID/USB/Serial choosers remain.

---------

Co-authored-by: Samuel Attard <sattard@anthropic.com>
2026-03-09 09:20:22 -07:00
Shelley Vohr
eacec9a47e refactor: use WHATWG URL instead of url.parse (#48674)
refactor: use WHATWG URL instead of url.parse
2026-03-09 11:12:01 -04:00
David Sanders
0d869c2007 ci: calculate dates for release board automation (#50081) 2026-03-09 11:35:55 +01:00
Shelley Vohr
ccb2c77c17 fix: InspectorFrontendHost override in embedded windows (#49794)
fix: InspectorFrontendHost override in embedded windows
2026-03-09 10:53:02 +01:00
Samuel Attard
603679cb18 fix: read nodeIntegrationInWorker from per-frame WebPreferences (#50122)
Previously the renderer checked a process-wide command-line switch to
decide whether to create a Node.js environment for dedicated workers.
When a renderer process hosted multiple WebContents with different
nodeIntegrationInWorker values (e.g. via window.open with overridden
webPreferences in setWindowOpenHandler), all workers in the process
used whichever value the first WebContents set on the command line.

Instead, plumb the flag through blink's WorkerSettings at worker
creation time, copying it from the initiating frame's WebPreferences.
The check on the worker thread then reads the per-worker value. Nested
workers inherit the flag from their parent worker via
WorkerSettings::Copy.

The --node-integration-in-worker command-line switch is removed as it
is no longer consumed.
2026-03-09 00:50:01 -07:00
Samuel Attard
9b78d75b30 fix: validate response header names and values before AddHeader (#50123)
Matches the existing validation applied to request headers in
electron_api_url_loader.cc.
2026-03-08 15:40:48 -07:00
Samuel Attard
3a48fd5fbb build: pin diff.renames for deterministic patch export (#50121)
git format-patch honors diff.renames, which defaults to 'true' (rename
detection only). If a user has diff.renames=copies configured at the
system or global level, exported patches may encode new files as copies
of similar existing files, causing spurious diffs against patches
exported on other machines. Pin diff.renames=true to match git's
default.
2026-03-08 15:39:21 -07:00
Samuel Attard
fb13492c89 fix: correct parsing of second-instance additionalData (#50119)
- POSIX: validate StringToSizeT result and token count when splitting
  the socket message into argv and additionalData; previously a
  malformed message could produce incorrect slicing.
- Windows: base64-encode additionalData before embedding in the
  null-delimited wchar_t buffer. The prior reinterpret_cast approach
  dropped everything after the first aligned 0x0000 in the serialized
  payload, so complex objects could arrive truncated.
2026-03-08 15:39:12 -07:00
Samuel Attard
8bdae63036 fix: strictly validate sender for internal IPC reply channels (#50118)
The sender-mismatch check in invokeInWebContents and invokeInWebFrameMain
used a negative condition (`type === 'frame' && sender !== expected`),
which only rejected mismatched frame senders and accepted anything else.

Invert to a positive check so only the exact expected frame can resolve
the reply — matches the guard style used elsewhere in lib/browser/.
2026-03-08 15:39:04 -07:00
dependabot[bot]
2a4909093e build(deps): bump the npm_and_yarn group across 1 directory with 2 updates (#50080)
Bumps the npm_and_yarn group with 2 updates in the / directory: [basic-ftp](https://github.com/patrickjuchli/basic-ftp) and [minimatch](https://github.com/isaacs/minimatch).


Updates `basic-ftp` from 5.1.0 to 5.2.0
- [Release notes](https://github.com/patrickjuchli/basic-ftp/releases)
- [Changelog](https://github.com/patrickjuchli/basic-ftp/blob/master/CHANGELOG.md)
- [Commits](https://github.com/patrickjuchli/basic-ftp/compare/v5.1.0...v5.2.0)

Updates `minimatch` from 3.1.3 to 3.1.5
- [Changelog](https://github.com/isaacs/minimatch/blob/main/changelog.md)
- [Commits](https://github.com/isaacs/minimatch/compare/v3.1.3...v3.1.5)

---
updated-dependencies:
- dependency-name: basic-ftp
  dependency-version: 5.2.0
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: minimatch
  dependency-version: 3.1.5
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-08 19:20:52 +01:00
electron-roller[bot]
9f80b64617 chore: bump chromium to 147.0.7719.0 (main) (#50061)
* chore: bump chromium in DEPS to 147.0.7716.0

* chore: bump chromium in DEPS to 147.0.7717.0

* chore: bump chromium in DEPS to 147.0.7719.0

* chore: update patches

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7618634
Refs https://chromium-review.googlesource.com/c/chromium/src/+/7622595

* [Extensions] Track service worker lifecycle more precisely

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7567646

* Make Clipboard::ReadAsciiText|ReadData|ReadText|ReadAvailableTypes asynchronous

Refs
https://chromium-review.googlesource.com/c/chromium/src/+/7609958
https://chromium-review.googlesource.com/c/chromium/src/+/7600360
https://chromium-review.googlesource.com/c/chromium/src/+/7595942
https://chromium-review.googlesource.com/c/chromium/src/+/7594881

* fixup! Make Clipboard::ReadAsciiText|ReadData|ReadText|ReadAvailableTypes asynchronous

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-03-08 06:22:11 +09:00
Keeley Hammond
3e0e1e4e84 test: fix flaky macOS dock tests (#50098)
* test: fix flaky mac dock & autofill tests

* fix: add null checks for the parent widget before calling IsVisible()

* test: remove autofill test change (failing on Linux), keep crash fix

* chore: autofill updates from code review
2026-03-06 13:35:16 -08:00
Michaela Laurencin
86f2c7cced docs: cleanup desktop-capturer doc after chromium audio capture additions (#50091)
* docs: cleanup desktop-capturer doc after chromium audio capture additions

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* disable linter for list in note

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2026-03-06 15:27:00 -05:00
Calvin
73596cff9d fix: Revert "updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)" (#50093)
Revert "fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)"

This reverts commit 90c9de70ac.

Ref: https://github.com/electron/electron/issues/50050
2026-03-06 15:25:36 -05:00
John Kleinschmidt
62c8db561c docs: remove release schedule in favor of https://releases.electronjs.org/schedule (#50094) 2026-03-06 15:25:00 -05:00
Charles Kerr
dc4ad2e932 fix: screen.getCursorScreenPoint() crash on Wayland (#50092)
* docs: document that getCursorScreenPoint() needs a Window on Wayland

* feat: add IsWayland() helper

* fix: Wayland crash in GetCursorScreenPoint()

fix: support Screen::GetCursorScreenPoint() on X11
2026-03-06 15:24:33 -05:00
Robo
fbfd0ed3a4 fix: specs in release build due to electron_common_testing module (#50070)
* fix: specs in release build due to electron_common_testing module

* fix: move binding into respective tests

describe block will run the callback to register which
tests to skip and having the binding hoisted will end
up being invoked.
2026-03-06 08:39:25 +09:00
Jan Hannemann
ddefb54c8f feat: implements cold COM activation (#49919)
* fix: implements cold COM activation

* fix: code review feedack
2026-03-05 17:30:04 -05:00
Developer-Ecosystem-Engineering
d6fc627ba5 feat: replace deprecated NSUserNotifications with User Notifications (#47817)
* refactor: replace deprecated NSUserNotifications with User Notifications

Removes deprecated NSUserNotification API, now using User Notifications

It replaces API calls for generating, scheduling, and receiving native
macOS notifications with equivalent API calls from the new framework,
or functionally equivalent implementations.

To preserve the existing Notification module API, special handling was
required in certain cases:

  - Dynamically declared notification actions
    Typically, notification actions should be declared at app launch time
    when using the User Notifications framework. However, this isn’t
    compatible with Electron’s architecture. Instead, we dynamically
    declare new notifications actions when necessary and carefully manage
    the existing actions registered at runtime.

  - Localizations for ‘Reply’ and ‘Show’ labels
    New translation files are added and processed through GRIT to add
    localizations for “Reply” and “Show” button labels which were
    initially supplied by the NSUserNotification framework.

* Use NotificationImageRetainer pattern from //chrome

* build: fix lint

* build: update config to handle --translate-gender for pak files

* test: also sign on arm64

* fix: add error handling for scheduling notification

* docs: add details to breaking changes

* docs: clarify breaking change details

* docs: add details for notifications tutorial and API documentation

---------

Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-03-05 11:57:19 -08:00
Shelley Vohr
7c0cb61b3c fix: prevent use-after-free in PowerMonitor via dangling OS callbacks (#50045)
PowerMonitor registered OS-level callbacks (HWND UserData and
WTS/suspend notifications on Windows, shutdown handler and lock-screen
observer on macOS) but never cleaned them up in its destructor. The JS
layer also only held the native object in a closure-local variable,
allowing GC to reclaim it while those registrations still referenced
freed memory.

Retain the native PowerMonitor at module level in power-monitor.ts so
it cannot be garbage-collected. Add DestroyPlatformSpecificMonitors()
to properly tear down OS registrations on destruction: on Windows,
unregister WTS and suspend notifications, clear GWLP_USERDATA, and
destroy the HWND; on macOS, remove the emitter from the global
MacLockMonitor and reset the Browser shutdown handler.
2026-03-05 09:00:37 -06:00
ANANYA542
9b15976136 fix: avoid redundant page-favicon-updated events on setBounds (#49464)
* fix: avoid duplicate calls in electron_api_web_contents

* Style: fix lint errors

* fix: prevent duplicate page-favicon-updated events and add regression test
2026-03-05 11:30:46 +01:00
Erick Zhao
55106192af docs: add more api history (C-D) (#49510) 2026-03-05 11:30:20 +01:00
Charles Kerr
d18b017cb0 fix: FTBFS when printing is disabled (#50056)
these variables hit with-Werror,-Wunused when printing is disabled
2026-03-04 13:14:02 -06:00
Shelley Vohr
f7507447ad fix: use proper quoting for exe paths and args on Windows (#50016)
Previously, GetProtocolLaunchPath and FormatCommandLineString in
browser_win.cc used naive quoting which could break when paths or
arguments contained backslashes, spaces, or embedded quotes.

Fix by extracting the CommandLineToArgvW-compatible quoting logic from
relauncher_win.cc into a shared utility and use it in both browser_win.cc
and relauncher_win.cc to properly quote the exe path and each argument
individually.
2026-03-04 11:59:49 -05:00
Keeley Hammond
ff623a731c build: fix code-signing for MacOS x64 tests (#50058)
* fix: code-sign binaries for notification tests

* test: remove redundent feedURL test

* test: move squirrel feed tests to api-autoupdater

* fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings

* Revert "fix: fix SQRLShipItRequest.JSONKeyPathsByPropertyKey mappings"

This reverts commit 5ad9892a67.

* test: unsign tests requiring no signed app
2026-03-04 11:58:47 -05:00
Michaela Laurencin
442debdcd4 docs: correct lazy electron download breaking change to 42 (#50031) 2026-03-04 16:15:01 +01:00
Shelley Vohr
0d7fc95817 chore: remove applescript from trash (#50044)
Previously, when trashItemAtURL: failed (e.g. on network shares or
under app translocation), the code fell back to constructing an
AppleScript that interpolated the bundle path directly into a string
literal via %@ with no escaping. This was fragile and unnecessary —
trashItemAtURL: has been the standard API since 10.8 and covers the
relevant cases. The fix simply removes the AppleScript fallback
entirely, so Trash() now returns the result of trashItemAtURL: directly.
2026-03-04 12:16:33 +01:00
electron-roller[bot]
54ac544f27 chore: bump chromium to 147.0.7714.0 (main) (#50041)
* chore: bump chromium in DEPS to 147.0.7714.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-03-04 12:15:40 +09:00
dependabot[bot]
2c9bf0df6d build(deps): bump minimatch from 3.1.2 to 3.1.3 in the npm_and_yarn group across 1 directory (#50008)
build(deps): bump minimatch in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [minimatch](https://github.com/isaacs/minimatch).


Updates `minimatch` from 3.1.2 to 3.1.3
- [Changelog](https://github.com/isaacs/minimatch/blob/main/changelog.md)
- [Commits](https://github.com/isaacs/minimatch/compare/v3.1.2...v3.1.3)

---
updated-dependencies:
- dependency-name: minimatch
  dependency-version: 3.1.3
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 14:16:40 -05:00
dependabot[bot]
7b1dde1f10 build(deps): bump github/codeql-action from 4.32.4 to 4.32.5 (#50039)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.4 to 4.32.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](89a39a4e59...c793b717bc)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 12:07:37 -05:00
Robo
5eb1e1bf89 fix: uaf in non-client hittest during view teardown (#50042)
* fix: uaf in non-client hittest during view teardown

* chore: update crash spec
2026-03-04 00:29:49 +09:00
dependabot[bot]
6418847fd2 build(deps): bump actions/download-artifact from 7.0.0 to 8.0.0 (#50037)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 7.0.0 to 8.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](37930b1c2a...70fc10c6e5)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 16:00:15 +01:00
Mitchell Cohen
2f13d85785 fix: better shortcut registration and app icon matching on Wayland (#49988)
* fix: set default desktop name that matches exec name on linux

* chromium patches for global shortcuts

* use app name for shortcut description
2026-03-03 15:37:54 +01:00
Shelley Vohr
6d2fc4e5cb fix: validate USB device selection against filtered device list (#50002)
* fix: validate USB device selection against filtered device list

Previously, UsbChooserController::OnDeviceChosen looked up the chosen
device_id via chooser_context_->GetDeviceInfo(), which searches all
known USB devices on the system rather than the filtered list shown to
the select-usb-device handler. This meant a device excluded by the
renderer's filters or exclusion_filters could still be granted
permission if the handler returned its GUID.

* bump for CI

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-03 10:44:33 +01:00
dependabot[bot]
f037673655 build(deps): bump actions/upload-artifact from 6.0.0 to 7.0.0 (#50038)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](b7c566a772...bbbca2ddaa)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-03-03 10:41:43 +01:00
electron-roller[bot]
238699221e chore: bump chromium to 147.0.7713.0 (main) (#49975)
* chore: bump chromium in DEPS to 147.0.7708.0

* chore: update patches

* chore: bump chromium in DEPS to 147.0.7709.0

* chore: bump chromium in DEPS to 147.0.7710.0

* chore: bump chromium in DEPS to 147.0.7713.0

* 7603876: Remove OriginatingProcess and RendererProcess overloads

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7603876

Co-Authored-By: Claude (claude-opus-4-20250514)

* 7596126: Clean up StoragePartitionImpl bucket data deletion.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7596126

* fix(patch): ENABLE_GLIC guard removed upstream

Upstream removed the #if BUILDFLAG(ENABLE_GLIC) guard around
ShouldShowGlicSummarizeButton, making the code unconditional.
Restructured the patch to use #if 0 / #else / #endif instead.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7616763

Co-Authored-By: Claude (Anthropic)

* fix(patch): Win32 API :: scope qualifiers

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7613666

Co-Authored-By: Claude (Anthropic)

* chore: update patches (trivial only)

* docs: add skip-and-recreate warning to chromium upgrade skill

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-03-03 13:54:44 +09:00
Noah Gregory
0ae46d71d3 fix: add explicit JSON property mappings for SQRLShipItRequest model (#49980)
* fix: add explicit JSON property mappings for SQRLShipItRequest model

* style: add patch body to mantle v2 fix patch
2026-03-02 20:48:41 -08:00
Shelley Vohr
9f9a5b8b9b fix: prevent use-after-free in permission request callbacks (#50032)
EnterFullscreenModeForTab, RequestPointerLock, and RequestKeyboardLock
bind callbacks with base::Unretained(this); fullscreen also captures a
raw RenderFrameHost*. These callbacks may be invoked by the app's JS
permission handler after the WebContents or RenderFrameHost is destroyed.

Use GetWeakPtr() in all three call sites, and capture a
GlobalRenderFrameHostToken instead of the raw RenderFrameHost* for
fullscreen so the pointer is resolved and null-checked only when the
callback fires. Cancel in-flight permission requests from ~WebContents()
via a new ElectronPermissionManager::CancelPendingRequests()` so stale
callbacks are never handed back to JS.
2026-03-02 19:01:24 -05:00
GUNDUPU JAYA KRISHNA
21a2bfca16 fix(styles): add missing dot prefix to .hero-icon.loop-3 CSS selector (#49950) 2026-03-02 13:11:25 -05:00
Zach Waugh
89483e7e89 feat: add macOS-only api to determine if app is currently active (#49622)
* feat: add macOS-only api to determine if app is currently active

You can `focus()` the app and get events for `did-become-active`, but there's currently not a way to directly check if your app is the active (foreground) application.

* test: add unit test for app.isActive api

* fix: ensure we hide app after showing in test

If the app is still active, it may affect other tests like dock.bounce
that behave differently depending on whether the app is active

* docs: simplify isActive api description
2026-03-02 11:47:37 -05:00
Shelley Vohr
4c3565fb88 feat: show toast dismissal reason on Windows (#49913)
* feat: show toast dismissal reason on Windows

* Update docs/api/notification.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-03-02 11:38:51 -05:00
Shelley Vohr
e1e11c8fbe build: authenticate curl requests to googlesource in lint workflow (#50001)
fix: authenticate curl requests to googlesource in lint workflow

The "Download GN Binary" and "Download clang-format Binary" steps
fetch files from chromium.googlesource.com without passing
authentication cookies. When googlesource rate-limits or returns a
transient error (502), the HTML error page is piped into `base64 -d`,
causing `base64: invalid input`.

The `set-chromium-cookie` action already configures `~/.gitcookies`
in a prior step. Pass `-b ~/.gitcookies` to both `curl` calls so
they authenticate, matching what the cookie verification step itself
does.
2026-03-02 11:29:49 -05:00
Shelley Vohr
222c989f13 fix: bind offscreen paint callback to child WebContents (#49998)
fix: bind offscreen paint callback to child WebContents

Previously, MaybeOverrideCreateParamsForNewWindow bound the
OffScreenWebContentsView's paint callback to the parent WebContents
using base::Unretained(this). This was both unsafe (dangling pointer
risk if the parent is destroyed before the child) and semantically
incorrect — paint events belong to the child window, not the opener.

Replace the callback in MaybeOverrideCreateParamsForNewWindow with
base::DoNothing(), then rebind it to the child WebContents in
AddNewContents via a new SetCallback method on OffScreenWebContentsView.
2026-03-02 11:24:48 -05:00
Samuel Attard
838d30510f fix: use destination context when wrapping VideoFrame in contextBridge (#49997)
Enter the destination context scope before creating the VideoFrame V8
wrapper, matching the sibling Element and Blob branches. Without this,
ScriptState::ForCurrentRealm resolved to the calling context instead of
the target context, producing an incorrect wrapper.

Also switch to ScriptState::From with an explicit context argument to
make the intent clearer.

Adds spec coverage for VideoFrame crossing the bridge in both
directions and adds VideoFrame to the existing prototype checks.
2026-03-02 08:18:19 -08:00
Samuel Attard
ee76e549fa fix: use setter's creation context when proxying setter in OverrideGlobalPropertyFromIsolatedWorld (#49990)
The setter branch was deriving source_context from getter-> instead of
setter->. Currently latent since the only call site passes both from
the same preload context, but this would crash or mis-resolve if a
future call site passed a setter without a getter or from a different
context.
2026-03-02 08:18:00 -08:00
Samuel Attard
97fceb5f7c docs: add PR labeling guidance to CLAUDE.md (#49992)
Document semver/* and target/* label conventions so Claude Code
can automatically apply the right labels when opening PRs against
electron/electron. Includes a gh one-liner to discover currently
active target branches via label color.

Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-03-02 16:05:31 +00:00
Shelley Vohr
6dcec79bba chore: remove unused commandLineSwitches flag (#49993)
chore: remove unused commandLineSwitches flag
2026-03-02 10:30:13 -05:00
Shelley Vohr
07dcba74b3 fix: potential UAF in OnDownloadPathGenerated (#50003)
fix: potential UAF in OnDownloadPathGenerated
2026-03-02 10:28:14 -05:00
Dante Issaias
839cc5b879 fix: deliver Universal Links when NSUserActivity.userInfo is nil (#49986)
* fix(mac): deliver Universal Links when NSUserActivity.userInfo is nil

* chore: format
2026-03-02 14:28:52 +01:00
Samuel Attard
d0241ea27d fix: delete temporary blink* globals after restoring Blink implementations (#49991)
ElectronRendererClient::DidCreateScriptContext (and the worker
equivalent) save Blink's fetch/Response/FormData/Request/Headers/
EventSource as temporary globalThis.blink* properties before Node
initialization may overwrite them. node/init.ts and worker/init.ts
restore the originals but previously never deleted the temporary
blink* globals.

They persisted as non-standard global pollution visible to page
content when contextIsolation is disabled -- a minor fingerprinting
signal and a bypass for any preload that wraps window.fetch (page
could call blinkfetch() instead).
2026-03-02 10:44:49 +00:00
WofWca
20dfc93f3a fix: menu bar hiding on two setFullscreen(false) (#45930)
* test: add failing test for `setFullscreen(false)`

`setFullscreen(false)` should do nothing
when not already in fullscreen, but it hides the menu bar
on Linux.

* fix: menu bar hiding on two setFullScreen(false)

This fixes the following bug on Linux (and maybe macOS):
1. Create a window with a menu bar.
2. Call `win.setFullScreen(false)`.

The menu bar will hide.

See the original bug in our project:
https://github.com/deltachat/deltachat-desktop/issues/4752.
2026-03-02 10:01:30 +01:00
electron-roller[bot]
2bd7758ec1 chore: bump chromium to 147.0.7707.0 (main) (#49965)
* chore: bump chromium in DEPS to 147.0.7706.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 147.0.7707.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-27 16:12:17 -05:00
dependabot[bot]
806b7e19a3 build(deps): bump basic-ftp from 5.0.5 to 5.1.0 in the npm_and_yarn group across 1 directory (#49954)
build(deps): bump basic-ftp in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [basic-ftp](https://github.com/patrickjuchli/basic-ftp).


Updates `basic-ftp` from 5.0.5 to 5.1.0
- [Release notes](https://github.com/patrickjuchli/basic-ftp/releases)
- [Changelog](https://github.com/patrickjuchli/basic-ftp/blob/master/CHANGELOG.md)
- [Commits](https://github.com/patrickjuchli/basic-ftp/compare/v5.0.5...v5.1.0)

---
updated-dependencies:
- dependency-name: basic-ftp
  dependency-version: 5.1.0
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-27 14:13:36 -05:00
Shelley Vohr
3d1cc3970b fix: update label/sublabel/icon in MenuItems on open (#49678)
fix: update label/sublabel/icon in macOS item on open
2026-02-27 12:47:05 -05:00
Mitchell Cohen
6a440f0bc9 fix: correct window sizing on Linux when constraints on resizability are enforced (#49903)
* fix window sizing on linux when constraints are applied

* added tests

* apply window style directly when changing resizability

* Revert "apply window style directly when changing resizability"

This reverts commit 949e2ee2ab.

* set size constraints for resizability on window and linux
2026-02-27 12:33:21 -05:00
electron-roller[bot]
699445f5da chore: bump chromium to 147.0.7705.0 (main) (#49958)
* chore: bump chromium in DEPS to 147.0.7705.0

* chore: update patches (trivial only)

* 7607719: Refactor predictors GN targets and clean up LCPP unittest params

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7607719

Co-Authored-By: Claude (claude-3-5-sonnet)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-26 16:56:30 -05:00
Charles Kerr
e3d8c9fcdf refactor: replace std::to_string() with base::NumberToString() (#49949) 2026-02-26 14:57:54 -05:00
Jarek Radosz
55d9e48c35 fix: menu close event missing after opening a submenu (#49783)
* fix: menu close event missing after opening a submenu

* add a unit-like test
2026-02-26 10:40:29 -05:00
electron-roller[bot]
96ad701dd0 chore: bump node to v24.14.0 (main) (#49941)
* chore: bump node in DEPS to v24.14.0

* lib: prefer call() over apply() if argument list is not array

https://github.com/nodejs/node/pull/60796

* build,deps: replace cjs-module-lexer with merve

https://github.com/nodejs/node/pull/61456

* chore: fixup patch indices

* test: use fixture directories for sea tests

https://github.com/nodejs/node/pull/61167

* src: throw RangeError on failed ArrayBuffer BackingStore allocation

https://github.com/nodejs/node/pull/61480

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-26 10:32:14 -05:00
Charles Kerr
aee0661046 refactor: simplify BaseWindow parent<->child association code (#49537)
* refactor: simplify BaseWindow parent<->child association code

* refactor: remove unnecessary local variable from BaseWindow::GetParentWindow()
2026-02-26 09:22:42 -06:00
electron-roller[bot]
227cc02aee chore: bump chromium to 147.0.7703.0 (main) (#49935)
* chore: bump chromium in DEPS to 147.0.7702.0

* chore: update patches (trivial only)

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* chore: bump chromium in DEPS to 147.0.7703.0

* 7582039: [Extensions] Use dependency injection for ManifestHandlerRegistry

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7582039

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* 7582477: spanification: migrate base::ReadUnicodeCharacter usage to string_view

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7582477

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* chore: update patches (trivial only)

Co-Authored-By: Claude (claude-3-5-sonnet, Anthropic)

* 7590029: Remove 5 unused deprecated sync methods in ui::Clipboard

Migrate clipboard API calls from synchronous methods to async callback-based
methods with RunLoop pattern.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7590029

* 7599553: [rust png] Chromium: Update `png` to version `0.18.1`.

https://chromium-review.googlesource.com/c/chromium/src/+/7599553
Chromium updated their to Rust PNG implementation which produces
different (but valid) PNG output. Update tests to compare raw bitmap
data instead of encoded PNG data URLs.

* test: fixup clipboard tests to properly handle urls

Needed after migrating clipboard API calls from synchronous methods to async callback-based methods with RunLoop pattern.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7590029

* fixup "7599553: [rust png] Chromium: Update `png` to version `0.18.1`."

https://chromium-review.googlesource.com/c/chromium/src/+/7599553
Chromium updated their Rust PNG implementation which produces
different (but valid) PNG data URLs.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-26 08:21:31 -05:00
yureiblack
128880988e test: correct typo in node-spec.ts comment (#49141)
fix: correct typo in node-spec.ts comment
2026-02-25 23:03:06 -08:00
Shelley Vohr
8d05285a1f fix: potential std::stoi crash in Windows Toasts (#49947)
fix: potential std::stoi crash in Windows Toasts
2026-02-25 14:14:45 -08:00
Mitchell Cohen
6a2571ee3d ci: Wayland test job, helpers, and app spec (#49908)
* wayland test chromium patch

* ci: add wayland test job and helpers

* use weston directly instead of wlheadless-run

* roll build image to eac3529

* fixed exec command

* Update .github/workflows/pipeline-segment-electron-test.yml

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* Update .github/workflows/pipeline-segment-electron-test.yml

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* chore: fixup shard case statement

* reverted leftover patch line

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-25 14:51:13 -05:00
Shelley Vohr
94aa90bb64 fix: recover network requests after Network Service restart (#49887)
* fix: recover network requests after Network Service restart

* chore: reuse implementation

* chore: make linter happy

* chore: fix lint

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-25 12:53:06 -05:00
zonescape
b9a09acff3 docs: mark "Show hidden files" file dialog setting as deprecated on Linux (#46926)
* fix: don't overwrite "Show hidden files" setting on Linux/GTK

* docs: deprecate showHiddenFiles property in dialogs on Linux

* docs: mark Electron 42 as the removal date for this feature

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2026-02-25 11:05:01 -05:00
David Sanders
fd9bf54243 build: fix Chromium roll linting merge base determination in CI (#49937) 2026-02-25 08:38:31 -05:00
John Kleinschmidt
d9170093aa build: exit upload with error code if github upload fails (#49936) 2026-02-25 14:16:13 +01:00
David Sanders
aca83afeef ci: add maintainer /request-review command (#49927)
Assisted-by: Claude Opus 4.6
2026-02-24 20:13:37 -08:00
electron-roller[bot]
e5d3fbf6dc chore: bump chromium to 147.0.7699.0 (main) (#49831)
* chore: bump chromium in DEPS to 147.0.7693.0

* chore: bump chromium in DEPS to 147.0.7694.0

* chore: bump chromium in DEPS to 147.0.7695.0

* chore: bump chromium in DEPS to 147.0.7697.0

* chore: bump chromium in DEPS to 147.0.7698.0

* fix(patch): IsGuest moved to SecurityPrincipal

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234613

Co-Authored-By: Claude (claude-opus-4-6)

* chore: update patches (trivial only)

* fix(patch): v8::External API now requires ExternalPointerTypeTag

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7562476

Co-Authored-By: Claude (claude-opus-4-6)

* fix: update CreateCustomWebContents signature

Upstream added disposition and window_features parameters.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7585256

Co-Authored-By: Claude (claude-opus-4-6)

* fix: OriginatingProcess renamed to OriginatingProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7557820

Co-Authored-By: Claude (claude-opus-4-6)

* fix: kLogNetLog moved from network::switches to net::switches

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7559090

Co-Authored-By: Claude (claude-opus-4-6)

* fix(patch): patch out glic and save-to-drive Profile usage in PDF

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7589312

Co-Authored-By: Claude (claude-opus-4-6)

* chore: bump chromium in DEPS to 147.0.7699.0

* chore: remove upstreamed pseudonymization salt descriptor code

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7568382

Co-Authored-By: Claude (claude-opus-4-6)

* chore: update patches (trivial only)

* chore: update reclient patch format (copy-from to new-file)

Co-Authored-By: Claude (claude-opus-4-6)

* chore: remove upstreamed patch and update stale patches

Co-Authored-By: Claude (claude-opus-4-6)

* fix: expose GetLibGdk3 and guard glic function body

GetLibGdk3 needs to be public for Electron's gdk_display_beep usage.
ShouldShowGlicSummarizeButton body must be guarded, not just call site.

Co-Authored-By: Claude (claude-opus-4-6)

* fix(patch): v8::External API in nan requires ExternalPointerTypeTag

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7562476

Co-Authored-By: Claude (claude-opus-4-6)

* fixup fix(patch): v8::External API in nan requires ExternalPointerTypeTag

* fixup: remove extraneous changes to patches

Caused by
debb371681
6e51034728

* fixup: revert fix: expose GetLibGdk3 and guard glic function body

Reverts 6e51034728 as this was an unneeded changed caused by the incorrect changes made in debb371681

* 7586673: Update logic for showing pdf summarize button

7586673: Update logic for showing pdf summarize button | https://chromium-review.googlesource.com/c/chromium/src/+/7586673

Also 7454131: set enable_glic=true | https://chromium-review.googlesource.com/c/chromium/src/+/7454131 (landed in previous roll)

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-24 16:42:05 -05:00
Shelley Vohr
0aaea4eaa0 fix: crash after win.showAllTabs() new tab (#49917)
fix: crash after win.showAllTabs new tab
2026-02-24 16:09:09 -05:00
dependabot[bot]
818b28410f build(deps): bump github/codeql-action from 4.32.3 to 4.32.4 (#49925)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.3 to 4.32.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](9e907b5e64...89a39a4e59)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.4
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-24 16:13:04 +01:00
David Sanders
25db585a23 docs: fix some string enum typings (#49923) 2026-02-24 16:11:22 +01:00
dependabot[bot]
02eed1ec0b build(deps): bump actions/stale from 10.1.1 to 10.2.0 (#49924)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.1 to 10.2.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](997185467f...b5d41d4e1d)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.2.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-24 16:11:18 +01:00
Mitchell Cohen
acd01e15e2 fix: prevent crash on Windows when closing child windows (#49901)
* guard against window destruction in min/max size checks

* use weakptr to prevent hit test crash on teardown

* revove web contents views during teardown

* fix test failure

* fix other tests
2026-02-24 15:48:04 +01:00
David Sanders
fc3a0abf19 build: fix roller branch detection in CI (#49920) 2026-02-23 18:10:22 -08:00
David Sanders
fa2b9ac466 ci: fix checking latest release for website docs update (#49918) 2026-02-23 15:22:01 -08:00
Andre Hora
481e224992 docs: remove documentation link to discontinued Touch Bar Simulator (#49899)
Remove link to discontinued Touch Bar Simulator

https://github.com/sindresorhus/touch-bar-simulator is archived.

> This app is discontinued as it no longer works because of changes in macOS.
2026-02-23 15:04:31 -05:00
Shashwat Raj
90c9de70ac fix: updated Alt detection to explicitly exclude AltGraph/AltGr (#49778)
Updated Alt detection to explicitly exclude AltGraph/AltGr
2026-02-23 13:00:27 -05:00
Shelley Vohr
9d0a0a5459 fix: apply zoomFactor from setWindowOpenHandler to window.open() windows (#49886)
fix: apply zoomFactor from setWindowOpenHandler to window.open() windows
2026-02-23 09:02:48 +01:00
Erick Zhao
19d0c072d5 feat: lazy electron download (#49328)
* feat: lazy electron download

* better error messaging?

* add breaking changes script doc

* add binary download step to install instructions

* respect no binary env var
2026-02-20 15:35:38 -05:00
redeemer
2b80f4ccc9 fix: prevent GBytes leak in GdkPixbufFromSkBitmap on Linux/GTK (#49863)
Inside gtk_util::GdkPixbufFromSkBitmap, g_bytes_new() was called
inline as an argument to gdk_pixbuf_new_from_bytes(), which per
GTK docs does not take ownership of the GBytes - it adds its own
internal reference. The caller's GBytes* was never stored or
unreffed, leaking 4 x width x height bytes of pixel data on every
call.
2026-02-20 15:00:46 -05:00
Shelley Vohr
5795689fd9 fix: fullscreen restoration on Windows (#49872) 2026-02-20 11:58:37 -05:00
Shelley Vohr
3e58c6cb3a fix: refresh menu item state on key equivalent dispatch (#49875) 2026-02-20 11:35:44 -05:00
Mitchell Cohen
ea89ba5b8d feat: Shadows and CSD for frameless windows on Wayland (#49295)
* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* layout helper

* CSD shadows for frameless windows on Linux

* simplify min/max size calculation

* use base window size for min/max

* respect HasShadow option

* moved windows min/max size overrides

* add newline at end of file

* fix setting background color for frameless csd windows

* fix wco positioning nad sizing to match prod

* safety improvements
2026-02-19 18:53:13 -06:00
Niklas Wenzel
5ddd8a0200 feat: add support for --experimental-transform-types (#49711)
* feat: add support for `--experimental-transform-types`

* chore: add tests

* docs: add `--experimental-transform-types` to docs
2026-02-19 20:27:49 +01:00
Nilay Arya
8b81bfda8f ci: log mocha retries in spec runner (#49150) 2026-02-19 11:30:46 -05:00
reito
491fa0442b fix: rgbaf16 shared texture remove keyed mutex. (#49798)
* fix: rgbaf16 shared texture remove keyed mutex.

* fix: rgbaf16 patch.

* 更新 shared-texture-handle.md

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-19 11:28:53 -05:00
Shelley Vohr
b508510cab fix: update DBus signal signature for XDG GlobalShortcuts portal (#49842) 2026-02-19 15:22:27 +01:00
David Sanders
469b2af0c0 chore: use relative links from docs/ to files outside of docs/ (#49605) 2026-02-19 01:15:27 -08:00
Noah Gregory
61b3d5d63c refactor: initialize libgdk stubs before use in platform_util:Beep (#49680)
* refactor: initialize libgdk stubs before use in `platform_util:Beep`

* feat: add upstream function to get libgdk handle

* fix: add missing include for libgdk support

* style: adjust comment wording and make linter happy

* style: make linter actually happy
2026-02-19 09:59:10 +01:00
reito
1e437c9a18 feat: use 1.0f as default for offscreen scale factor. (#49683) 2026-02-19 09:58:29 +01:00
David Sanders
efb3fd98c6 build: lint commits on Chromium roller branches (#49655)
* build: lint commits on Chromium roller branches

Assisted-By: Claude Opus 4.5

* chore: add ability to skip linting CLs by adding #nolint

* chore: only exit with non-zero exit code in CI
2026-02-18 20:45:44 -08:00
Shelley Vohr
9ca9311b73 docs: note required windows in 'new-window-for-tab' event (#49851)
docs: note required windows in new-window-for-tab
2026-02-18 19:30:43 -08:00
Samuel Attard
8b05717661 docs: clarify ASAR integrity is supported in MAS builds (#49852)
* docs: clarify ASAR integrity is supported in MAS builds

Add a note to the ASAR integrity documentation explicitly stating
that this feature is fully supported and recommended in Mac App
Store builds. While MAS-installed apps have system-level protections,
ASAR integrity provides an additional security layer and is important
for MAS builds distributed outside the Mac App Store.

Slack thread: https://electronhq.slack.com/archives/CB6CG54DB/p1771449093872419?thread_ts=1771446183.473289&cid=CB6CG54DB

https://claude.ai/code/session_01A97nfiqHUVxLNaQyHVXS7j

* docs: clarify ASAR integrity support for MAS builds

Updates the ASAR integrity documentation to explicitly mention that
it is supported and recommended in Mac App Store builds. Clarifies
that while MAS-installed apps have system-level protections (Resources
folder owned by root), ASAR integrity is especially important when
distributing MAS builds through other channels like direct download,
since those installations won't have the read-only protections.

https://claude.ai/code/session_012mBNZQW34h91NRcdFaLxNh

---------

Co-authored-by: Claude <noreply@anthropic.com>
2026-02-18 14:14:00 -08:00
John Kleinschmidt
be45b5f8e7 ci: fixup build stats upload on Windows (#49845) 2026-02-18 15:00:30 -05:00
dependabot[bot]
87597a99de build(deps-dev): bump webpack from 5.95.0 to 5.104.1 in the npm_and_yarn group across 1 directory (#49779)
build(deps-dev): bump webpack

Bumps the npm_and_yarn group with 1 update in the / directory: [webpack](https://github.com/webpack/webpack).


Updates `webpack` from 5.95.0 to 5.104.1
- [Release notes](https://github.com/webpack/webpack/releases)
- [Changelog](https://github.com/webpack/webpack/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack/compare/v5.95.0...v5.104.1)

---
updated-dependencies:
- dependency-name: webpack
  dependency-version: 5.104.1
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-18 14:22:25 -05:00
Shelley Vohr
3ed52a3ded build: roll sysroots (#49844) 2026-02-18 13:24:29 -05:00
Shelley Vohr
dfdf04976e fix: draggable region position with docked DevTools (#49822) 2026-02-18 11:49:18 -05:00
Shelley Vohr
f4ba25a3da fix: frameless window resize in MAS builds (#49780) 2026-02-18 10:35:10 -05:00
Robo
05061544ab feat: enable WASM trap handlers in all Node.js processes (#48983)
fix: enable WASM trap handlers in all Node.js processes

```
Original reason for revert:

Some apps started throwing exception on startup
https://github.com/electron/electron/issues/48956
```

We now move the trap handler registeration before
any user script execution. Add a fuse to support
disabling the feature is application needs to run
in memory constrained environments.
2026-02-18 12:08:03 +09:00
Sam Maddock
10566c2d5f test: MAS for private API usage (#49712) 2026-02-17 15:29:21 -05:00
Mitchell Cohen
931c257de7 fix: accurate window sizing and support for content sizing on Linux/Wayland with CSD (#49209)
* fix window sizing and content sizing on Linux when CSD is in use

* fixed size constraints

* simplify min/max size calculation

* use base window size for min/max

* moved windows min/max size overrides

* remove unnecessary checks for client frame

* cleanup
2026-02-17 15:23:54 -05:00
Ronald Eddy Jr
459a88f788 docs: fix typos across tutorial documentation (#49736) 2026-02-17 14:47:45 -05:00
electron-roller[bot]
c98cf69f40 chore: bump chromium to 147.0.7687.0 (main) (#49782)
* chore: bump chromium in DEPS to 147.0.7683.0

* fix(patch): constant moved to header

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* fix(patch): occlusion simplification upstream

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7563790

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: remove upstreamed patches

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: bump chromium in DEPS to 147.0.7685.0

* fix(patch): V1 Keychain removal

Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted

keychain_password_mac.mm to use KeychainV2 APIs.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7535923: Rename ozone buildflags

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7528398: [LNA] Rename PNA-named files to LNA-named files

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528398

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7534194: Convert some functions in ui::Clipboard to async

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* 7544580: [DevTools] Add command to restart Chrome to DevTools UI bindings

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7544580

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: bump chromium in DEPS to 147.0.7687.0

* chore: update patches (trivial only)

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

* chore: incorporate learnings into claude skill

I asked Claude to reflect on our upgrade session, consider what it learned and should know in the future, and to update its skill documents.

Co-Authored-By: Claude Opus 4.6 <noreply@anthropic.com>

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-02-17 14:25:21 -05:00
John Kleinschmidt
0da0c3a47e build: use spawn instead of spawnSync for build (#49774) 2026-02-17 13:24:19 -05:00
John Kleinschmidt
f19cfce430 chore: add Copilot CLI instructions (#49784)
chore: add copilot-instructions
2026-02-17 09:49:59 -05:00
dependabot[bot]
ca61f2d7df build(deps): bump actions-cool/issues-helper from 3.7.5 to 3.7.6 (#49813)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.5 to 3.7.6.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](e2ff99831a...71b62d7da7)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-17 11:24:20 +01:00
dependabot[bot]
1322bee878 build(deps): bump github/codeql-action from 4.32.2 to 4.32.3 (#49814)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.2 to 4.32.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](45cbd0c69e...9e907b5e64)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-17 11:24:06 +01:00
Samuel Attard
dda71a464c chore: add PR Notes section requirement to CLAUDE.md (#49816)
docs: add PR Notes section requirement to CLAUDE.md

Co-authored-by: Claude Opus 4.6 <noreply@anthropic.com>
2026-02-17 01:02:52 -08:00
Shelley Vohr
a056c63fd8 fix: excise abort_report_np usage in MAS (#49726)
* fix: excise abort_report_np usage in MAS

* chore: fix it harder
2026-02-16 12:23:53 +01:00
reito
bf3eb098bd fix: missing shared texture docs (#49797) 2026-02-16 10:51:31 +01:00
Shelley Vohr
67cced1270 build: remove *.star files (#49796) 2026-02-16 10:49:39 +01:00
Shelley Vohr
eb29568e45 feat: introduce os_crypt_async in safeStorage (#49054)
* feat: support Freedesktop Secret Service OSCrypt client

Refs https://issues.chromium.org/issues/40086962
Refs https://issues.chromium.org/issues/447372315

* chore: rework to async interface

* refactor: allow customizing freedesktop config

* docs: add more async impl info

* refactor: reject when temporarily unavailable

* chore: feedback from review

* chore: push_back => emplace_back
2026-02-15 19:54:50 +01:00
Shelley Vohr
dcdbb0397e feat: allow defaulting to printer default page size (#49523)
Co-authored-by: Edvan de Matos <edvan.santos@querodelivery.com>
2026-02-13 07:40:14 -05:00
electron-roller[bot]
3a5f9e0a33 chore: bump node to v24.13.1 (main) (#49744)
* chore: bump node in DEPS to v24.13.1

* chore: fixup patches

refs:
* https://github.com/nodejs/node/pull/60425
* https://github.com/nodejs/node/pull/61270
* https://github.com/nodejs/node/pull/61044

* fix: generate_config_gypi needs to generate valid JSON

https://github.com/nodejs/node/pull/60794

* doc: align Buffer.concat documentation with behavior

https://github.com/nodejs/node/pull/60405

* src: fix off-thread cert loading in bundled cert mode

https://github.com/nodejs/node/pull/60764

* build: fix extraneous includes

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-02-13 09:48:05 +01:00
Keeley Hammond
f90e35cb45 chore: cherry-pick e045399a1ecb from chromium (#49788)
* chore: cherry-pick e045399a1ecb from chromium

* chore: update patch
2026-02-12 19:24:19 -08:00
Shelley Vohr
74fd10450f feat: improve Windows Toast actions support (#48132)
* feat: improve Windows Toast actions support

* fix: ensure MSIX compatibility

* test: add bad clsid format test
2026-02-12 17:25:20 -05:00
electron-roller[bot]
a65cfed500 chore: bump chromium to 146.0.7666.0 (main) (#49528)
* chore: bump chromium in DEPS to 146.0.7652.0

* fix(patch-conflict): update mas_avoid_private_macos_api_usage context for constrainFrameRect method

The upstream CL added a new constrainFrameRect:toScreen: method override to
NativeWidgetMacNSWindow as part of headless mode window zoom implementation.
The MAS patch's #endif for frameViewClassForStyleMask now correctly appears
after that method, since constrainFrameRect is a public API override that
doesn't need to be guarded.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7487666

* fix(patch-conflict): update printing.patch for base::DictValue rename

Updated printing.patch to use the new base::DictValue type name instead of
base::Value::Dict following Chromium's type renaming change. This affects
CompleteUpdatePrintSettings() signature and related code.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* fix(patch-conflict): update accessibility_ui patch for base::DictValue/ListValue rename

Updated adjust_accessibility_ui_for_electron.patch to use the new
base::DictValue and base::ListValue type names instead of base::Value::Dict
and base::Value::List following Chromium's type renaming change.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509820

* chore: update patches

* 6625736: Rename DURABLE_STORAGE to PERSISTENT_STORAGE for consistency | https://chromium-review.googlesource.com/c/chromium/src/+/6625736

* chore: bump chromium in DEPS to 146.0.7653.0

* chore: update patches

* 7000847: add type tag to v8::External for gin_helper function templates

The upstream gin function templates now use v8::ExternalPointerTypeTag
for type safety when using v8::External. Updated Electron's forked
gin_helper function template to use the same kGinInternalCallbackHolderBaseTag
that Chromium's gin uses.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* fix(patch-update): extend V8 Object API deprecation patch for Node.js

Extended the existing patch to cover additional files that use
GetAlignedPointerFromInternalField and SetAlignedPointerInInternalField:
- src/stream_base-inl.h
- src/udp_wrap.cc
- src/js_udp_wrap.cc
- src/node_process_methods.cc
- src/node_snapshotable.cc
- src/base_object.cc

These APIs now require an EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* 7000847: add type tag to v8::External calls in shared_texture

Updated v8::External::New and v8::External::Value calls to use the
kExternalPointerTypeTagDefault tag as required by the V8 API change
that deprecates the tagless versions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7000847

* 7508687: use ChildProcessId for file permission APIs

The ChildProcessSecurityPolicy::CanReadFile and GrantReadFile APIs
now require ChildProcessId instead of int. Updated to use GetID()
instead of GetDeprecatedID() for these specific calls.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7508687

* 7000847: add type tag to v8::External calls in callback and osr_converter

The v8::External API now requires an EmbedderPointerTypeTag parameter
for both New() and Value() methods to improve V8 sandbox type safety.

Updated calls in:
- callback.cc: TranslatorHolder constructor and CallTranslator
- osr_converter.cc: OffscreenSharedTextureValue converter

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7000847

* fixup! 7087956: [api] Promote deprecation of v8::Context and v8::Object API methods

Extended the Node.js patch to cover histogram.cc which also uses
SetAlignedPointerInInternalField and GetAlignedPointerFromInternalField
APIs that now require the EmbedderDataTypeTag parameter.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* chore: bump chromium in DEPS to 146.0.7655.0

* chore: update patches

* 7509043: update WebSpellingMarker type for API change

The upstream Chromium API changed - WebSpellingMarker was moved from a
nested type within WebTextCheckClient to a standalone type in the blink
namespace.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7509043

* 7498491: update process_id to use OriginatingProcess type

The upstream Chromium API changed - URLLoaderFactoryParams::process_id
was changed from an integer to a union type network::OriginatingProcess
that distinguishes between browser and renderer processes.

- For browser process requests, use OriginatingProcess::browser()
- For renderer process lookups, check !is_browser() and use
  renderer_process().value() to get the child_id

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7498491

* 5710330: Add crash keys to debug NativeWidgetMacNSWindowBorderlessFrame exception | https://chromium-review.googlesource.com/c/chromium/src/+/5710330

5710330 added a new NSNextStepFrame interface extension and
implementations for NativeWidgetMacNSWindowTitledFrame and
NativeWidgetMacNSWindowBorderlessFrame. These use private macOS APIs
that are not available in Mac App Store builds.

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7661.0

* chore: bump chromium in DEPS to 146.0.7663.0

* fix(patch-conflict): update accessibility_ui for string_view API change

Upstream removed redundant std::string(default_api_type) conversion as part
of a string_view optimization cleanup. Updated patch context to match.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7514107

* fix(patch-conflict): update service process launch options for sandbox API refactor

Upstream removed content/common/sandbox_init_win.cc and
content/public/common/sandbox_init_win.h, moving the functionality directly
into ChildProcessLauncherHelper. Updated patch to call
sandbox::policy::SandboxWin::StartSandboxedProcess directly with the
LaunchOptions pointer instead of going through the removed helper.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7528253

* fix(patch-conflict): update MAS safestorage for keychain API refactor

Upstream refactored KeychainPassword::GetPassword() to use a new
GetPasswordImpl() helper function with improved error tracking via
base::expected<std::string, OSStatus>. Adapted patch to use the new
GetPasswordImpl with the suffixed account name and handle migration
from legacy accounts through the new API.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7516438

* chore: update patches

* chore: bump chromium in DEPS to 146.0.7663.0

* fix: base::Value::Dict -> base::DictValue
https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: include new cookie exclusion reason
https://chromium-review.googlesource.com/c/chromium/src/+/7486527

* fix: enable libc++ ABI flag for trivially copyable std::vector<bool>

Required for changes introduced in the following CL
https://chromium-review.googlesource.com/c/chromium/src/+/7513653

* fixup! fix: base::Value::Dict -> base::DictValue https://chromium-review.googlesource.com/c/chromium/src/+/7513889

* fix: spellcheck not working in tests
https://chromium-review.googlesource.com/c/chromium/src/+/7452579

* fix: cookie test failing due to multiple rejection reasons
https://chromium-review.googlesource.com/c/chromium/src/+/7506629

* fix: macos sizing unmaximized window incorrectly
https://chromium-review.googlesource.com/c/chromium/src/+/7487666

Changes to headless mode caused the unmaximized window to subtract
the height of the menubar.

* fix: skip tests for incompatible BoringSSL ML-DSA crypto
https://boringssl-review.googlesource.com/c/boringssl/+/84929

* test: fix pseudonymization registration in utility process on Linux

Ref: 7486913: Pass pseudonymization salt via shared memory at process launch | https://chromium-review.googlesource.com/c/chromium/src/+/7486913

* fix: restore MAS patch-outs

Restores some `#if !IS_MAS_BUILD()` gates dropped in 773054ad59

* fixup! 7508687: use ChildProcessId for file permission APIs

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

* chore: add note about parallel upstream change

* fixup! Merge remote-tracking branch 'origin/main' into roller/chromium/main

* Revert "fixup! 7508687: use ChildProcessId for file permission APIs"

This reverts commit 05c43e4e5d.

The _impl version has the signature, but not the public interface. :oof:

* fixup! fix(patch-conflict): update MAS safestorage for keychain API refactor

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
2026-02-12 12:37:56 -05:00
Calvin
e9faa14cc0 test: drag region tests (#49266) 2026-02-12 01:50:02 -06:00
Niklas Wenzel
ce47542ccd feat: add support for long-animation-frame script attribution (#49706)
* feat: add support for `long-animation-frame` script attribution

* docs: document `AlwaysLogLOAFURL`

* chore: add test

* docs: adjust docs as per PR comment

* fix: test failures

* chore: simplify test

* fix: tests on Windows and Linux
2026-02-11 09:34:22 -08:00
dependabot[bot]
ff2df2c98a build(deps): bump diff from 3.5.0 to 3.5.1 in the npm_and_yarn group across 1 directory (#49666)
build(deps): bump diff in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [diff](https://github.com/kpdecker/jsdiff).


Updates `diff` from 3.5.0 to 3.5.1
- [Changelog](https://github.com/kpdecker/jsdiff/blob/master/release-notes.md)
- [Commits](https://github.com/kpdecker/jsdiff/compare/v3.5.0...v3.5.1)

---
updated-dependencies:
- dependency-name: diff
  dependency-version: 3.5.1
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-11 16:52:05 +01:00
John Kleinschmidt
0284b9afcc build: fixup attestation for release assets (#49732)
* build: fixup attestation for release assets

* Generate artifact attestation for generated artifacts

* set id-token for attestation

* Add artifact-metadata permission for attestation

* add permissions for testing attestations

* Revert "add permissions for testing attestations"

This reverts commit 0284bed175.

* Revert "set id-token for attestation"

This reverts commit 69a1b13a18.

* Revert "Generate artifact attestation for generated artifacts"

This reverts commit ee0536eceb.
2026-02-11 07:17:59 -05:00
David Sanders
52061b4c28 ci: add markdownlint problem matcher (#49751) 2026-02-11 13:17:29 +01:00
David Sanders
ec6d2fe549 build(dev-deps): update micromark-core-commonmark to 2.0.3 (#49749) 2026-02-11 13:11:58 +01:00
Ronald Eddy Jr
1c621cc982 docs: fix typos across documentation (#49734)
Fix 40 typos across 25 documentation files including misspellings,
missing words, doubled words, wrong words, and grammatical errors.
2026-02-11 12:45:46 +01:00
Shelley Vohr
57a6e43025 fix: revoke Read access after removing file via FileSystemAccess API (#49620)
Refs https://chromium-review.googlesource.com/6677249
2026-02-10 15:48:05 +01:00
dependabot[bot]
ef5b232e9f build(deps): bump github/codeql-action from 4.32.1 to 4.32.2 (#49735)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.1 to 4.32.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](6bc82e05fd...45cbd0c69e)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-10 15:06:42 +01:00
Bug-Reaper
99fce5b6ca fix: address upstream Chromium shift to enable CoreAudio Tap API for audio capture used in electron's desktopCapturer (🍏 macOS). (#49717)
* fix: Enable CoreAudio Tap API for Audio Capture (🍏 macOS)

* fix: addressed markdown issue which caused pre-commit hook failure

🧑‍🔧 : Ref : https://github.com/electron/electron/pull/49717#issuecomment-3874660013

* fix: updated docs to cover `desktopCapturer` nuances with macOS

📝 : PR https://github.com/electron/electron/pull/49717
2026-02-10 15:06:21 +01:00
Rushikesh Bobade
7c66112e88 docs: link unlinked type references in API documentation (#49651)
docs: add missing type links in menu.md and shared-texture.md
2026-02-09 23:08:52 -08:00
John Kleinschmidt
fd0108907a build: fixup build attestation (#49730) 2026-02-09 11:50:17 -05:00
reito
3fa3e91f90 docs: fix framerate limit when osr with shared texture (#49705) 2026-02-09 15:18:06 +01:00
David Sanders
a3563422c4 ci: fix patches changes detected in apply patches workflow (#49701) 2026-02-06 13:48:30 -08:00
Keeley Hammond
9db2290bcd fix: restore macos 12 support in Node 24 (#49697) 2026-02-06 07:48:37 -08:00
Samuel Attard
60d35bbaf4 feat: add support for disclaiming utility processes (#49128)
* feat: add support for disclaiming utility processes

* chore: update patches

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2026-02-05 14:37:24 -08:00
Michaela Laurencin
15dc7170ef ci: fix ai-pr label commenting (#49685) 2026-02-05 14:27:46 -05:00
Keeley Hammond
59e434a27f refactor: use ComPtr pattern for MSIX to avoid exception handling (#49645)
* Revert "fix: fix Windows MSIX release build errors (#49613)"

This reverts commit 4b5d5f9dd5.

* refactor: use WRL ComPtr pattern for MSIX to avoid exception handling

The MSIX auto-updater code was using C++/WinRT (winrt::* namespace), which requires exception handling (/EHsc). Mixing exception and non-exception handling code in the same binary is problematic at runtime. This commit refactors electron_api_msix_updater.cc to use an upstream Chromium pattern and eliminates the need for special exception handling build flags

* build: import correct packages

* build: consolidate IPackage declarations

* refactor: use IPackageManager/IPackageManager5/IPackageManager9 and
IPackage/IPackage2/IPackage4/IPackage6 interfaces as needed for
different API methods.

Also consolidates duplicate completion handler logic, fixes a bug in
RegisterRestartOnUpdate where the command line string could go out of
scope, and removes unused includes.
2026-02-05 10:42:28 -08:00
Samuel Attard
dec7f937ae build: generate artifact attestions for released assets (#48239)
* build: generate artifact attestions for released assets

* chore: address review feedback

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2026-02-05 09:37:17 -05:00
Noah Gregory
50381a6d57 refactor: don't log error just for unsigned code (#49654) 2026-02-05 15:26:17 +09:00
David Sanders
41c7e9bb21 ci: use squash merge for apply patches workflow (#49667) 2026-02-04 15:51:49 -08:00
Shelley Vohr
9740c989da fix: default accelerator for role-based menu items (#49558)
fix: apply default accelerator for role-based menu items

Co-authored-by: Kimgun3383 <tygob5247@gmail.com>
2026-02-04 16:45:29 -05:00
John Kleinschmidt
4ea2d816b8 revert(ci): use new case syntax in workflows (#49665)
Revert "ci: use new case syntax in workflows (#49590)"

This reverts commit def7854848.
2026-02-04 14:55:20 -05:00
Noah Gregory
6a47bb4731 fix: use temp directory for singleton test and clean up at end (#49604)
* fix: create directory for singleton test in `temp` instead of `home`

* fix: remove directory for singleton test at test end

* refactor: avoid extraneous declarations in singleton test

* refactor: reintroduce `userDataFolder` declaration in singleton test

* refactor: move cleanup before app exit in singleton test

* style: add missing semicolon

* refactor: set the user data path after pre-test cleanup in singleton test

* fix: release lock before cleanup in singleton test
2026-02-04 14:43:36 -05:00
David Sanders
ef11669b67 ci: handle PRs with no checks in rerun apply patches (#49630) 2026-02-04 16:13:27 +01:00
Shelley Vohr
d7378d96a5 docs: add Wayland note to win.getPosition() and win.getBounds() (#49632)
docs: add Wayland note to win.getPosition()
2026-02-04 16:13:11 +01:00
Keeley Hammond
431f77ca1c fix: remove menu observer before destroying menu_controller_ (#49648)
* fix: remove menu observer before destroying menu_controller_

* fix: resolves private inheritance conflict
2026-02-04 16:11:00 +01:00
Shelley Vohr
51a9101c3d build: remove Core Graphics private macOS APIs on MAS (#49633) 2026-02-03 12:02:06 -05:00
Shelley Vohr
def7854848 ci: use new case syntax in workflows (#49590)
ci: use new case synta in workflows
2026-02-03 11:57:14 -05:00
Niklas Wenzel
28858ecb85 chore: add "I have built and tested this PR" box to PR template (#49434) 2026-02-03 11:39:07 -05:00
Shelley Vohr
8fdb7549bb fix: alt-space should route through 'system-context-menu' (#49619)
fix: alt-space should route through system-context-menu
2026-02-03 11:34:58 -05:00
dependabot[bot]
c3428fa413 build(deps): bump lodash from 4.17.21 to 4.17.23 in the npm_and_yarn group across 1 directory (#49577)
build(deps): bump lodash in the npm_and_yarn group across 1 directory

Bumps the npm_and_yarn group with 1 update in the / directory: [lodash](https://github.com/lodash/lodash).

Updates `lodash` from 4.17.21 to 4.17.23
- [Release notes](https://github.com/lodash/lodash/releases)
- [Commits](https://github.com/lodash/lodash/compare/4.17.21...4.17.23)

---
updated-dependencies:
- dependency-name: lodash
  dependency-version: 4.17.23
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-03 11:05:40 -05:00
loc
233caf8469 fix(squirrel.mac): clean up old staged updates before downloading new update (#49365)
fix: clean up old staged updates before downloading new update

When checkForUpdates() is called while an update is already staged,
Squirrel creates a new temporary directory for the download without
cleaning up the old one. This can lead to disk usage growth when
new versions are released while the app hasn't restarted.

This adds a force parameter to pruneUpdateDirectories that bypasses
the AwaitingRelaunch state check. This is called before creating a
new temp directory, ensuring old staged updates are cleaned up.
2026-02-03 11:04:06 -05:00
Shelley Vohr
86209f60eb fix: possible crash in FileSystem API (#49578)
Refs https://chromium-review.googlesource.com/6880247

Fixes a crash that can arise in the File System Access API in the
following scenario:

1. Create fileHandle1 at path1.
2. Call fileHandle1.remove() or user manually delete the file.
3. Create fileHandle2 at path2.
4. fileHandle2.move(path1).
2026-02-03 15:15:54 +01:00
dependabot[bot]
bdf2b67462 build(deps): bump github/codeql-action from 4.32.0 to 4.32.1 (#49629)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.32.0 to 4.32.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b20883b0cd...6bc82e05fd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-02-03 15:03:22 +01:00
Mr.Chaofan
4413a0f642 fix: wrong cause and removed flag in cookie change listener (#49103) 2026-02-03 10:19:35 +01:00
Shelley Vohr
3776731f4a fix: menu state in macOS dock menus (#49574) 2026-02-02 17:01:34 -05:00
Robo
db5606b4b3 fix: handle out of order recording errors in skia graphite (#49608) 2026-02-02 14:20:19 +01:00
Calvin
1159de52e7 docs: app.getGPUInfo() may reject (#49580) 2026-02-02 10:00:05 +01:00
Keeley Hammond
4b5d5f9dd5 fix: fix Windows MSIX release build errors (#49613)
* fix: fix MSIX release build

* fix: add C++/WinRT headers

* build: modify include paths

* fix: compile msix as seperate source set

* build: add additional needed deps for msix
2026-02-01 22:27:42 -08:00
Prachi Maskar
0cbf3c2918 docs: add jsign instructions for Azure Trusted Signing on Linux/macOS (#49345)
* docs: add jsign instructions for Azure Trusted Signing on Linux/macOS

* docs: add clickable jsign link for Azure Trusted Signing
2026-01-30 15:24:08 -05:00
axolotl
f272723a33 feat: Allow View.setBounds to animate (#48812)
* feat: allow View::SetBounds to animate

* fix: support width/height animations

* fix: jumping on subsequent animations

* fix: segfault race condition

* fix: remove layer background

* fix: layer clips not being reset

* refactor: use gfx tween gin converter

* fix: layer cleanups causing flickering views

* chore: merge artifact

* fix: missing private method in header

* fix: return type

* fix: do not set layer opacity

* refactor: update animate parameter format

* refactor: move animate into options object

* chore: typo

* docs: update

* spec: add view animation test
2026-01-30 15:18:56 -05:00
Shelley Vohr
331d1e16f5 refactor: address PathProvider TODO (#49563) 2026-01-30 14:16:39 -05:00
Shelley Vohr
6825a522e9 fix: duplicate fullscreen macOS menu item (#49074) 2026-01-30 13:23:43 -05:00
Shelley Vohr
e033c10075 fix: issues with xdg activation on Linux (#49499) 2026-01-30 10:53:04 -05:00
Shelley Vohr
64872a6cb8 fix: macOS menu item accelerators when item disabled (#49553)
fix: macOS menu item acceerators when item disabled
2026-01-30 10:07:16 +01:00
Jan Hannemann
d74fcfcecb feat: msix auto-updater (#49230)
* feat: native auto updater for MSIX on Windows

* doc: added MSIX debug documentation

* fix: allow downgrade with json release file and emit update-available

* test: msix auot-update tests

* doc: API documentation

* test: add package version validation

* fix: docs typo

* fix: don't allow auto-updating when using appinstaller manifest

* fix: getPackageInfo interface implementation

* fix: review feedback, add comment

* fix: missed filename commit

* fix: install test cert on demand

* fix: time stamp mismatch in tests

* fix: feedback - rename to MSIXPackageInfo

* fix: update and reference windowsStore property

* fix: remove getPackagInfo from public API

* fix: type error bcause of removed API
2026-01-29 16:38:26 -05:00
Michaela Laurencin
92a3f7d6c1 ci: add workflow for commenting with new 'ai-pr' label (#49564)
* add workflow for commenting with new 'ai-pr' label

* Update .github/workflows/pull-request-labeled.yml

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* add pr autoclose

* replace with specific secret

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* specify repo

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* update wording of comment

* chore: use GH app token

* chore: fix indentation

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-29 13:12:42 -05:00
David Sanders
0e161c18eb ci: rework reapply patches (#49552) 2026-01-29 11:19:07 -05:00
David Sanders
3d76d3a469 build(dev-deps): bump @electron/lint-roller to 3.2.0 (#49565) 2026-01-29 16:06:47 +01:00
Kanishk Ranjan
82d350524e test: fix flaky BrowserView test (#49316)
* test: fix flaky BrowserWindow test

* fix: improved as per review
2026-01-28 11:54:35 -08:00
Shelley Vohr
e6be04a7a0 fix: chrome://accessibility drift (#49547)
https://chromium-review.googlesource.com/c/chromium/src/+/6870052
2026-01-28 12:07:14 +01:00
David Sanders
a7de47084b test: remove split dependency (#49551) 2026-01-28 10:47:43 +01:00
Kanishk Ranjan
3820d3ae6c test: fix flaky BrowserWindow test (#49364)
test: fix flaky BrowserWindow test
2026-01-27 21:47:02 -08:00
Charles Kerr
8364b62f68 fix: potential dangling pointer in api::Screen (#49536)
fixes a regression from #49506
2026-01-27 16:27:38 -05:00
dependabot[bot]
441729c3a0 build(deps): bump actions/checkout from 6.0.1 to 6.0.2 (#49541)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.1 to 6.0.2.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](8e8c483db8...de0fac2e45)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-27 11:37:15 +01:00
Shelley Vohr
c521c2b868 test: update/fix Node.js disabled specs (#49467) 2026-01-27 11:03:09 +01:00
Shelley Vohr
b2c5093542 docs: correct type for process.noDeprecation (#49524)
* docs: correct type for process.noDeprecation

* docs: mark `noDeprecation` as optional instead

Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: René <contact.9a5d6388@renegade334.me.uk>
2026-01-27 11:02:51 +01:00
dependabot[bot]
ec5eb64788 build(deps): bump github/codeql-action from 4.31.10 to 4.32.0 (#49540)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.10 to 4.32.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cdefb33c0f...b20883b0cd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.32.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-27 11:00:13 +01:00
David Sanders
0cc15a6386 ci: reapply patches if PR base branch updates them (#49516) 2026-01-26 15:13:34 -05:00
David Sanders
4aa89b9c3c ci: add pipeline segment to run clang-tidy (#49072)
* ci: add pipeline segment to run clang-tidy

* chore: set -header-filter='' for clang-tidy

Breaking change in `clang-tidy` 22.0.0:

> clang-tidy now displays warnings from all non-system headers by default.
> Previously, users had to explicitly opt-in to header warnings using
> -header-filter=’.*’. To disable warnings from non-system, set
> -header-filter to an empty string.
2026-01-26 14:37:01 -05:00
Felix Rieseberg
ae43f17b79 build: Run gh workflows only on e/e (#49521) 2026-01-26 14:35:11 -05:00
electron-roller[bot]
b847299f19 chore: bump chromium to 146.0.7650.0 (main) (#49496)
* chore: bump chromium in DEPS to 146.0.7650.0

* 7496671: WaaP: Control hung delay for Initial WebUI

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7496671

* 7494302: [//media] Rename renderable_gpu_memory_buffer_video_frame_pool*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7494302

* chore: update patches

* 7502996: [DevTools] Add ability to toggle Chromium feature flags from DevTools

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7502996

* 7456200: Vectorize StringImpl::CopyChars and EqualIgnoringASCIICase using Highway.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200

* 7236627: spellcheck: supply full spelling marker info, incld. marker type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7236627

* chore: rm dependency on wtf::string from blink public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7456200
added a public dependency on //third_party/highway for
//third_party/blink/renderer/platform/wtf:wtf which will not be
inherited by //content/renderer since wtf is internal dependency of
blink leading to the following compilation error

```
In file included from ../../content/public/renderer/window_features_converter.cc:5:
In file included from ../../content/public/renderer/window_features_converter.h:10:
In file included from ../../third_party/blink/public/web/web_window_features.h:38:
In file included from ../../third_party/blink/renderer/platform/wtf/text/wtf_string.h:40:
../../third_party/blink/renderer/platform/wtf/text/string_impl.h:27:10: fatal error: 'hwy/highway.h' file not found
   27 | #include <hwy/highway.h>
      |          ^~~~~~~~~~~~~~~
1 error generated.
```

Use `gn desc out/Testing content/renderer:renderer_sources --blame`
to verify the inherited config and dependency list.

* 7493995: Restore directive part of wasm-eval error message

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7493995

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-26 11:18:09 -08:00
Charles Kerr
6766343173 refactor: simplify NativeWindow-to-BaseWindow lookup (#49520)
refactor: simplify native window to base window lookup
2026-01-26 12:28:57 +01:00
Sourav Bera
75be2fe8d6 docs: add type reference links in Menu and MenuItem API documentation (#49437)
* docs: add type reference links in Menu and MenuItem API documentation

* docs: revert type links in Menu return types to fix parser
2026-01-26 12:22:28 +01:00
Charles Kerr
30f365d9d8 refactor: use gin::Wrappable for electron::api::PowerMonitor (#49509)
* refactor: use `gin::Wrappable` for `electron::api::PowerMonitor`

* chore: update patches
2026-01-25 22:51:31 -06:00
Charles Kerr
e8250f9955 refactor: use gin::Wrappable for electron::api::Screen (#49506) 2026-01-25 13:46:25 -06:00
Kyle Cutler
d5de8883a2 feat: add focusOnNavigation flag to WebPreferences (#49425)
* feat: add focusOnNavigation webPreference

* WebContentsView tests

* fix

* fix
2026-01-23 14:29:34 -05:00
David Franco
8a11d5afb1 fix: avoid startup crash when V8 sandbox is disabled (#49210)
* fix: avoid startup crash when V8 sandbox is disabled

* chore: update patch

---------

Co-authored-by: David Franco <davidfrsan@gmail.com>
2026-01-23 11:49:15 -05:00
Shelley Vohr
89963618d9 fix: second argument to shell.writeShortcutLink is optional (#49476)
fix: second argument to shell.writeShortcutLink is optional
2026-01-23 11:24:47 -05:00
Charles Kerr
8c5c6a6088 refactor: use gin::Wrappable for electron::api::DataPipeHolder (#49495)
* refactor: make `DataPipeHolder` inherit from `gin::Wrappable`

* test: add a test to ensure GC clears the data pipe holder

* chore: e patches all

* chore: e patches all (trivial only)

* refactor: make AllDataPipeHolders a base::flat_map of WeakPersistent
2026-01-23 20:29:01 +09:00
Szymon Kurek
24526ccd39 docs: correct yarn part of tutorial-5-packaging (#49401)
docs: fix yarn part of `tutorial-5-packaging` - adding electron forge
2026-01-23 11:14:19 +01:00
Keeley Hammond
1134d95c6d chore: update main patches (#49498)
chore: update patches
2026-01-22 20:30:32 -08:00
Charles Kerr
d76608b945 refactor: use gin::Wrappable in electron::api::PowerSaveBlocker (#49381)
* refactor: PowerSaveBlocker subclasses gin::Wrappable

* chore: update chore_add_electron_objects_to_wrappablepointertag.patch

* chore: e patches all
2026-01-22 17:31:38 -06:00
electron-roller[bot]
d689f76ff9 chore: bump chromium to 146.0.7645.0 (main) (#49453)
* chore: bump chromium in DEPS to 146.0.7643.0

* chore: bump chromium in DEPS to 146.0.7645.0

* chore: update patches

* 7402162: Refactor app shims to call ContentMain

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7402162

* 7454282: Add master key management for HTTP Cache Encryption

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7454282

* 7490440: Reland "Delete unused base::Contains()"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7490440

* chore: update patches

* 7414864: Pass CSSParserLocalContext down to CSSMathExpressionNodeParser

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7414864

* 7460969: Move child_process_id.h to common

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7460969

* 7474608: [api] Remove deprecated v8::PropertyCallbackInfo<T>::This()

Refs https://chromium-review.googlesource.com/c/v8/v8/+/7474608

* 7461067: [Viz] Rename kPreferGpuMemoryBuffer

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7461067

* 7487174: Remove GLHelper

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7487174

* 7457538: Set timeout from multi source page context fetcher

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7457538

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-22 17:01:09 -05:00
reito
e3142865b2 fix: offscreen rendering with correct screen info. (#48730)
fix: osr use correct screen info.
2026-01-22 14:58:54 -05:00
David Sanders
1f8e4079cd test: fix version color output when running prebuilt Electron (#49491) 2026-01-22 16:17:56 +01:00
Shelley Vohr
bad88c6ed4 fix: potential devtools crash on empty (#49468) 2026-01-21 17:05:26 -08:00
Noah Gregory
534cb33465 fix: return early from platform_util::Beep() on Linux if there is no default GDK display (#49442)
fix: return early from beep on linux if there is no default gdk display
2026-01-21 15:55:24 -05:00
Soobin Rho
51e7753ae9 docs: clearer wording performance common pitfalls (#45308)
docs: clearer wording (performance common pitfalls)

Signed-off-by: Soobin Rho <soobinrho@gmail.com>
2026-01-21 14:46:02 -05:00
sam marshall
d141934885 docs: document that shell.trashItem requires backslashes (#49038)
docs: Update shell.md: Document that shell.trashItem requires backslashes

In Windows many functions relating to files (e.g. shell.openItem, the Node fs functions, as well as native Win32 APIs) will accept either type of slash / or \ as a folder separator.

shell.trashItem does not work with / as folder separator in Windows. This documentation change explains that.

See also:
https://github.com/electron/electron/issues/28831
2026-01-21 13:21:01 -05:00
Erick Zhao
22e8cf9416 docs: add a few API history fragments (#49340)
* docs: add a few API history fragments

* manual fixes
2026-01-21 12:57:02 -05:00
David Sanders
5856b2e01c ci: trigger website docs update on release published (#49429) 2026-01-21 10:44:18 -05:00
Shelley Vohr
49d91dd02b revert: use deprecated setAllowedFileTypes in macOS dialogs (#49444)
* revert: use deprectated setAllowedFileTypes in macOS dialogs

Closes https://github.com/electron/electron/issues/48191

* chore: remove stray import
2026-01-21 13:08:04 +01:00
David Franco
2f20d287d1 feat: import shared texture supports p010le (#49272)
feat: import shared texture supports p010le.
2026-01-20 11:50:30 +01:00
Shelley Vohr
73377af79e build: try removing zero-fill sandbox patch component (#49452) 2026-01-20 09:40:33 +01:00
dependabot[bot]
47766801e4 build(deps): bump actions/setup-node from 6.1.0 to 6.2.0 (#49456)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.1.0 to 6.2.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](395ad32622...6044e13b5d)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.2.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-20 09:40:02 +01:00
dependabot[bot]
bf0510dc22 build(deps): bump electron/github-app-auth-action from 1.1.1 to 2.0.0 (#49457)
Bumps [electron/github-app-auth-action](https://github.com/electron/github-app-auth-action) from 1.1.1 to 2.0.0.
- [Release notes](https://github.com/electron/github-app-auth-action/releases)
- [Commits](384fd19694...e14e47722e)

---
updated-dependencies:
- dependency-name: electron/github-app-auth-action
  dependency-version: 2.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-20 09:39:47 +01:00
electron-roller[bot]
486a9a61d2 chore: bump chromium to 146.0.7635.0 (main) (#49408)
* chore: bump chromium in DEPS to 146.0.7635.0

* chore: update patch hunk headers

* 7078551: [wasm] Refactor caching API

https://chromium-review.googlesource.com/c/v8/v8/+/7078551

* 7141498: [api] Remove unused context parameter from FixedArray::Get

https://chromium-review.googlesource.com/c/v8/v8/+/7141498

* 7454865: Add timeouts to content API for CopyFromSurface

https://chromium-review.googlesource.com/c/chromium/src/+/7454865

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-19 15:37:02 +01:00
Niklas Wenzel
7851a34c2d docs: fix webContents.hostWebContents types (#49424) 2026-01-19 10:45:23 +01:00
Shelley Vohr
faa21a748f fix: MAS rejection for private APIs (#49391) 2026-01-18 10:34:16 +01:00
Shelley Vohr
5bd2938f6a fix: try clearing InspectableWebContents delegate earlier (#49406)
fix: try clearing InspectableWebContents delegate earlier
2026-01-16 21:36:34 +01:00
electron-roller[bot]
f149efe32e chore: bump node to v24.13.0 (main) (#49189)
* chore: bump node in DEPS to v24.12.0

* src: use CP_UTF8 for wide file names on win32

https://github.com/nodejs/node/pull/60575

* test,crypto: handle a few more BoringSSL tests

https://github.com/nodejs/node/pull/59030

* chore: fixup patch indices

* chore: re-add accidentally removed sslv23 test

* chore: fixup crypto patch rebase

* test: make buffer sizes 32bit-aware in test-internal-util-construct-sab

https://github.com/nodejs/node/pull/61026

* src: add internal binding for constructing SharedArrayBuffers

https://github.com/nodejs/node/pull/60497

* chore: bump node in DEPS to v24.13.0

* chore: fixup patch indices

* chore: fixup sandboxed pointers patch

* tls: route callback exceptions through error handlers

https://github.com/nodejs-private/node-private/pull/782

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-16 11:08:38 -05:00
Daniel Gräfe
5dd509d2f4 fix: restore AXDocument accessibility attribute for representedFilename on macOS (#49346)
Starting from Chromium 134.0.6989.0 (Electron 35.0.0-beta.5), the
NativeWidgetMacNSWindow class overrides accessibilityDocument to return
the web content URL from the accessibility tree, but doesn't fall back
to NSWindow's default behavior when that URL is empty.

This broke Electron's setRepresentedFilename() API - the file path was
still set on the NSWindow, but no longer exposed via the AXDocument
accessibility attribute that screen readers use.

This fix adds an accessibilityDocument override in ElectronNSWindow that
checks representedFilename first, falling back to Chromium's behavior
for web content URLs.

Fixes: https://github.com/electron/electron/issues/XXXXX

Co-authored-by: Claude Opus 4.5 <noreply@anthropic.com>
2026-01-16 10:27:29 +01:00
Alex Schwartz
bdd7730a24 fix: make toplevel icon Wayland protocol work (#49290) 2026-01-16 09:55:52 +01:00
dependabot[bot]
060e76f1b6 build(deps): bump actions/upload-artifact from 5.0.0 to 6.0.0 (#49220)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](330a01c490...b7c566a772)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-16 09:55:38 +01:00
David Sanders
2fbf1f5c72 ci: detect patch needs update error with problem matcher (#49405) 2026-01-15 19:18:50 -08:00
Charles Kerr
c769361af2 fix: warning: default arguments on virtual or override methods (#49398)
fix: warning: default arguments on virtual or override methods are prohibited [google-default-arguments]

we never override these, so just make them nonvirtual
2026-01-15 16:09:43 -08:00
electron-roller[bot]
6ea7d6d5a4 chore: bump chromium to 146.0.7633.0 (main) (#49390)
* chore: bump chromium in DEPS to 146.0.7633.0

* chore: fixup patch indices

* chore: fix unsafe buffer usage in browser_linux.cc

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-15 10:52:42 -05:00
Charles Kerr
27b3a32307 chore: update patches (#49399) 2026-01-14 22:33:23 -08:00
Charles Kerr
ddeb970f18 refactor: make ReplyChannel inherit from gin::Wrappable (#49339)
* refactor: make ReplyChannel inherit from gin::Wrappable

* chore: add kElectronReplyChannel to chore_add_electron_objects_to_wrappablepointertag.patch

* fix: use gin::PerIsolateData::DisposeObserver

* fix: lifetime issues

* chore: rm perisolatedata hook in favor of prefinalizer

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-14 18:35:01 -06:00
electron-roller[bot]
5d80264944 chore: bump chromium to 145.0.7628.0 (main) (#49331)
* chore: bump chromium in DEPS to 145.0.7620.0

* chore: bump chromium in DEPS to 145.0.7622.0

* chore: bump chromium in DEPS to 145.0.7624.0

* chore: bump chromium in DEPS to 145.0.7626.0

* chore: bump chromium in DEPS to 145.0.7628.0

* 7362759: Migrate various base::Contains() to contains() in ui | https://chromium-review.googlesource.com/c/chromium/src/+/7362759

* chore: update patches

* 7411324: url: Mark deprecated functions as UNSAFE_BUFFER_USAGE

https://chromium-review.googlesource.com/c/chromium/src/+/7411324

* 7366867: Store property info in CSSParserLocalContext for random()

https://chromium-review.googlesource.com/c/chromium/src/+/7366867

* 7277406: Exclude PiP from getDisplayMedia picker thumbnails

https://chromium-review.googlesource.com/c/chromium/src/+/7277406

* 7253489: activity_reporter: Create stub module owned by browser_process

https://chromium-review.googlesource.com/c/chromium/src/+/7253489

* 7404514: Create device parental controls delegate

https://chromium-review.googlesource.com/c/chromium/src/+/7404514

* 7269504: Update histograms to use the updated MediaStreamRequestResult enum

https://chromium-review.googlesource.com/c/chromium/src/+/7269504

* fixup! 7253489: activity_reporter: Create stub module owned by browser_process

* 7368549: Reland "Use native rollup"

https://chromium-review.googlesource.com/c/devtools/devtools-frontend/+/7368549

* 4803165: Enable suppressing input event dispatch while paint-holding.

https://chromium-review.googlesource.com/c/chromium/src/+/4803165

* chore: make device_parental_controls lazy

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2026-01-14 15:34:24 +01:00
Erick Zhao
dae76c2885 docs: remove stale example and standardize DevTools capitalization (#49321)
* docs: remove stale example and standardize `DevTools` capitalization

* Update docs/api/web-contents.md

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>

---------

Co-authored-by: Kilian Valkhof <kilian@kilianvalkhof.com>
2026-01-14 10:35:53 +01:00
Erick Zhao
a368c5da0c docs: improve build-tools instructions (#49294)
* docs: improve build-tools instructions

* address comments

* update directory structure

* update

* nits

* node -> electron_node

* update macos build version

* Update docs/development/build-instructions-gn.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2026-01-14 09:51:55 +01:00
Keeley Hammond
1b2679b315 fix: revert os_crypt async cookie provider implementation (#49382)
* Revert "fix: provide explicit cookie encryption provider for cookie encryption (#49348)"

This reverts commit 95f097a392.

* Revert "fix: fix cookie encryption provider loading on Windows and Linux (#49371)"

This reverts commit 0e4ee9f03a.

* revert: 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-14 09:34:00 +01:00
Shelley Vohr
15acf70760 build: roll build-image to a82b87d (#49377)
build: roll build-image to a82b87d
2026-01-13 12:13:14 +01:00
dependabot[bot]
324eb0eb1c build(deps): bump github/codeql-action from 4.31.7 to 4.31.10 (#49376)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.7 to 4.31.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](cf1bb45a27...cdefb33c0f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-13 10:25:10 +01:00
Keeley Hammond
0e4ee9f03a fix: fix cookie encryption provider loading on Windows and Linux (#49371)
* fix: support cookie encryption provider cross-platform

* fix: add async macos key provider
2026-01-12 19:39:29 -08:00
Charles Kerr
ae94cefdba refactor: add static ReplyChannel::SendError() helper (#49338)
* refactor: add static void ReplyChannel::SendError()

* refactor: use static SendError() instead of instantiating a temporary

* refactor: remove non-static version of SendError()

* refactor: remove redundant callback-is-non-null checks
2026-01-12 17:02:58 -06:00
Shelley Vohr
409c29b12b build: roll build-tools SHA to 4430e4a (#49362)
build: roll build-tools SHA to 4430e4a
2026-01-12 12:22:30 -05:00
Shelley Vohr
b0e012f14e build: update on-create-command for siso (#49357) 2026-01-12 14:30:48 +01:00
Calvin
9a5ffd920c feat: suppress devtools console logging (#49292)
* feat: suppress devtools console logging

* Emit messages as-is in testing builds

* Promote `DCHECK_IS_ON()` to preprocessor check
2026-01-12 11:31:33 +01:00
Charles Kerr
cf2e283332 fix: clang-tidy warnings, pt. 1 (#49083)
* fix: google-readability-casting warning about the uint32_t cast

* fix: modernize-use-equals-default warnings

* fix: readability-redundant-member-init warning

* fix: modernize-make-unique warnings

* fix: modernize-use-emplace

warning: use emplace_back instead of push_back

* refactor: address code review feedback
2026-01-09 22:57:38 -08:00
Niklas Wenzel
d6a6312fc8 build: update NMV to 145 (#49349) 2026-01-09 18:14:18 -08:00
Keeley Hammond
95f097a392 fix: provide explicit cookie encryption provider for cookie encryption (#49348)
fix: provide explicit cookie encryption provider

Fixes 6996667: Reland "Port net::CookieCryptoDelegate to os_crypt async" | https://chromium-review.googlesource.com/c/chromium/src/+/6996667
2026-01-09 11:53:58 -08:00
Niklas Wenzel
b380755514 chore: remove stakeholders mention from PR template (#49317) 2026-01-09 00:36:40 -08:00
David Sanders
3985daa81c chore: improvements to script/run-clang-tidy.ts (#49335)
* chore: disable color output for clang-tidy in CI

* chore: small QoL improvements to run-clang-tidy.ts

* chore: add --fix option to script/run-clang-tidy.ts
2026-01-08 22:05:44 -08:00
Erick Zhao
5901d8a6d8 docs: document ELECTRON_SKIP_BINARY_DOWNLOAD (#49320) 2026-01-07 14:54:22 -08:00
electron-roller[bot]
eee60f202c chore: bump chromium to 145.0.7618.0 (main) (#49314)
* chore: bump chromium in DEPS to 145.0.7618.0

* 7399531: [GTK] Don't preselect file dialog accept buttons | https://chromium-review.googlesource.com/c/chromium/src/+/7399531

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2026-01-07 15:01:56 -05:00
Charles Kerr
b5a7d81c7d refactor: have GetXdgAppId() return a std::optional<std::string> (#49318)
* refactor: GetXdgAppId() now returns std::optional<std::string>

* refactor: slightly simplify app.setDesktopName() ts calls

* refactor: add better documentation for dekstop-entry in XDG notifications
2026-01-07 14:30:09 -05:00
dependabot[bot]
a89b2cd9bc build(deps): bump actions/download-artifact from 6.0.0 to 7.0.0 (#49221)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 6.0.0 to 7.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](018cc2cf5b...37930b1c2a)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 7.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-06 15:48:38 -05:00
Niklas Wenzel
44fa30695f docs: update roundedCorners documentation (#49195) 2026-01-05 16:27:46 -05:00
Niklas Wenzel
2ab56adbbd test: remove outdated disabled test (#49196) 2026-01-05 16:27:01 -05:00
electron-roller[bot]
a1f0ef80d4 chore: bump chromium to 145.0.7616.0 (main) (#49279)
* chore: bump chromium in DEPS to 145.0.7605.0

* chore: bump chromium in DEPS to 145.0.7606.0

* chore: bump chromium in DEPS to 145.0.7608.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7610.0

* chore: update patches

* [InputVizard] Fix missing touch cancel in InputTransferHandlerAndroid
using InputEventSource

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7302368

* chore: bump chromium in DEPS to 145.0.7611.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7614.0

* chore: bump chromium in DEPS to 145.0.7615.0

* chore: update patches

* chore: bump chromium in DEPS to 145.0.7616.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2026-01-05 13:34:36 -05:00
dependabot[bot]
c1a031be83 build(deps): bump actions-cool/issues-helper from 3.7.3 to 3.7.5 (#49282)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.3 to 3.7.5.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](3809910bc1...e2ff99831a)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2026-01-05 12:26:03 -05:00
John Kleinschmidt
c8bb700509 build: fixup release notes generation (#49302) 2026-01-05 11:11:40 -05:00
Calvin
46922de638 fix: drag regions in child windows (#49231)
* fix: drag regions in child windows

* Update comments
2026-01-05 10:34:01 -05:00
Niklas Wenzel
75ea93a279 chore: remove quiet period mention from PR template (#49298) 2026-01-05 10:12:07 -05:00
John Kleinschmidt
ace0beaa3f build: add logging to notes generator (#49300) 2026-01-05 09:49:51 -05:00
electron-roller[bot]
9eb43f3286 chore: bump chromium to 145.0.7604.0 (main) (#49265)
* chore: bump chromium in DEPS to 145.0.7599.0

* chore: bump chromium in DEPS to 145.0.7600.0

* chore: bump chromium in DEPS to 145.0.7602.0

* chore: bump chromium in DEPS to 145.0.7604.0

* chore: update patches (trivial only)

* [bytesize] Migrate network data in Task Manager to ByteSize.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/7266090

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-28 20:40:50 -08:00
electron-roller[bot]
809ab09b6f chore: bump chromium to 145.0.7596.0 (main) (#49224)
* chore: bump chromium in DEPS to 145.0.7588.0

* fix(patch-conflict): update scroll_bounce_flag for split overscroll methods

Chromium split IsElasticOverscrollEnabled() into two methods:
IsElasticOverscrollEnabledOnRoot() and IsElasticOverscrollSupported().
Updated patch to apply the scroll-bounce command-line switch to both
methods.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7233733

* fix(patch-conflict): update exclusive_access patch context

Upstream refactored the profile variable declaration. Updated patch to
match new surrounding context with brace-style if statement.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239252

* fix(patch-conflict): update screen capture kit non-shareable filter

Upstream refactored PiP window exclusion to use GetWindowsToExclude()
helper function. Updated patch to combine non-shareable window filtering
with the new helper's output.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7274596

* fix(patch-conflict): update corner smoothing CSS property id position

Upstream added new internal overscroll CSS properties. Updated patch to
add kElectronCornerSmoothing after the new entries.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7234051

* fix(patch-conflict): update permission patches for new permission types

Upstream added new permission types: LOCAL_NETWORK, LOOPBACK_NETWORK,
and GEOLOCATION_APPROXIMATE. Updated Electron permission patches to
include these new types and renumber Electron-specific permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7231952

* fix(patch-conflict): update memory query fallback for new function signature

Upstream added AmountOfTotalPhysicalMemory() with PCHECK. Updated patch
to maintain fallback logic with correct ByteSize return type.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254886

* chore: update patch hunk headers

* fix(patch): update reclient-configs patch to use new file mode

The fix_add_python_remote_wrapper patch was using 'copy from' mode
which caused inconsistent behavior between local and CI git versions.
Changed to 'new file' mode for consistent patch application.

* fix(patch-conflict): remove duplicate GEOLOCATION_APPROXIMATE case

Upstream moved GEOLOCATION_APPROXIMATE earlier in the switch statement
in GetPermissionString(). The 3-way merge kept both the old and new
positions, causing a duplicate case error.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6397637

* chore: update libcxx filenames for new headers

* chore: bump chromium in DEPS to 145.0.7590.0

* chore: update patch hunk headers

* fix(patch): update memory fallback return type to ByteSize

Upstream changed the return type from ByteCount to ByteSize.

* fix: suppress nodiscard warning in node_file.cc

libc++ added [[nodiscard]] to std::filesystem::copy_options operator|=
which causes build failures with -Werror.

* 7229082: update CopyFromSurface to use CopyFromSurfaceResult

Upstream changed CopyFromSurface callback to return
base::expected<viz::CopyOutputBitmapWithMetadata, std::string>
instead of SkBitmap, enabling better error handling.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7229082

* 7254070: add ip_address_space param to OnLocalNetworkAccessPermissionRequired

Upstream added IPAddressSpace parameter to check address space for
proper permission handling in Local Network Access.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254070

* 7136679: add spelling_markers param to RequestCheckingOfText

Upstream added spelling_markers parameter to report misspelling
ranges from Blink to Spellcheck to IME.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7136679

* 7240487: remove second param from RegisterWebSafeIsolatedScheme

Upstream removed the schemes_okay_to_appear_as_origin_headers_ parameter.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7240487

* 7254577: use explicit WebElement constructor

WebElement default constructor now requires explicit construction
rather than brace initialization.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7254577

* 7256335: remove override from CreateGlobalFeaturesForTesting

Upstream removed BrowserProcess::CreateGlobalFeaturesForTesting virtual
method so the override specifier is no longer valid.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7256335

* chore: add missing SingleThreadTaskRunner include

A transitive include of SingleThreadTaskRunner was removed upstream,
requiring an explicit include.

Ref: Unable to locate specific CL (transitive include change)

* 7260483: add LOCAL_NETWORK, LOOPBACK_NETWORK permission type cases

Upstream added new permission types for Local Network Access split
permissions.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7260483

* chore: update patch hunk headers

* 7264893: update postMessage tests for file: origin serialization change

Chromium now serializes file: origins as 'null' in MessageEvent per spec.
This is a security improvement aligning with the HTML spec behavior.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7264893

* fix: add paths to custom scheme URLs in protocol tests

Custom scheme URLs without paths (e.g. test-scheme://foo) cause a
DCHECK crash in ASAN builds when CorsURLLoader tries to log the
request via GenerateRequestLine -> PathForRequest, which asserts
that the path is non-empty.

Adding trailing slashes ensures URLs have valid paths.

* chore: bump chromium in DEPS to 145.0.7592.0

* chore: update patches (trivial only)

* chore: bump chromium in DEPS to 145.0.7594.0

* chore: bump chromium in DEPS to 145.0.7596.0

* chore: update accelerator.patch

no manual changes; patch applied with fuzz 2 (offset 1 line)

* chore: update patches (trivial only)

* chore: node ./script/gen-libc++-filenames.js

---------

Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-12-25 17:15:53 -06:00
Samuel Attard
3df3a6a736 fix: webRequest.onBeforeSendHeaders not being able to modify reserved headers (#49226)
* fix: `webRequest.onBeforeSendHeaders` not being able to modify reserved headers

* chore: add unit test for reserved header
2025-12-19 23:08:40 +13:00
Samuel Attard
7433c14af5 chore: add CLAUDE.md and Chromium Upgrade claude skill (#49229)
* chore: add CLAUDE.md and Chromium Upgrade claude skill

* Update script/lint.js

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-12-19 13:07:58 +13:00
electron-roller[bot]
a90ccc753b chore: bump chromium to 145.0.7577.0 (main) (#49175)
* chore: bump chromium in DEPS to 145.0.7572.0

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Polished the edits and formatted the result. No real changes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7232079 "7232079: Use WindowsToExclude to exclude PiP window in macOS screencapture device"

* chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7214586 "7214586: Refactor SelectFileDialogLinuxPortal to request XDG portal on demand"
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910 "7237910: Remove g_gtk_ui global"

* 7228586: Migrate SystemMemoryInfo from ByteCount to ByteSize

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7228586

* 7207583: GlobalRenderFrameHostId to ChildProcessId

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7207583

* 7205548: Remove uses of BodyAsStringCallbackDeprecated (extensions/)

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7205548

* chore: bump chromium in DEPS to 145.0.7574.0

* chore: update libc++ filenames

* chore: update patches (trivial only)

* chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7246150 "7246150: Fix crash in ScreenCaptureKitDeviceMac due to null PIPScreenCaptureCoordinator"

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* fixup! chore(patch-conflict): feat_filter_out_non-shareable_windows_in_the_current_application_in.patch

* 7239572: [OOPIF PDF] Enable OOPIF PDF by default on Windows/macOS/Linux

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7239572

* chore: bump chromium in DEPS to 145.0.7576.0

* fixup! chore(patch-conflict): feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

* chore: update patches (trivial only)

* chore: add note to keep patch that was upstreamed but reverted

fix_restore_original_resize_performance_on_macos.patch was organically upstreamed but that change got reverted just after the current roll's cutoff.

I've added a note in the patch contents so the patch sticks around and so we can keep it after the revert is included.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* chore: bump chromium in DEPS to 145.0.7577.0

* chore: update patches (trivial only)

* chore(patch-conflict): keep patch after revert

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7255334 "7255334: Revert 'Fix jank when resizing browser window'"

* 7237910: Remove g_gtk_ui global

I tried to find a way to avoid the patch, but other approaches seemed complex and involved.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7237910

* 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7251900

* 7170174: [LNA] Retry requests for cached local resources

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7170174

* fix: PDFs use OOPIF (behavior change)

* fixup! 7237910: Remove g_gtk_ui global

* fixup! 7251900: Reland "Remove callback_helpers.h include from is_callback.h (try 5)"

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-16 12:32:38 -05:00
John Kleinschmidt
e181fd040f build: drop dugite as a dependency (#49194) 2025-12-12 13:43:12 -05:00
David Sanders
a486185e10 ci: disallow non-maintainer changes to Yarn files (#49186) 2025-12-11 09:25:29 -05:00
John Kleinschmidt
8cefc8425c build: upgrade yarn to 4.12.0 (#49176) 2025-12-10 14:04:14 -05:00
electron-roller[bot]
fe477ce3aa chore: bump chromium to 145.0.7568.0 (main) (#49145)
* chore: bump chromium in DEPS to 145.0.7562.0

* fix(patch-conflict): update code cache patch for PersistentCache refactor

Upstream refactored code cache to use PersistentCache with new class-based
implementation (NoopCodeCacheHost, LocalCodeCacheHost, CodeCacheWithPersistentCacheHost).
Updated patch to integrate custom scheme support into the new structure while
preserving ProcessLockURLIsCodeCacheScheme checks for embedder-registered schemes.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7044986

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update dialog patch for RequestXdgDesktopPortal API

Upstream changed from SetSystemdScopeUnitNameForXdgPortal to RequestXdgDesktopPortal
API pattern. Updated OnServiceStarted signature and kept OnSystemdUnitStarted callback
that calls Electron's file_dialog::StartPortalAvailabilityTestInBackground().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7204285

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): remove reference to deleted AbortByPlaceholderLayout flag

Upstream removed the AbortByPlaceholderLayout runtime flag from
runtime_enabled_features.json5. Updated patch to only add ElectronCSSCornerSmoothing
without the removed flag reference.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7226494

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): guard media_file_system_registry for ChromeOS only

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7100719
moved media_file_system_registry to be ChromeOS-only since Media
Galleries is a Chrome Apps API and Chrome Apps are only available
on Chrome OS now.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): update VideoPixelFormat API for SharedImageFormat

Upstream CL https://chromium-review.googlesource.com/c/chromium/src/+/7207153
removed VideoPixelFormatToGfxBufferFormat as part of migration to
SharedImageFormat. Update to use VideoPixelFormatToSharedImageFormat
which directly returns the SharedImageFormat.

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): extend profile methods patch for ShouldEnableXfaForms

The ShouldEnableXfaForms function uses Profile::FromBrowserContext()
which is not available in Electron. Wrap the profile-dependent code
in #if 0 to fall through to the feature flag default.

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: bump chromium in DEPS to 145.0.7563.0

* chore: bump chromium in DEPS to 145.0.7565.0

* chore: bump chromium in DEPS to 145.0.7567.0

* chore: bump chromium in DEPS to 145.0.7568.0

* fix(patch-conflict): update content_main_delegate.h context for IsInitFeatureListEarly

Upstream added a new IsInitFeatureListEarly() virtual method to ContentMainDelegate
just before where our GetBrowserV8SnapshotFilename() method is added. Updated patch
context to account for this new method.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-update): include v8-cppgc.h for CppHeap complete type

The std::unique_ptr<v8::CppHeap> default argument in node.h requires
the complete CppHeap type definition for the destructor. Added the
v8-cppgc.h include to provide the full type definition.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(build): move NativeAppWindowFrameViewMacClient before constructor

The std::unique_ptr<NativeAppWindowFrameViewMacClient> member requires
the complete type definition to be visible at the point of the constructor
because the unique_ptr destructor may be instantiated during exception
handling. Moved the class definition before the NativeWindowMac constructor.

Ref: Unable to locate CL - libc++ unique_ptr requires complete type for destructor

Co-Authored-By: Claude <svc-devxp-claude@slack-corp.com>

* fix(patch-conflict): update create_browser_v8_snapshot_file_name_fuse context for IsInitFeatureListEarly

The upstream added IsInitFeatureListEarly() virtual method declaration to
ContentMainDelegate class. Updated the patch context to account for this
new function being present before the GetBrowserV8SnapshotFilename()
declaration we add.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7092856

Co-Authored-By: Claude <noreply@anthropic.com>

* chore: update patch hunk headers

Co-Authored-By: Claude <noreply@anthropic.com>

* fix(patch-update): remove reverted IsInitFeatureListEarly from v8 snapshot patch

The upstream added IsInitFeatureListEarly() was reverted, so the patch should
not include this declaration. Only GetBrowserV8SnapshotFilename() should be
added by the create_browser_v8_snapshot_file_name_fuse patch.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7230430

Co-Authored-By: Claude <noreply@anthropic.com>

* 6171655: include single_thread_task_runner.h for complete type

Added include for base/task/single_thread_task_runner.h in osr_converter.cc
to resolve incomplete type error when using
base::SingleThreadTaskRunner::GetCurrentDefault().

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/6171655

Co-Authored-By: Claude <noreply@anthropic.com>

* 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

Upstream removed GetChromiumGitRevision() function from embedder_support.
Updated to use CHROMIUM_GIT_REVISION macro directly via
build/util/chromium_git_revision.h as recommended in the Chromium CL.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7224136

Co-Authored-By: Claude <noreply@anthropic.com>

* fixup! 7224136: use CHROMIUM_GIT_REVISION directly instead of removed function

* fix(build): add missing include

`components/dbus/xdg/systemd.h` for `void OnSystemdUnitStarted(dbus_xdg::SystemdUnitStatus)` in the same patch.

* fix(build): adapt to string-view-ification change in windows jump_list.cc

7186922: Fix unsafe buffer usage in base/win/win_util.cc
https://chromium-review.googlesource.com/c/chromium/src/+/7186922

* chore: update libc++ filenames

* fixup! fix(build): add missing include

* fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

* fixup! fix(build): guard media_file_system_registry for ChromeOS only

* fixup! fixup! fix(build): extend profile methods patch for ShouldEnableXfaForms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Claude <svc-devxp-claude@slack-corp.com>
Co-authored-by: Claude <noreply@anthropic.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-12-10 10:28:31 -05:00
John Kleinschmidt
bab6bd3dae build: use @electron-ci/dev-root for package.json default (#49154) 2025-12-09 14:49:12 -05:00
dependabot[bot]
33f6942565 build(deps): bump actions/stale from 10.1.0 to 10.1.1 (#49159)
Bumps [actions/stale](https://github.com/actions/stale) from 10.1.0 to 10.1.1.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5f858e3efb...997185467f)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:50 -05:00
dependabot[bot]
a1b2e82778 build(deps): bump actions-cool/issues-helper from 3.7.2 to 3.7.3 (#49157)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.2 to 3.7.3.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](9861779a69...3809910bc1)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 12:14:13 -05:00
dependabot[bot]
1e06b74cd2 build(deps): bump github/codeql-action from 4.31.6 to 4.31.7 (#49155)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.6 to 4.31.7.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fe4161a26a...cf1bb45a27)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.7
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:15:08 -05:00
dependabot[bot]
fe0caa0e0d build(deps): bump actions/checkout from 6.0.0 to 6.0.1 (#49158)
Bumps [actions/checkout](https://github.com/actions/checkout) from 6.0.0 to 6.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](1af3b93b68...8e8c483db8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:14:41 -05:00
dependabot[bot]
cd48083be8 build(deps): bump actions/setup-node from 6.0.0 to 6.1.0 (#49156)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 6.0.0 to 6.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](2028fbc5c2...395ad32622)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-09 11:13:56 -05:00
John Kleinschmidt
8d5b104c17 build: upgrade github-app-auth to 3.2.0 (#49152) 2025-12-09 09:49:37 -05:00
John Kleinschmidt
6e134a8ad9 build: use powershell for Electron build step (#49144) 2025-12-08 16:03:40 -05:00
electron-roller[bot]
95e87e46ab chore: bump chromium to 144.0.7547.0 (main) (#49058)
* chore: bump chromium in DEPS to 144.0.7543.0

* Pass PipScreenCaptureCoordinatorProxy to ScreenCaptureKitDeviceMac

https://chromium-review.googlesource.com/c/chromium/src/+/7157590

* chore: update patches

* chore: update filenames.libcxx.gni

* 7142359: Spanification of process_singleton_posix.cc

https: //chromium-review.googlesource.com/c/chromium/src/+/7142359
Co-Authored-By: Charles Kerr <70381+ckerr@users.noreply.github.com>

* Move logging::LoggingSettings to base/logging/logging_settings.h

https://chromium-review.googlesource.com/c/chromium/src/+/7173024

* chore: bump chromium in DEPS to 144.0.7545.0

* 7159368: update PluginService API for sync GetPlugins

Upstream removed async PluginService APIs:
- GetPluginsAsync() removed, use synchronous GetPlugins()
- RegisterInternalPlugin() now takes single argument (remove add_at_beginning)
- RefreshPlugins() removed entirely

Updated ElectronPluginInfoHostImpl to use synchronous plugin loading and
simplified ElectronBrowserMainParts internal plugin registration.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159368
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159328
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159056
(cherry picked from commit 88cdf50b0a)

* 7159184: add missing base/files/file_path.h include

Add explicit include for base/files/file_path.h in electron_browser_context.h.
After removal of superfluous Mojo includes from content headers, base::FilePath
is no longer transitively included via content/public/browser/browser_context.h.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7159184
(cherry picked from commit 6ca8ea03ec)

* 7126479: add ShouldForceRefreshTextCheckService parameter to SpellCheckClient

Upstream added a force-refresh parameter to WebTextCheckClient::RequestCheckingOfText
to bypass spell check cache. Add the new ShouldForceRefreshTextCheckService
parameter to SpellCheckClient's override (currently unused in Electron).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7126479
(cherry picked from commit 879c0401c4)

* 7083663: remove fingerprinting_protection_ruleset_service override

Upstream deleted external references to Fingerprinting Protection Filter (FPF)
component. Remove the fingerprinting_protection_ruleset_service() override
from BrowserProcessImpl as the method no longer exists in the base class.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7083663
(cherry picked from commit 8350d152f9)

* 7155287: implement WebContentsView::GetSize and Resize

Upstream delegated WebContents::GetSize() and Resize() to WebContentsView,
making them pure virtual. Add const qualifier to GetSize() and implement
the Resize() override in OffScreenWebContentsView (no-op for offscreen).

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7155287
(cherry picked from commit 084eaa568e)

* 7184238: add OnUnconfirmedTapConvertedToTap override

Upstream added OnUnconfirmedTapConvertedToTap as a pure virtual method
to RenderWidgetHostViewBase to inform root view when child frame converts
an unconfirmed tap. Add empty override for offscreen rendering.

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7184238
(cherry picked from commit ef03400d9a)

* 7143586: add widget parameter to OnCommandsChanged

GlobalAcceleratorListener::OnCommandsChanged gained a gfx::AcceleratedWidget
parameter for window association in the GlobalShortcutListenerLinux
implementation. Pass gfx::kNullAcceleratedWidget for Electron's usage.

Ref: : Pass parent handle to GlobalAcceleratorListenerLinux::BindShortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/7143586
(cherry picked from commit 38306e2bfc)
Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: update patches

Co-Authored-By: Samuel Attard <MarshallOfSound@users.noreply.github.com>

* chore: bump chromium in DEPS to 144.0.7547.0

* chore: update patches

* 7189232: Add support for UnownedUserData in GlobalFeatures

https: //chromium-review.googlesource.com/c/chromium/src/+/7189232

* Refactor: Use std::u16string for extension load error messages

https://chromium-review.googlesource.com/c/chromium/src/+/7185844

* fixup Add support for UnownedUserData in GlobalFeatures

* 7165650: Remove ResourceContext

https://chromium-review.googlesource.com/c/chromium/src/+/7165650

* fixup BUILD.gn for lint

* 7202164: Reland "Reland "Remove GenericScopedHandle:IsValid""

https://chromium-review.googlesource.com/c/chromium/src/+/7202164

* advance deprecation of v8::ReturnValue<void>::Set(Local<S>).

7168624: [runtime][api] Relax requirements for setter/definer/deleter callbacks | https://chromium-review.googlesource.com/c/v8/v8/+/7168624

* fixup advance deprecation of v8::ReturnValue<void>::Set(Local<S>)

* chore: skip setting LPAC ACLs

* Revert "chore: skip setting LPAC ACLs"

This reverts commit e187aec488.

* chore: revert Convert to UNSAFE_TODO in sandbox

revert https://chromium-review.googlesource.com/c/chromium/src/+/7131661 to see if it fixes the Windows sandbox issue.

* Revert "chore: revert Convert to UNSAFE_TODO in sandbox"

This reverts commit 57afbfefe5.

* chore: Revert "Enable network sandbox by default on Windows"

see if this fixes the Windows sandbox issue

* Enable network sandbox by default on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* Revert "chore: Revert "Enable network sandbox by default on Windows""

This reverts commit 530ab6af82.

* fixup! Enable network sandbox by default on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/7204292

* fixup!: Correct flag name, add kLocalNetworkAccessChecks to all platforms

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <70381+ckerr@users.noreply.github.com>
Co-authored-by: Samuel Attard <sattard@anthropic.com>
Co-authored-by: Samuel Attard <MarshallOfSound@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-12-04 16:40:04 -08:00
Jan Hannemann
90e338df50 fix: run toast creation on background thread (#49106)
* fix: run toast creation on background thread

notes: attempts to fix app freeze when triggering notifications and the COM server in WindowsShellExperienceHost hangs

* fix: comments
2025-12-02 15:27:22 -08:00
dependabot[bot]
1b3fc9c174 build(deps): bump actions/checkout from 4.2.2 to 6.0.0 (#49125)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.2.2...1af3b93b6815bc44a9784bd300feb67ff0d1eeb3)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:02:06 -05:00
dependabot[bot]
c51018281f build(deps): bump github/codeql-action from 4.31.5 to 4.31.6 (#49124)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.5 to 4.31.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fdbfb4d275...fe4161a26a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-12-02 14:01:21 -05:00
Samuel Attard
8ce97df569 build: gate brew commands in free-space-macos action (#49123)
fix: gate brew commands in free-space-macos action

The brew uninstall and autoremove commands now only run if
brew is available on the machine. This prevents failures on
runners where Homebrew is not installed.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 17:32:46 -08:00
John Kleinschmidt
7aafe66717 chore: reclaim macOS disk space (#49118) 2025-12-01 13:34:06 -08:00
Samuel Attard
ba5f7d272f fix: rename RUNNER_NAME to MATRIX_RUNNER in disk cleanup workflow (#49120)
RUNNER_NAME is a reserved environment variable in GitHub Actions.
Renamed to MATRIX_RUNNER to avoid conflicts.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:33:45 -08:00
Samuel Attard
6b50b5e816 ci: add nightly macOS disk space cleanup workflow (#49119)
Add a scheduled GitHub Action that runs every night to:
- Run the existing disk space reclaimer on macOS runners
- Log disk space metrics (before/after cleanup, space freed) to Datadog

This helps monitor disk space trends and proactively maintain
runner health after recent "No space left on device" failures.

Co-authored-by: Claude <noreply@anthropic.com>
2025-12-01 13:07:28 -08:00
Niklas Wenzel
06044b50f4 chore: mention quiet period in PR template (#49117)
* chore: mention quiet period in PR template

* fix: remove trailing spaces
2025-12-01 11:55:13 -05:00
Robo
4adfc212b3 fix: crash when attempting to resolve modules during process exit (#49090)
* fix: crash when attempting to resolve modules during process exit

* chore: fix build
2025-11-27 10:30:09 +01:00
David Sanders
640c7bb908 ci: use clang problem matcher with nan spec runner (#49096) 2025-11-26 16:55:44 -08:00
David Sanders
0767b42cb8 ci: fix import in issue opened workflow (#49095) 2025-11-26 13:33:45 -05:00
Shelley Vohr
555f507c17 fix: ensure menu-did-close is emitted for application menus (#49075)
fix: ensure menu-did-close is emitted for application menus
2025-11-26 09:44:20 -06:00
David Sanders
1ff8e8014a ci: use yarn workspace for workflow dependencies (#48246) 2025-11-26 10:31:01 +01:00
John Kleinschmidt
20c7042a20 ci: don't build yarn modules for linux arm (#49031)
This should fix the oom errors
2025-11-26 10:25:16 +01:00
David Sanders
4786e80f33 ci: ignore Dependabot workflow failures in audit (#49080) 2025-11-25 17:06:36 -08:00
dependabot[bot]
64326e296b build(deps): bump actions/checkout from 5.0.1 to 6.0.0 (#49070)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.1 to 6.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](93cb6efe18...1af3b93b68)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 14:44:17 -05:00
dependabot[bot]
2f67242030 build(deps): bump github/codeql-action from 4.31.3 to 4.31.5 (#49071)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.3 to 4.31.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](014f16e7ab...fdbfb4d275)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-25 12:44:10 -06:00
David Sanders
e6844a3640 test: remove already disabled nan tests from our disable list (#49050) 2025-11-25 12:04:52 -06:00
Luke Horwell
fdb7fc7794 docs: Clarify that menus use non-native styles (#45033)
* docs: Clarify menus use non-native styles

Addresses #42262

* empty commit to kick ci

* fix: make linter happy

* Strip trailing space for lint

---------

Co-authored-by: George Xu <george.xu@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-11-25 18:27:46 +01:00
John Kleinschmidt
e601d05cbd docs: update linux build instructions (#49030)
* docs: update linux build instructions

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

* Update docs/development/build-instructions-linux.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-11-24 14:36:32 -05:00
electron-roller[bot]
66367e9db4 chore: bump chromium to 144.0.7527.0 (main) (#48959)
* chore: bump chromium in DEPS to 144.0.7527.0

* 7106405: [video pip] Fix gesture handling issues

https://chromium-review.googlesource.com/c/chromium/src/+/7106405

* 7130938: Reland "Remove some dependencies from the custom_handlers component"

https://chromium-review.googlesource.com/c/chromium/src/+/7130938

* 7139361: Rename PluginService's GetPlugins methods

https://chromium-review.googlesource.com/c/chromium/src/+/7139361

* chore: fixup patch indices

* test: fix macos webgl test | 7128438: Reland "Flip SwiftShader deprecation to launched." | https://chromium-review.googlesource.com/c/chromium/src/+/7128438

* test: update webgl test to skip on fallback adapters

* Fixup spec runner to properly fail on linux when tests fail

* test: fixup dbus tests

* test: convert shared-texture-spec from old done callback to async

Fixes Error: done() called multiple times in test <sharedTexture module import shared texture produced by osr successfully imported and rendered with subtle api> of file /__w/electron/electron/src/electron/spec/api-shared-texture-spec.ts

* test: fixup shared texture spec

* Revert "test: fixup dbus tests"

This reverts commit 3e2e720003.

* test: fixup dbus tests

* test: disable context menu spellcheck tests on linux

https://github.com/electron/electron/pull/48657 broke those tests

* disable sharedTexture tests on platforms other than macOS arm64

They were not working on other platforms previously but now they error out.

Also removed extraneous debugging.

* fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug

* Use --immutable-cache to allow native module builds

* fix: wait for devtools blur event in focus test to avoid race condition

* fix: wait for devtools blur event in focus test to avoid race condition

* fix allow native module builds in spec workspace

* test:rebuild native modules

* Revert "fix allow native module builds in spec workspace"

This reverts commit ffda3be98c.

* Revert "Use --immutable-cache to allow native module builds"

This reverts commit 2e6eea4348.

* Revert "fix: use github.sha for yarn cache key to avoid hashFiles() composite action bug"

This reverts commit 33560ba0de.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-11-24 12:30:57 -05:00
Teo Yu Qi
05233b4962 docs: explain how to create transparent window using BaseWindow (#48921)
docs: clarify how to create transparent BaseWindow
2025-11-23 21:40:42 +01:00
Shelley Vohr
e4f02faa0a fix: only call popup closecallback for top-level menu (#49017) 2025-11-21 10:37:46 -05:00
Robo
d890ebd9fa chore: backport 744f40f from devtools-frontend (#49027) 2025-11-21 10:35:41 -05:00
Robo
79e17ce4be fix: exception when reading system certificates via nodejs (#49028) 2025-11-21 10:35:05 -05:00
reito
2200a70e8d feat: import shared texture supports nv12. (#48922) 2025-11-21 10:32:29 -05:00
John Kleinschmidt
203540c8aa build: automatically install git for dugite (#49022) 2025-11-20 10:12:02 -05:00
BILL SHEN
8f9637fde4 fix: revert the parent window remained interactive after the modal window was opened (#48977) 2025-11-19 18:24:12 +01:00
dependabot[bot]
5b5b24775e build(deps): bump github/codeql-action from 4.31.2 to 4.31.3 (#48997)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.2 to 4.31.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](0499de31b9...014f16e7ab)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:40 +01:00
dependabot[bot]
eb4b7bb82f build(deps): bump actions/checkout from 5.0.0 to 5.0.1 (#48998)
Bumps [actions/checkout](https://github.com/actions/checkout) from 5.0.0 to 5.0.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](08c6903cd8...93cb6efe18)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-19 09:45:28 +01:00
Shelley Vohr
13e84e6868 fix: abort more descriptively for beforeunload (#48960) 2025-11-18 12:16:08 -05:00
electron-roller[bot]
54a617caab chore: bump node to v24.11.1 (main) (#48917)
* chore: bump node in DEPS to v24.11.1

* src: add a default branch for module phase

https://github.com/nodejs/node/pull/60261

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* chore: update patches

* src: update locks to use DictionaryTemplate and other minor cleanups

https://github.com/nodejs/node/pull/60061

* deps: update simdjson to 4.0.7

https://github.com/nodejs/node/pull/59883

* test: move sea tests into test/sea

https://github.com/nodejs/node/pull/60250

* fixup deps: update simdjson to 4.0.7a

* src: conditionally disable source phase imports by default

https://github.com/nodejs/node/pull/60364

* module: handle null source from async loader hooks in sync hooks

https://github.com/nodejs/node/pull/59929

* Revert "src: conditionally disable source phase imports by default"

This reverts commit 5f85b84262.

* src: allow disabling JS source phase imports

https://github.com/nodejs/node/pull/60364

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-18 09:34:51 -05:00
Robo
530be28bc5 fix: handle empty event scenario in ipc callbacks (#48987) 2025-11-17 15:28:25 -05:00
Samuel Attard
537fd7b10b build: update to yarn v4 (#48243) 2025-11-17 15:18:14 -05:00
Keeley Hammond
3809093511 build: add header for SetStackDumpFirstChanceCallback in renderer client (#48978) 2025-11-15 11:32:08 +01:00
Keeley Hammond
71be38f87f fix: revert enabling WASM trap handlers in all Node.js processes (#48973)
Revert "fix: enable wasm trap handlers in all Node.js  processes (#48788)"

This reverts commit ca0b46b413.
2025-11-14 15:23:15 -08:00
Samuel Attard
925966fde4 build: limit workflow gh token permissions (#48237) 2025-11-14 12:11:42 -08:00
Noah Gregory
2d5597b1b0 feat: validate integrity of ASAR Integrity dictionary on macOS (#48587) 2025-11-14 11:24:08 -08:00
Shelley Vohr
e3a0ac06e2 test: add view.getBounds|setBounds tests (#48936)
test: add view.getBounds|setBounds tests
2025-11-14 14:46:21 +01:00
Keeley Hammond
b66bf5db0c build: correct uploader copy for tar files (#48953) 2025-11-13 20:07:52 -08:00
Charles Kerr
16f1ec9001 refactor: use std::map::extract() in api::WebRequest (#48929)
refactor: use std::map::extract() in api::WebRequest

Small readability refactor to api::WebRequest::blocked_requests_:
use extract() when we want to pull a BlockedRequest from the map
and then process it.
2025-11-13 16:50:13 -05:00
Keeley Hammond
c896ab80fe fix: handle tar.xz files in uploaders, add to breaking changes (#48941)
* fix: handle tar.xz files in uploaders, add to breaking changes

* docs: add additional file extension info
2025-11-13 13:03:24 -08:00
Shelley Vohr
40b6738735 test: fix types in chromium-spec (#48943) 2025-11-13 15:25:09 -05:00
Niklas Wenzel
05b9a5bfc7 docs: fix docs for app.isHardwareAccelerationEnabled() (#48925) 2025-11-13 14:39:59 -05:00
Fedor Indutny
b9d3f15265 fix: crash on windows when UTF-8 is in path (#48898)
In 6399527761 we changed the path strings
that `node_modules.cc` operates on from single-byte to wide strings.
Unfortunately this means that `generic_path()` that the
"fix: ensure TraverseParent bails on resource path exit" patch was
calling was no longer a safe method to call on Windows if the underlying
string has unicode characters in it.

Here we fix it by using `ConvertGenericPathToUTF8` from the Node.js
internal utilities.
2025-11-13 19:09:34 +01:00
electron-roller[bot]
8ecd064d2c chore: bump chromium to 144.0.7526.0 (main) (#48932)
* chore: bump chromium in DEPS to 144.0.7526.0

* 7138583: [Partitioned Popins Removal] IPC

https://chromium-review.googlesource.com/c/chromium/src/+/7138583

* chore: fixup patch indices

* 7139794: Partially remove check for global handlers in plugin mime_type code

https://chromium-review.googlesource.com/c/chromium/src/+/7139794

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 11:09:51 -05:00
Niklas Wenzel
511809ef63 docs: explain how to load SF Symbols with nativeImage (#48908)
* docs: explain how to load SF Symbols with `nativeImage`

* fix: use single quotes

* fix: use single quotes
2025-11-13 10:41:00 -05:00
Nilay Arya
32ae696ee0 feat: add --disable-geolocation command-line flag for macOS (#45934)
* feat(macos): add --disable-geolocation-mac command-line flag

* internally deny geolocation requests if flag set

e

* wrap PermissionRequestHandler instead

* wrap custom handler and deny regardless of response

* Update docs/api/command-line-switches.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* resolving conflicts during rebase

* tests added

* tests added: minor changes

* move IsGeolocationDisabledViaCommandLine inside ElectronPermissionManager as a static member

* test: inject fixturesPath via --boot-eval

* Update shell/browser/electron_permission_manager.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: Fixup after merge

* fixup after merge

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
Co-authored-by: Robo <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-13 10:39:03 -05:00
Niklas Wenzel
b121065984 docs: clarify meaning of string value for menu item icon (#48919)
* docs: clarify meaning of string value for menu item icon

* fix: format

* fix: wording
2025-11-13 16:10:18 +01:00
Keeley Hammond
2622e6606d build: apply additional compression to dsym on upload (#48930)
build: use tar.xz compression
2025-11-13 10:43:53 +01:00
electron-roller[bot]
10b07deb97 chore: bump chromium to 144.0.7522.0 (main) (#48892)
* chore: bump chromium in DEPS to 144.0.7522.0

* 7131867: Remove GenericScopedHandle::IsValid in favor of is_valid

https://chromium-review.googlesource.com/c/chromium/src/+/7131867

* 7078879: [video pip] Remove old controls

https://chromium-review.googlesource.com/c/chromium/src/+/7078879

* chore: fixup patch indices

* 7128138: Add a pref to enable Secure DNS 'automatic mode with DoH fallback'.

https://chromium-review.googlesource.com/c/chromium/src/+/7128138

* chore: fixup indices

* fix: pip patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-13 09:49:51 +01:00
vulture
92a910d15c fix: Windows: Calling window.setFocusable(true) will no longer cause a window to lose focus (#45640)
Make setFocusable only deactivate a window if focusable is false. Do not deactivate a window when setting focusable to true.
2025-11-12 15:15:40 -05:00
Charles Kerr
3c5513015a refactor: make api::WebRequest inherit from gin::Wrappable (#48762)
* refactor: make api::WebRequest inherit from gin::Wrappable

refactor: remove unused v8::Isolate* arg from WebRequest ctor

refactor: make electron::api::Session::web_request_ a cppgc::Member<api::WebRequest>

refactor: allocate api::WebRequest on cpp heap

refactor: modify Create(), Find(), and FindOrCreate() to return a WebRequest*

* refactor: ProxyingURLLoaderFactory takes a concrete api::WebRequest instead of a WebRequestAPI

Experimental commit to ensure `ProxyingURLLoaderFactory::web_request_api_`
won't be a dangling pointer.

* chore: fix doc shear

* refactor: use cppgc::WeakPersistent<> in ProxyingURLLoaderFactory

* refactor: make ProxyingURLLoaderFactory::web_request_ const

* refactor: make ProxyingWebSocket::web_request_ a cppgc::WeakPersistent<>

* add a gin::WeakCellFactory to api::WebRequest

* refactor: use a gin::WeakCell for the bound WebRequest argument in HandleOnBeforeRequestResponseEvent()

* chore: update patches
2025-11-12 12:53:00 -06:00
John Kleinschmidt
27727dbe0a docs: deprecate clipboard API access from renderer processes (#48877) 2025-11-12 10:16:31 -05:00
정승규
7961206fcb docs: fix v40 stable release date (#48889)
* docs(timelines): Correct v40.0.0 stable release date

On the Electron Timelines tutorial page (/docs/latest/tutorial/electron-timelines), there is a clear typo in the release schedule for v40.0.0.

The table currently lists the dates as:
* Alpha: 2025-Oct-30
* Beta: 2025-Dec-03
* **Stable: 2025-Oct-28**

This is logically incorrect, as the 'Stable' release date (Oct 28) is listed *before* both the 'Alpha' (Oct 30) and 'Beta' (Dec 03) dates for the same version.

This appears to be a copy-paste error, as the 'Stable' date (2025-Oct-28) is identical to the 'Stable' date for the v39.0.0 release in the preceding row.

This commit updates the 'Stable' date for v40.0.0 to its correct value, ensuring the timeline is accurate and logical.

* docs: Update v40.0.0 stable date to 2026-Jan-13 based on Chromium schedule
2025-11-12 12:59:32 +01:00
dependabot[bot]
7da0b4b351 build(deps): bump actions-cool/issues-helper from 3.7.1 to 3.7.2 (#48884)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.7.1 to 3.7.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](564cd9b1ba...9861779a69)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-11 21:33:27 +01:00
BILL SHEN
3d31030fc5 fix: restore window's canHide property on macOS (#47970)
* fix: restore window's canHide property on macOS

* chore: empty commit to unstick CI

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-11-11 15:30:04 -05:00
Shelley Vohr
11d174344a build: roll Mantle and remove patch (#38437) 2025-11-11 15:25:51 -05:00
dependabot[bot]
687f3d4a92 build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1 (#48721)
* build(deps-dev): bump @electron/asar from 3.2.13 to 4.0.1

Bumps [@electron/asar](https://github.com/electron/asar) from 3.2.13 to 4.0.1.
- [Release notes](https://github.com/electron/asar/releases)
- [Changelog](https://github.com/electron/asar/blob/main/CHANGELOG.md)
- [Commits](https://github.com/electron/asar/compare/v3.2.13...v4.0.1)

---
updated-dependencies:
- dependency-name: "@electron/asar"
  dependency-version: 4.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump Node.js to 22.21.x

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 15:01:19 -05:00
Shelley Vohr
93a611e224 ci: exclude top-level docs files from full CI (#48872) 2025-11-11 11:53:50 -05:00
Shelley Vohr
09db682529 build: remove track SSL_ERROR_ZERO_RETURN explicitly patch (#48875)
build: remove track SSL_ERROR_ZERO_RETURN explicitly patch
2025-11-11 14:16:04 +01:00
electron-roller[bot]
b811ca0cde chore: bump chromium to 144.0.7521.0 (main) (#48880)
* chore: bump chromium in DEPS to 144.0.7521.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-11 13:16:38 +01:00
Robo
f260e06a62 chore: delay load pdfjs-dist for pdf spec (#48888)
trap handlers will be initialized once the user script starts
but before app#ready. Wasm compilation before that phase will
break trap handler registeration due to the check in
v8::internal::wasm::UpdateComputedInformation. For some reason
this issue was only visible in <= 39-x-y when pdf-reader.mjs
was being loaded, maybe some module loading logic changed in >= 40-x-y
which are based on Node.js v24.x. In either case, it is best to
align the loading of wasm module required for the tests in light
of changes to how we are registering the trap handlers for the
main process.
2025-11-11 19:00:39 +09:00
Charles Kerr
b659563724 refactor: use gin_helper's gin::Wrappable-to-v8::Local converter (#48885)
* refactor: Session::NetLog() returns a NetLog*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.

* refactor: FromPath(base::FilePath&, gin::Arguments*) returns a Session*

refactor: FromPartition(std::string&, gin::Arguments*) returns a Session*

Use gin_helper's gin::Wrappable-to-v8::Local converter instead
of rewriting it.
2025-11-11 15:33:25 +09:00
Erick Zhao
dd7c7fddd1 docs: remove electronegativity (#48878) 2025-11-10 20:37:12 -05:00
Kai
bc86e68a72 feat: add bypassCustomProtocolHandlers option to net.request (#47331)
* feat: add bypassCustomProtocolHandlers option to net.request

* style: fix lint errors in api-protocol-spec
2025-11-10 16:37:29 -05:00
Shelley Vohr
4951b96235 feat: support WebSocket authentication handling (#48512)
* feat: support WebSocket authentication handling

* test: add a test

* refactor: route through login instead
2025-11-10 21:30:44 +01:00
electron-roller[bot]
a5cebb6df2 chore: bump chromium to 144.0.7520.0 (main) (#48869)
* chore: bump chromium in DEPS to 144.0.7520.0

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-10 18:44:49 +01:00
Foad Lind
1ad8d35be9 docs: update macOS version support in README (#48785)
Update macOS version support in README

Support for macOS 11 (BigSur) was removed from v38: https://www.electronjs.org/blog/electron-38-0#removed-macos-11-support
2025-11-10 13:57:34 +01:00
electron-roller[bot]
a22511a196 chore: bump chromium to 144.0.7514.0 (main) (#48840)
* chore: bump chromium in DEPS to 144.0.7514.0

* chore: update patches

* 7119882: Reorganize //ui/gfx GN build target

https://chromium-review.googlesource.com/c/chromium/src/+/7119882

* Replace includes with forward declares in rect_conversions.h

https://chromium-review.googlesource.com/c/chromium/src/+/7127098

* Add ssl info to TrustedHeaderClient

https://chromium-review.googlesource.com/c/chromium/src/+/7106780

* Replace ContentPluginInfo with WebPluginInfo

https://chromium-review.googlesource.com/c/chromium/src/+/7127893

* Reland "[temporal] Unflag Temporal"

https://chromium-review.googlesource.com/c/v8/v8/+/7123876

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-10 13:27:35 +01:00
BILL SHEN
068ac3c405 fix: the parent window remained interactive after the modal window was opened (#48770)
fix: fix the issue where the parent window remained interactive after the modal window was opened in somecases.
2025-11-10 12:06:28 +01:00
Robo
87d1ff59cb build: add missing header for SetStackDumpFirstChanceCallback (#48860) 2025-11-10 18:12:02 +09:00
Charles Kerr
1073d7e2bb refactor: remove unused ExtensionActionAPI methods & fields (#48850)
refactor: remove unused method ExtensionActionAPI::GetExtensionPrefs()

refactor: remove unused field ExtensionActionAPI::browser_context_

refactor: remove unused field ExtensionActionAPI::browser_context_

looks like these were added in 5b105f91 but never used
2025-11-10 09:52:11 +01:00
Fedor Indutny
6399527761 fix: ESM-from-CJS import when CJK is in path (#48855)
Upstream fix: https://github.com/nodejs/node/pull/60575
2025-11-10 09:51:56 +01:00
Charles Kerr
519187db1d refactor: decouple api::WebRequest from api::BrowserContext (#48848)
* refactor: rename api::Session::CreateFrom() to api::Session::FromOrCreate()

This is both clearer and more consistent with other classes

* refactor: add Session::FromOrCreate(content::BrowserContext*)

* refactor: reimplement api::WebRequest::FromOrCreate() using api::Session::FromOrCreate()

* refactor: use base::PassKey to ensure WebRequest is only instantiated by Session

* refactor: remove WebRequest::From()

no longer needed; Session already guarantees uniqueness

* refactor: remove unused isolate arg from WebRequest ctor

* refactor: do not attach WebRequest to BrowserContext

no longer needed now that access goes through Session
2025-11-09 08:07:25 -06:00
Shelley Vohr
ab0ff5dffc refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch (#48843)
refactor: remove spellcheck::kWinDelaySpellcheckServiceInit patch
2025-11-08 10:26:06 -06:00
John Kleinschmidt
bec1734d63 chore: update patches (#48847) 2025-11-07 17:12:51 -05:00
Ryota Murakami
78b32cafcb docs: Update 404 devtools extension documentation link (#48813)
* docs: Update 404 devtools extension documentation link

https://developer.chrome.com/extensions/devtools

↑Current link is not exists.

So update to most relevant developer.chrome.com page.

https://developer.chrome.com/docs/extensions/how-to/devtools/extend-devtools#creating

* docs: remove unnecessary anchor link

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-11-07 10:32:33 -05:00
electron-roller[bot]
595920a308 chore: bump chromium to 144.0.7512.1 (main) (#48768)
* chore: bump chromium in DEPS to 144.0.7507.0

* chore: bump chromium in DEPS to 144.0.7508.0

* chore: update patches

* 7101838: [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* chore: update filenames.libcxx.gni

* [pathbuilder] Enforce immutable SkPath APIs globally

https://chromium-review.googlesource.com/c/chromium/src/+/7101838

* Reduce service_worker_info.h includes in headers

https://chromium-review.googlesource.com/c/chromium/src/+/7108401

* chore: bump chromium in DEPS to 144.0.7510.0

* chore: update patches

* Use internal popup menus for tabs in actor-controlled states

https://chromium-review.googlesource.com/c/chromium/src/+/7074751

* [api] Delete deprecated fields on v8::Isolate

https://chromium-review.googlesource.com/c/v8/v8/+/7081397
xref: 98d243aea0

* Fixup Reduce service_worker_info.h includes in headers

* Promote deprecation of v8::Context and v8::Object API methods

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* fixup Promote deprecation of v8::Context and v8::Object API methods

* chore: bump chromium in DEPS to 144.0.7512.1

* chore: update patches

* fixup [pathbuilder] Enforce immutable SkPath APIs global

* chore: update filenames.hunspell.gni

* fix deprecation of v8::Context and v8::Object API methods for nan

https://chromium-review.googlesource.com/c/v8/v8/+/7087956

* [PDF] Implement PdfHelpBubbleHandlerFactory

https://chromium-review.googlesource.com/c/chromium/src/+/7056325

also: [PDF Ink Signatures] Hook up IPH
https://chromium-review.googlesource.com/c/chromium/src/+/7056207

* Remove base/hash/md5.h

https://chromium-review.googlesource.com/c/chromium/src/+/7113738

* fixup for lint

* Remove deprecated interceptor callback types and AccessControl enum

https://chromium-review.googlesource.com/c/v8/v8/+/7112747

* fixup for lint

* fixup [PDF] Implement PdfHelpBubbleHandlerFactory

* use base::SHA1HashString instead of std::hash

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-07 10:13:45 -05:00
Robo
ca0b46b413 fix: enable wasm trap handlers in all Node.js processes (#48788)
* fix: enable wasm trap handlers in all Node.js  processes

* fix: separate registrations to account for featurelist init
2025-11-07 20:56:51 +09:00
Mitchell Cohen
194ce1a1d6 fix: CSD window frame tiles properly on Wayland (#48765)
fix: CSD window frame tiles properly on Linux
2025-11-07 11:24:12 +01:00
Shelley Vohr
b6a9f08be1 refactor: remove allow_unsafe_buffers pragma from FD_ZERO (#48811)
refactor: remove allow_unsafe_buffers pragma from FD_ZERO
2025-11-07 11:23:52 +01:00
reito
bab11f8c7b feat: add sharedTexture module to import shared texture (#47317)
feat: add `sharedTexture` module.
2025-11-07 09:50:28 +01:00
George Xu
38be633aa8 fix(reland): allow disabling all NSMenuItems (#48795)
* fix: allow disabling all `NSMenuItems` (#48598)

fix: allow disabling all NSMenuItems

* fix: add guard for type

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-11-06 19:02:04 -08:00
Robo
9d01e6b3e3 fix: oom crash in v8 when optimizing wasm (#48791) 2025-11-06 21:58:13 +09:00
David Sanders
3c100c2229 build: use --keep-non-patch flag with git am (#48797) 2025-11-06 17:07:09 +09:00
Charles Kerr
f6ffb55c72 refactor: remove electron::WebRequestAPI interface (#48792)
* refactor: remove electron::WebRequestAPI interface

Remove the |electron::WebRequestAPI| interface class.
Use handles to the concrete class |electron::api::WebRequest| instead.

Prerequisite for https://github.com/electron/electron/pull/48762.

Two classes (electron::ProxyingURLLoaderFactory and electron::ProxyingWebSocket)
hold a handle to a WebRequest via |raw_ptr<electron::WebRequestAPI>|.
|electron::WebRequestAPI| is a pure virtual interface whose concrete impl is
|electron::api::WebRequest|.

This is a problem when migrating |electron::api::WebRequest| to cppgc:
we need to change those |raw_ptr<>|s to |cppgc::WeakPersistent<>| but
can't instantiate |cppgc::WeakPersistent<electron::WebRequestAPI>| as-is.
We also can't change it to inherit from |cppgc::GarbageCollectedMixin|,
since that causes problems when |electron::api::WebRequest| inherits from
both |electron::WebRequestAPI| and |cppgc::GarbageCollected|.

* refactor: use name web_request, not web_request_api

* refactor: make ProxyingURLLoaderFactory::web_request() private

* chore: make linter happy by fixing whitespace
2025-11-06 17:05:50 +09:00
Keeley Hammond
27bea2576e fix: revert allow disabling all NSMenuItems, fix menu crash (#48794)
Revert "fix: allow disabling all `NSMenuItems` (#48598)"

This reverts commit 0cb4fdd0f2.
2025-11-05 15:49:43 -08:00
Charles Kerr
c460992407 refactor: remove unnecessary template type in EmitEvent() (#48778)
refactor: remove unnecessary template type in EmitEvent()

refactor: CallMethodWithArgs() takes a std::string_view
2025-11-05 18:28:33 -05:00
Shelley Vohr
1f78d2258c refactor: remove base::AdaptCallbackForRepeating patch (#48774)
refactor: remove base::AdaptCallbackForRepeating patch
2025-11-05 11:00:51 -08:00
BILL SHEN
513a6ee80a fix: draw smoothing round rect corner (#48769) 2025-11-05 10:33:05 +01:00
Keeley Hammond
040b0e795b build: apply additional compression on upload (#48766)
build: apply additional compression on upload for large files
2025-11-04 10:20:42 -05:00
electron-roller[bot]
184586f0b1 chore: bump node to v24.11.0 (main) (#48728)
chore: bump node in DEPS to v24.11.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-11-04 14:09:33 +01:00
dependabot[bot]
26759b8412 build(deps): bump github/codeql-action from 4.31.0 to 4.31.2 (#48764)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.31.0 to 4.31.2.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e94bd11f7...0499de31b9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:33 +01:00
dependabot[bot]
de5041797f build(deps): bump actions-cool/issues-helper from 3.6.2 to 3.7.1 (#48763)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.2 to 3.7.1.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](50068f49b7...564cd9b1ba)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.7.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-11-04 11:54:19 +01:00
axolotl
5bd45a6a28 feat: add SF Symbol support to NativeImage::CreateFromNamedImage (#48203)
* feat: add SF Symbol support to NativeImage::CreateFromNamedImage

* use obj-c name in NSImage constructor

* add test for named symbol image

* apply suggested simplification

* fix: support NX cocoa prefix
2025-11-04 11:15:34 +01:00
David Sanders
d7727c9ec2 build: remove patch that landed in Chromium roll (#48771) 2025-11-04 10:07:52 +01:00
electron-roller[bot]
ba135e2f7f chore: bump chromium to 144.0.7506.0 (main) (#48744)
* chore: bump chromium in DEPS to 144.0.7504.0

* chore: bump chromium in DEPS to 144.0.7506.0

* chore: update patches

* Revert "build: explicitly disable reclient"

This reverts commit e08c6adb08.

No longer needed after https://crrev.com/c/7099239

* 7097498: Remove MSG_ROUTING_* constants from ipc_message.h

https://chromium-review.googlesource.com/c/chromium/src/+/7097498

* 7090671: [//gpu] Remove unneeded GpuInfo methods

https://chromium-review.googlesource.com/c/chromium/src/+/7090671

* 7103701: Remove IPC::PlatformFileForTransit.

https://chromium-review.googlesource.com/c/chromium/src/+/7103701

(This should have been removed with https://github.com/electron/electron/pull/17406).

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-11-03 21:26:16 -08:00
Damglador
a88de8bf1c fix: use app name as a part of tray id on Linux (#48675)
* fix: use browser name as tray id

* fix: remove unnecessary .c_str()

* fix: use string_view instead of string&

* fix: move app_name_ to the bottom of private: section

https://google.github.io/styleguide/cppguide.html#Declaration_Order

* fix: use base's string utils to join strings

* docs: note when to remove the patch

* fix: update patch

* fix: make linter happy

* fix: move app_name_ to the bottom of private: section
2025-11-03 16:53:53 -06:00
Mitchell Cohen
4d6db515bd fix: release mouse buttons on focus loss on Wayland (#48752) 2025-11-03 14:37:42 +01:00
Niklas Wenzel
20fc76cb43 docs: explain how to handle incoming drag and drop (#48718)
Fixes https://github.com/electron/electron/issues/48667
2025-11-03 14:37:01 +01:00
Mitchell Cohen
2a94d414f7 docs: clarify BrowserWindow and App API support status on Wayland (#48740)
* docs: clarify BrowserWindow API support in Wayland

* typo fix

* updated docs

* wrapping
2025-10-31 16:35:08 -05:00
Charles Kerr
4abb1f2aa3 refactor: use Object.values() instead of Object.keys() in stringifyValues() (#48741)
refactor: use Object.values() instead of Object.keys() in stringifyValues

we only used the key to get the value
2025-10-31 16:32:34 -05:00
electron-roller[bot]
310490221e chore: bump chromium to 144.0.7500.0 (main) (#48725)
* chore: bump chromium in DEPS to 144.0.7500.0

* chore: fixup patch indices

* 7088768: Reland "download reclient only for chromeos by default"

https://chromium-review.googlesource.com/c/chromium/src/+/7088768

* Revert "7088768: Reland "download reclient only for chromeos by default""

This reverts commit 149d9fc92e.

* build: explicitly disable reclient

* 7013355: [api] Remove deprecated PropertyCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/7013355

* [video pip] Enable video picture-in-picture controls update

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6701399

* fixup! [api] Remove deprecated PropertyCallbackInfo::Holder()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-10-31 11:01:09 -04:00
Shelley Vohr
3345edd2bf chore: upgrade Node.js to v24.10.0 (#48613)
* chore: upgrade Node.js to v24.10.0

* chore: fixup crypto patch

* chore: fixup crypto test patch

* src: prepare for v8 sandboxing

https://github.com/nodejs/node/pull/58376

* esm: fix module.exports export on CJS modules

https://github.com/nodejs/node/pull/57366

* chore: fixup lazyload fs patch

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* module: remove --experimental-default-type

https://github.com/nodejs/node/pull/56092

* lib,src: refactor assert to load error source from memory

https://github.com/nodejs/node/pull/59751

* src: add source location to v8::TaskRunner

https://github.com/nodejs/node/pull/54077

* src: remove dependency on wrapper-descriptor-based CppHeap

https://github.com/nodejs/node/pull/54077

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* test: update v8-stats test for V8 12.6

https://github.com/nodejs/node/pull/54077

* esm: unflag --experimental-wasm-modules

https://github.com/nodejs/node/pull/57038

* test: adapt assert tests to stack trace changes

https://github.com/nodejs/node/pull/58070

* src,test: unregister the isolate after disposal and before freeing

https://github.com/nodejs/node/pull/58070

* src: use cppgc to manage ContextifyContext

https://github.com/nodejs/node/pull/56522

* src: replace uses of FastApiTypedArray

https://github.com/nodejs/node/pull/58070

* module: integrate TypeScript into compile cache

https://github.com/nodejs/node/pull/56629

* deps: update ada to 3.2.7

https://github.com/nodejs/node/pull/59336

* src: make minor cleanups in encoding_binding.cc

https://github.com/nodejs/node/pull/57448

* src: switch from `Get/SetPrototype` to `Get/SetPrototypeV2`

https://github.com/nodejs/node/pull/55453

* src: use non-deprecated Get/SetPrototype methods

https://github.com/nodejs/node/pull/59671

* src: simplify string_bytes with views

https://github.com/nodejs/node/pull/54876

* src: improve utf8 string generation performance

https://github.com/nodejs/node/pull/54873

* src: use non-deprecated Utf8LengthV2() method

https://github.com/nodejs/node/pull/58070

* src: use non-deprecated WriteUtf8V2() method

https://github.com/nodejs/node/pull/58070

* src: refactor WriteUCS2 and remove flags argument

https://github.com/nodejs/node/pull/58163

* src: use String::WriteV2() in TwoByteValue

https://github.com/nodejs/node/pull/58164

* node-api: use WriteV2 in napi_get_value_string_utf16

https://github.com/nodejs/node/pull/58165

* node-api: use WriteOneByteV2 in napi_get_value_string_latin1

https://github.com/nodejs/node/pull/58325

* src: migrate WriteOneByte to WriteOneByteV2

https://github.com/nodejs/node/pull/59634

* fs: introduce dirent\.parentPath

https://github.com/nodejs/node/pull/50976

* src: avoid copy by using std::views::keys

https://github.com/nodejs/node/pull/56080

* chore: fixup patch indices

* fix: errant use of context->GetIsolate()

* fix: tweak BoringSSL compat patch for new changes

* fix: add back missing isolate dtor declaration

* fixup! esm: fix module.exports export on CJS modules

* cli: remove --no-experimental-fetch flag

https://github.com/nodejs/node/pull/52611/files

* esm: Source Phase Imports for WebAssembly

https://github.com/nodejs/node/pull/56919

* fixup! src: prepare for v8 sandboxing

* chore: bump @types/node to v24

* chore: fix const assignment in crypto test

* fix: sandbox pointer patch issues

* chore: rework source phase import patch

* src: add percentage support to --max-old-space-size

https://github.com/nodejs/node/pull/59082

* chore: fixup crypto tests

* chore: HostImportModuleWithPhaseDynamically todo

* fix: cjs esm failures

* fix: v8::Object::Wrappable issues

- b72a615754
- 490bac2496
- 4896a0dd69

* chore: remove deleted specs

* src: use v8::ExternalMemoryAccounter

https://github.com/nodejs/node/pull/58070

* fs: port SonicBoom module to fs module as FastUtf8Stream

https://github.com/nodejs/node/pull/58897

* chore: tweak sandboxed pr patch

* test: disable parallel/test-os-checked-function

* test: use WHATWG URL instead of url.parse

* fix: OPENSSL_secure_zalloc doesn't work in BoringSSL

* chore: fix accidental extra line

* 7017517: [defer-import-eval] Parse import defer syntax

https://chromium-review.googlesource.com/c/v8/v8/+/7017517
2025-10-30 19:16:48 +01:00
Charles Kerr
c5fe50be3b refactor: remove redundant map lookups in browser/api/menu.ts (#48706)
perf: avoid double map lookup in Menu.prototype._shouldCommandIdWorkWhenHidden

perf: avoid double map lookup in Menu.prototype._isCommandIdVisible

perf: avoid double map lookup in Menu.prototype._shouldRegisterAcceleratorForCommandId

perf: avoid double map lookup in Menu.prototype._getSharingItemForCommandId
2025-10-29 11:42:15 -05:00
electron-roller[bot]
37de243f55 chore: bump chromium to 143.0.7499.0 (main) (#48707)
* chore: bump chromium in DEPS to 143.0.7499.0

* 7079895: Allow full screen reentry when full screen parameters changed

https://chromium-review.googlesource.com/c/chromium/src/+/7079895

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-29 12:32:33 +01:00
Erick Zhao
8c05e4b450 docs: use relative link for OffscreenSharedTexture (#48717) 2025-10-28 15:24:31 -07:00
Keeley Hammond
1eb2858e9a build: bump NMV to 143 for Electron 40 (#48714) 2025-10-28 15:02:26 -07:00
Calvin
c761a7529e docs: add release timeline for Electron 40 (#48663) 2025-10-28 12:42:59 -07:00
Calvin
75c722ca2f docs: remove inaccurate EOL deprecation process (#48696) 2025-10-28 12:40:00 -07:00
byquanton
1d3cc9d554 docs: add caveats for Electron PipeWire implementation (#48242) 2025-10-28 12:39:12 -07:00
Shelley Vohr
0cb4fdd0f2 fix: allow disabling all NSMenuItems (#48598)
fix: allow disabling all NSMenuItems
2025-10-28 11:20:55 -04:00
syntax.sculptor
21dfa8c732 fix: use correct signal variable in nan-spec-runner install check (#48639)
The install process spawn was not capturing its own signal variable,
causing the error check to incorrectly reference the build signal
instead. This could lead to:
- Install termination by signal going undetected
- False positive errors when build was killed but install succeeded

This commit ensures the install signal is properly captured and
checked, matching the pattern used for the build process.
2025-10-28 11:18:47 -04:00
electron-roller[bot]
29e0948f7b chore: bump chromium to 143.0.7497.0 (main) (#48657)
* chore: bump chromium in DEPS to 143.0.7492.0

* chore: bump chromium in DEPS to 143.0.7493.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update printing.patch

Avoid a reachable NOTREACHED() in PrintingContextLinux | https://chromium-review.googlesource.com/c/chromium/src/+/7081117

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Reland "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7079411

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

patch reapplied manually due to context shear

Cleanup: format some content files | https://chromium-review.googlesource.com/c/chromium/src/+/7083290

* chore: update feat_ensure_mas_builds_of_the_same_application_can_use_safestorage.patch

patch manually reapplied for files moved upstream

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: update revert_cleanup_remove_feature_windelayspellcheckserviceinit.patch

no manual changes; patch applied with fuzz

[spelling+grammar restrictions] fix feature param name | https://chromium-review.googlesource.com/c/chromium/src/+/7081186

* chore: update patches

* chore: fix broken includes in ElectronBrowserMainParts

Move os_crypt/sync and os_crypt/async shared code to os_crypt/common | https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* chore: bump chromium in DEPS to 143.0.7495.0

* chore: fixup patch indices

* chore: bump chromium in DEPS to 143.0.7497.0

* chore: fixup patch indices

* 7085081: Roll libc++ from d6739a332fe9 to bc00f6e9f739 (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/7085081

* 7081087: Move os_crypt/sync and os_crypt/async shared code to os_crypt/common

https://chromium-review.googlesource.com/c/chromium/src/+/7081087

* test: fix failing spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-28 11:17:29 -04:00
dependabot[bot]
08492b5977 build(deps): bump actions/upload-artifact from 4.6.2 to 5.0.0 (#48691)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.2 to 5.0.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](ea165f8d65...330a01c490)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:50:01 -05:00
dependabot[bot]
3c1b51d949 build(deps): bump github/codeql-action from 4.30.9 to 4.31.0 (#48692)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.9 to 4.31.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](16140ae1a1...4e94bd11f7)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.31.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 07:49:29 -05:00
michal-pichlinski-openfin
28f1cf1f11 feat: Focus DevTools when breakpoint is triggered (#46386)
`bringToFront` DevTools message is sent when breakpoint is triggered
or inspect is called and Chromium upon this message activates DevTools
via `DevToolsUIBindings::Delegate::ActivateWindow`:
```
void DevToolsWindow::ActivateWindow() {
  if (life_stage_ != kLoadCompleted)
    return;
\#if BUILDFLAG(IS_ANDROID)
  NOTIMPLEMENTED();
\#else
  if (is_docked_ && GetInspectedBrowserWindow())
    main_web_contents_->Focus();
  else if (!is_docked_ && browser_ && !browser_->window()->IsActive())
    browser_->window()->Activate();
\#endif
}
```
which implements: `DevToolsUIBindings::Delegate::ActivateWindow`.

Electron also implements this interface in:
`electron::InspectableWebContents`. However it was only setting
a zoom level, therefore this commit extends it with activation
of the DevTools.

Only supported for DevTools manged by `electron::InspectableWebContents`.

Closes: #37388
2025-10-28 08:46:33 -04:00
Erick Zhao
297319f931 ci: use <sup> in release notes generator (#48690) 2025-10-28 09:06:23 +01:00
dependabot[bot]
7fecc66e12 build(deps): bump actions/download-artifact from 5.0.0 to 6.0.0 (#48693)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](634f93cb29...018cc2cf5b)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:58:28 +01:00
dependabot[bot]
705d120288 build(deps-dev): bump typescript from 5.6.2 to 5.8.3 (#48694)
Bumps [typescript](https://github.com/microsoft/TypeScript) from 5.6.2 to 5.8.3.
- [Release notes](https://github.com/microsoft/TypeScript/releases)
- [Changelog](https://github.com/microsoft/TypeScript/blob/main/azure-pipelines.release-publish.yml)
- [Commits](https://github.com/microsoft/TypeScript/compare/v5.6.2...v5.8.3)

---
updated-dependencies:
- dependency-name: typescript
  dependency-version: 5.8.3
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-28 08:54:56 +01:00
Teaveloper
9ce27e5318 docs: security.md use runnable examples for permissions and csp (#43248)
* docs: security.md use runnable examples for permissions and csp

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* Removed semi-colon for uniform js code style in examples

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>

* docs: security.md, session.md - added clarification on defaultSession, added csp example

* docs: security.md/session.md incorporated review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: security.md/session.md incorporated more review feedback

* docs: tutorial/security.md - fixed linting issue

* chore: empty commit for CI

---------

Signed-off-by: LeUser111 <florian.wiedenmann@grob.de>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-10-27 16:56:53 -04:00
CuzImSlymi
09c22ea979 docs: add net.isOnline() to online/offline detection tutorial (#48665)
* docs: add net.isOnline() to online/offline detection tutorial

* chore: make linter happy

docs/tutorial/online-offline-events.md:12:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]
docs/tutorial/online-offline-events.md:13:1 MD004/ul-style Unordered list style [Expected: dash; Actual: asterisk]

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-27 15:35:38 -04:00
Charles Kerr
e44b96bbd3 refactor: avoid deprecated views a11y api (#47674)
* refactor: use GetViewAccessibility().SetName() instead of SetAccessibleName()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5537333

* refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5337377

* fixup! refactor: use GetViewAccessibility().SetRole() instead of SetAccessibleRole()

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-27 14:05:25 -05:00
Shelley Vohr
b389377c63 feat: add app.isHardwareAccelerationEnabled() (#47614)
* feat: add app.isHardwareAccelerationEnabled()

* chore: address review feedback
2025-10-27 14:03:08 -05:00
zoy
8f6ecd816b docs: modify the thickFrame doc (#48579)
* doc: modify the thickFrame doc

* chore: update description

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* update format

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2025-10-27 13:38:05 -04:00
Charles Kerr
a611881ff3 fix: logical bug in install.js env var handling (#48634)
If either `npm_config_electron_use_remote_checksums` or
`electron_use_remote_checksums` are set as environment variables, then
force Electron to verify with remote checksums instead of embedded ones.

Fixes #48594.
2025-10-27 11:23:45 +01:00
dependabot[bot]
7925a4fe78 build(deps-dev): bump webpack-cli from 5.1.4 to 6.0.1 (#48651)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 5.1.4 to 6.0.1.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/main/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@5.1.4...webpack-cli@6.0.1)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-27 09:21:05 +01:00
Shelley Vohr
eda0a7e749 fix: crash on empty dialog extensions array on Windows (#48640) 2025-10-25 18:14:55 +02:00
electron-roller[bot]
777b6c70a2 chore: bump chromium to 143.0.7491.0 (main) (#48650)
* chore: bump chromium in DEPS to 143.0.7490.0

* chore: bump chromium in DEPS to 143.0.7491.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

Revert "Remove BackForwardTransitions flag" | https://chromium-review.googlesource.com/c/chromium/src/+/7078209

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update allow_electron_to_depend_on_components_os_crypt_sync.patch

no manual changes; patch applied with fuzz

Remove usage of os_crypt/sync in chrome/browser/ui | https://chromium-review.googlesource.com/c/chromium/src/+/7062066

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-24 16:54:44 -05:00
electron-roller[bot]
6d8196fba3 chore: bump chromium to 143.0.7489.0 (main) (#48642)
* chore: bump chromium in DEPS to 143.0.7489.0

* chore: update add_didinstallconditionalfeatures.patch

no manual changes; patch applied with fuzz

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

patch reapplied manually due to context shear

Remove BackForwardTransitions flag | https://chromium-review.googlesource.com/c/chromium/src/+/7022596

* chore: update process_singleton.patch

patch reapplied manually due to context shear

Use an empty prefix for socket temporary directory. | https://chromium-review.googlesource.com/c/chromium/src/+/7062192

* chore: update add_electron_deps_to_license_credits_file.patch

no manual changes; patch applied with fuzz

* chore: update expose_ripemd160.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* chore: update feat_expose_several_extra_cipher_functions.patch

Apply modernize-use-nullptr fixes in all .cc files | https://boringssl-review.googlesource.com/c/boringssl/+/83067

* Pass Bus::Options by value with std::move. | https://chromium-review.googlesource.com/c/chromium/src/+/7056670

* chore: update patches

* Remove some includes of base/callback_list.h | https://chromium-review.googlesource.com/c/chromium/src/+/7055621

* chore: run gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 16:28:51 -04:00
Teaveloper
fbfd7c7126 docs: security.md mark 'Enable process sandboxing' as active by defau… (#43247)
* docs: security.md mark 'Enable process sandboxing' as active by default since electron 20

* Adjusted according to feedback

* Updated according to feedback - adjusted sandbox.md

* formatting

* Fixed broken markup

* Implemented docs linting suggestions

* docs: docs/tutorial/sandbox.md - fixed typo

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: web-preferences.md - sandbox: mention default value and relation to nodeIntegration

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-10-23 16:11:55 -04:00
Ruben R
00e01e0e82 fix: remove killed check to allow multiple signals (#40667)
* fix: remove `killed` check to allow multiple signals

* fix: signal forwarding
2025-10-23 15:20:04 -04:00
Calvin
418b8235bc chore: bump nan to 2.23.0 (#48591)
* chore: bump nan to 2.23.0

* Fix C++ flags passed to C compiler in NAN spec runner

Passing C++-specific flags to the C compiler caused failures building native test modules.

NAN uprgaded the version of node-gyp it uses, triggering a new codepath with the C compiler that didn't occur before. In that new branch, the C++ flags present in the CFLAGS environment variable we were passing in caused the C compiler to error out:

```
error: invalid argument '-std=c++20' not allowed with 'C'
```

The fix is to only pass C++-specific flags to the C++ compiler, and not the C compiler. This is done by separating out the CFLAGS and CXXFLAGS environment variables in our nan-spec-runner.js script.

I'm curious to know more about why each of these flags are necessary, but for now this change restores the previous behavior where native test modules could be built successfully.

* test: use v8 version check instead of node version check (patch)

* Re-enable `methodswithdata-test`
2025-10-23 20:58:40 +02:00
David Sanders
717eb0dca5 ci: add more fields to Slack payload for backport requested message (#48148)
* ci: add more fields to Slack payload for backport requested message

* chore: wrap values with toJSON
2025-10-23 11:58:18 -04:00
Niklas Wenzel
c6c3d405e2 docs: fix Ubuntu version used to build Electron (#48638) 2025-10-23 10:45:45 -04:00
electron-roller[bot]
9235dc0159 chore: bump chromium to 143.0.7485.0 (main) (#48618)
* chore: bump chromium in DEPS to 143.0.7485.0

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Patch applied manually due to context shear

* Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

* chore: e patches all

* chore: check for file existence before setting utime

* chore: stop disabling kWinDelaySpellcheckServiceInit

[cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

This flag has been removed upstream. We've used it since c2d7164 (#38248)
to fix a crash originally described in 97b353a (#34993):

> Delaying spell check initialization is causing specs for
> 'custom dictionary word list API' to fail in Electron.

Since we haven't touched this in a few years, and since there's a
clear success criteria (a passing/failing spec), and since the patch
to restore this flag would be pretty large (~750 lines), I'm going
to try just removing the flag from our source to see if the spec
passes or fails.

* Revert "chore: stop disabling kWinDelaySpellcheckServiceInit"

This reverts commit e688880396.

Unfortunately, the crash persists.

* Revert [cleanup] Remove feature WinDelaySpellcheckServiceInit | https://chromium-review.googlesource.com/c/chromium/src/+/7012087

We currently need this feature

* fixup! chore: check for file existence before setting utime

* fixup! Move SetSupportsDraggableRegions mojom IPC from chrome/ and extensions/ to blink/ | https://chromium-review.googlesource.com/c/chromium/src/+/7043264

Address Robo's code review @ 64c7fd21ed

* fixup! fixup! chore: check for file existence before setting utime

fix: oops typo

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-23 08:30:29 -05:00
Shelley Vohr
f784ea6f4f fix: icon in Windows toast notification (#48543) 2025-10-21 15:12:26 -04:00
Tau Gärtli
7ec0ebc50a feat: Add getAccentColor on Linux (#48027)
* feat: Implement `getAccentColor` on Linux

* doc: Update OS support for accent color APIs
2025-10-21 14:26:30 -04:00
dependabot[bot]
4d329d466b build(deps): bump actions/checkout from 4.2.2 to 5.0.0 (#48051)
* build(deps): bump actions/checkout from 4.2.2 to 5.0.0

Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.2 to 5.0.0.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](11bd71901b...08c6903cd8)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: remove inaccurate version information

Version can easily be determined from sha

* ci: link node 24 for linux arm testing

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 14:12:05 -04:00
Shelley Vohr
e766d378e1 feat: enable more granular a11y feature management (#48042)
* feat: enable more granular a11y feature management

* Update docs/api/app.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-21 10:56:14 -04:00
Shelley Vohr
0a19176917 feat: enable resetting accent color (#48274) 2025-10-21 10:49:08 -04:00
Shelley Vohr
6562d6ed0b fix: systemPreferences.getAccentColor inverted color (#48511)
fix: systemPreferences.getAccentColor inverted color
2025-10-21 10:46:46 -04:00
Shelley Vohr
0b179f8f05 fix: devtools crashing on Linux in detach mode (#48600) 2025-10-21 10:45:02 -04:00
Shelley Vohr
89d3067dd4 fix: trafficLightPosition incorrect with customButtonsOnHover (#48538)
fix: trafficLightPosition incorrect with customButtonsOnHover
2025-10-21 10:43:04 -04:00
electron-roller[bot]
00a3031357 chore: bump chromium to 143.0.7483.0 (main) (#48590)
* chore: bump chromium in DEPS to 143.0.7482.0

* chore: bump chromium in DEPS to 143.0.7483.0

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update mas_avoid_private_macos_api_usage.patch.patch

[graphite] Refactor backpressure fences on Mac to avoid GLContext | https://chromium-review.googlesource.com/c/chromium/src/+/7047167

* chore: update disable_compositor_recycling.patch

no manual changes; patch applied with fuzz

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update allow_disabling_blink_scheduler_throttling_per_renderview.patch

[CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

* chore: update feat_allow_code_cache_in_custom_schemes.patch

[url] Change Add*Scheme*(...) functions to accept std::string_view | https://chromium-review.googlesource.com/c/chromium/src/+/7046471

* chore: e patches all

* [memory] Replace bool success with MemoryDumpRequestOutcome enum. | https://chromium-review.googlesource.com/c/chromium/src/+/7029767

* [CodeHealth] Remove RenderWidgetHostImpl::is_hidden() | https://chromium-review.googlesource.com/c/chromium/src/+/7050059

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-10-21 08:11:09 -05:00
dependabot[bot]
46c344fb1c build(deps): bump github/codeql-action from 4.30.8 to 4.30.9 (#48606)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 4.30.8 to 4.30.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f443b600d9...16140ae1a1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.9
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 10:47:44 +02:00
dependabot[bot]
28cf65eb33 build(deps): bump actions/setup-node from 5.0.0 to 6.0.0 (#48607)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 5.0.0 to 6.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](a0853c2454...2028fbc5c2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 6.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-21 07:30:39 +02:00
John Kleinschmidt
2a0c368105 build: use one build target (#48527)
This reverts commit Optimizes our builds for use with siso/avoids file contention on Windows
2025-10-20 15:57:50 -04:00
Mitchell Cohen
0c27c1a395 fix: position window titlebar buttons correctly in Ubuntu on Wayland (#48490) 2025-10-20 12:42:23 -07:00
Michaela Laurencin
a528547dc8 chore: exempt tracking-upstream issues from stale (#48574) 2025-10-20 11:47:58 -04:00
Shelley Vohr
413803188d fix: background hover contrast for WCO buttons (#48568) 2025-10-20 09:54:14 +02:00
electron-roller[bot]
1cc2fce905 chore: bump chromium to 143.0.7477.0 (main) (#48584)
* chore: bump chromium in DEPS to 143.0.7477.0

* 7049117: [CodeCache] Adjust PersistentCache for CodeCache feature

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7049117

* chore: update patches

* chore: add missing includes of ui/gfx/image/image_skia.h

* 7028738: Rename several ipc_* files used by param_traits*

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7028738

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-19 21:46:34 +02:00
electron-roller[bot]
3bfe1f2363 chore: bump chromium to 143.0.7474.0 (main) (#48572)
* chore: bump chromium in DEPS to 143.0.7474.0

* 7006208: [Mac] Fix rendering bug for manual occlusion detection on macOS 26

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006208

* chore: update patches

* 7038563: Forward declare more in page_navigator.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7038563

* 7023417: Remove ipc/ipc_message_macros.h

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023417

* 7006340: Move icon_util files to win/ subdrectory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7006340

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-17 13:04:24 -04:00
Shelley Vohr
7e031f7e33 ci: fix publish for macOS < 26.0 (#48575) 2025-10-16 16:53:13 -07:00
Robo
7580e3a5e2 chore: update fix_harden_blink_scriptstate_maybefrom.patch (#48566) 2025-10-16 10:16:17 +09:00
electron-roller[bot]
471a14432f chore: bump chromium to 143.0.7469.0 (main) (#48548)
* chore: bump chromium in DEPS to 143.0.7469.0

* 7021651: [//gpu] Fold handle creation into D3DImageBackingFactory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7021651

* 7013047: Fix various C++23 build errors in //chrome

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7013047

* 7010850: [//ui] Port screen_mac.mm's calls to DisplayColorSpaces

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7010850

* 7007933: Remove superfluous mojom includes in //content/public headers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7007933

* 7023196: Trim os_crypt/sync visibility list

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7023196

* 7008912: Remove GURL::*_piece() method

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7008912

* 7003989: Add wrapper struct for CopyFromSurface output

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7003989

* 7017889: [MemoryPressureListener] Remove type aliases

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7017889

* 7027780: Delete viz::ResourceSizes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/7027780
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6989572

* 6495189: [api] Delete old String::Write* APIs

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6495189

* chore: update patches

* chore: run script/gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-10-15 14:10:10 -07:00
Shelley Vohr
676406c9e6 build: run on macOS 15 (#48563) 2025-10-14 13:29:21 -07:00
CezaryKulakowski
357e42d907 fix: fixed white flash on call to BrowserWindow.show (#47151) 2025-10-14 15:58:27 +02:00
お餅のCreeeper
9b740594fb fix: enable shader-f16 on windows (#48342)
* fix: Enable shader-f16 on Windows

* fix: include dxil.dll and dxcompiler.dll for windows x64 and arm64

* fix: modified to follow the chromium dawn build configuration

* fix: include dxil.dll and dxcompiler.dll for windows x86

* fix: Modified to avoid explicitly specifying dawn_use_built_dxc
2025-10-14 15:46:12 +02:00
dependabot[bot]
9e577ae60e build(deps): bump ossf/scorecard-action from 2.4.2 to 2.4.3 (#48551)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.2 to 2.4.3.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](05b42c6244...4eaacf0543)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.3
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 14:45:03 +02:00
dependabot[bot]
b74bd8fc35 build(deps): bump github/codeql-action from 3.30.6 to 4.30.8 (#48552)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.6 to 4.30.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](64d10c1313...f443b600d9)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 4.30.8
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-14 11:29:55 +02:00
David Sanders
f494dbb609 ci: upload build cache hit rate on Windows as well (#48550) 2025-10-14 09:57:47 +02:00
David Sanders
8dc5999f8b build(deps): bump @electron/typescript-definitions to 9.1.5 (#48210) 2025-10-13 10:46:34 -07:00
electron-roller[bot]
d920c82fc4 chore: bump chromium to 143.0.7451.0 (main) (#48362)
* chore: bump chromium in DEPS to 142.0.7429.0

* chore: bump chromium in DEPS to 142.0.7430.0

* 6954508: Reland Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6954508

* https://chromium-review.googlesource.com/c/chromium/src/+/6955633

* 5584820: Fix font face resolution when renderer is blocked | https://chromium-review.googlesource.com/c/chromium/src/+/5584820

* chore: export patches

* chore: remove patch that keeley says is ok to remove in comments

* chore: bump chromium in DEPS to 142.0.7432.0

* chore: export patches

* chore: bump chromium in DEPS to 142.0.7434.0

* 6973697: Use type tags for data stored in V8 internal fields | https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* 6976272: Revert Reland mac: click through content area in main window | https://chromium-review.googlesource.com/c/chromium/src/+/6976272

* chore: export patches

* 6938086: Rename native_widget_types.h -> native_ui_types.h | https://chromium-review.googlesource.com/c/chromium/src/+/6938086

* 6951252: Correct PersistentCache backed code cache context grouping

* chore: bump chromium in DEPS to 142.0.7436.0

* 6981628: Reland Use unordered_map in AcceleratorMap | https://chromium-review.googlesource.com/c/chromium/src/+/6981628

* chore: export patches

* chore: resolve patch conflict with main

* chore: merge conflict with main

* chore: bump chromium in DEPS to 142.0.7438.0

* chore: bump chromium in DEPS to 142.0.7440.0

* chore: bump chromium in DEPS to 142.0.7442.0

* chore: bump chromium in DEPS to 142.0.7444.0

* chore: bump chromium in DEPS to 143.0.7445.0

* chore: bump chromium in DEPS to 143.0.7447.0

* chore: bump chromium in DEPS to 143.0.7449.0

* chore: bump chromium in DEPS to 143.0.7451.0

* 7001364: Migrate GURL accessors to Get* variants in //content | https://chromium-review.googlesource.com/c/chromium/src/+/7001364

* 6986521: Implicit second value 'any' instead of 'span-all' for fallback query | https://chromium-review.googlesource.com/c/chromium/src/+/6986521

* chore: update chromium patches

* chore: update chromium patches

* chore: update patches

* fix: parse macOS SDK version across line break
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* fix: replace v8::Object::SetPrototype() usage
https://chromium-review.googlesource.com/c/v8/v8/+/6983465
https://github.com/nodejs/node/pull/55453

* fix: regenerate filenames.libcxx.gni
https://chromium-review.googlesource.com/c/chromium/src/+/6980307

* fix: replace additional usages of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* build: use macos 15 minimum
https://chromium-review.googlesource.com/c/chromium/src/+/6980166

* ci: ignore missing dir for strip_universal_deep

* fix: js2c compilation failure

https://chromium-review.googlesource.com/c/chromium/src/+/6950738

See patch description explaining MacOS 26 SDK headers incompatibility.

* fixup! chore: export patches

* feat: add new memory-eviction exit reason
https://chromium-review.googlesource.com/c/chromium/src/+/6991933

* fix: set JSON reader parsing options
https://chromium-review.googlesource.com/c/chromium/src/+/6992114

* fix: provide DeviceEmulationCacheBehavior param
https://chromium-review.googlesource.com/c/chromium/src/+/6965238

* fix: views::NonClientFrameView -> views::FrameView
https://chromium-review.googlesource.com/c/chromium/src/+/7005027
https://chromium-review.googlesource.com/c/chromium/src/+/6966937

* fix: check new forced colors enum value
https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fix: migrate NetworkConditions -> MatchedNetworkConditions
https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fix: migrate GURL string methods to Get*()
https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: disable C++ modules in electron_lib builds
https://chromium-review.googlesource.com/c/chromium/src/+/6950738

* fix: partially revert is_headless_mode removal
https://chromium-review.googlesource.com/c/chromium/src/+/6955633

This patch should likely be reworked. For now, this partially reverts the
removal of a required class property to restore behavior.

* Revert "build: use macos 15 minimum"

This reverts commit 2fc12d6acc.

Initially this change was made to test if it fixes libcxx
compilation issues. As that's now resolved by disabling libcxx
modules, this can be reverted.

* fix: disable C++ modules in libnode builds

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* fixup! fix: replace v8::Object::SetPrototype() usage https://chromium-review.googlesource.com/c/v8/v8/+/6983465 https://github.com/nodejs/node/pull/55453

* build: switch to macos-15 runner

build/mac/find_sdk.py now requires macOS 15 SDK as a minimum version. The
macos 15 runners default to an Xcode using the 15 SDK and removes older
versions.

* fixup! fix: check new forced colors enum value https://chromium-review.googlesource.com/c/chromium/src/+/6944403

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* fix: use std::u16string for Extension::Create() error parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6975452

* fix: add missing image_skia include
https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fixup! fix: add missing image_skia include https://chromium-review.googlesource.com/c/chromium/src/+/6986762

* fix: remove outdated V8 flag
https://chromium-review.googlesource.com/c/v8/v8/+/6948286

* fix: disable protocol handler DCHECK

https://chromium-review.googlesource.com/c/chromium/src/+/6727594

Ignore the extension custom protocol handler registry DCHECK until
we invest in supporting it. Replacing this DCHECK seems harmless
and will unblock the roll.

* fix: replace deprecated usage of SetPrototype
https://chromium-review.googlesource.com/c/v8/v8/+/6983465

* fixup! fix: migrate NetworkConditions -> MatchedNetworkConditions https://chromium-review.googlesource.com/c/chromium/src/+/6827307

* fixup! fix: migrate GURL string methods to Get*() https://chromium-review.googlesource.com/c/chromium/src/+/7007010

* chore: remove patch already included in roll

* chore: remove extraneous formatting added to patch

* chore: remove fix_harden_blink_scriptstate_maybefrom.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6973697

No longer needed since the above CL landed.

* 6973697: Use type tags for data stored in V8 internal fields

https://chromium-review.googlesource.com/c/chromium/src/+/6973697

* chore: update patches

* fixup! chore: export patches

* chore: restore electron embedder data tag patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-10-13 12:21:54 -04:00
dependabot[bot]
d82b8f3b80 build(deps): bump github/codeql-action from 3.30.5 to 3.30.6 (#48478)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.5 to 3.30.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3599b3baa1...64d10c1313)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.6
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-13 16:02:16 +02:00
Samuel Attard
52929c93db build: fail publish when upload fatal errors (#48537)
We logged a fatal error but didn't exit with code 1 so the publish kept going. This was caught by a sanity check later down the release process but would have been quicker to fail out here.

Also adds some code to maybe workaround the underlying auth error
2025-10-13 12:53:52 +02:00
Shelley Vohr
dd25a6361b fix: auth required websocket crash (#48510) 2025-10-13 10:13:32 +02:00
Zuohui Yang
16b5776b01 fix: launch crash when null device is disabled on Windows (#47870)
fix: fix launch crash when null device is disabled on Windows

add node flag node::ProcessInitializationFlags::kNoStdioInitialization

Co-authored-by: yangzuohui <yangzuohui@bytedance.com>
Co-authored-by: yangliu <yangliu.leo@bytedance.com>
2025-10-11 18:00:04 -04:00
David Sanders
cbf5c3331f ci: fix release branch name in build stats script (#48533) 2025-10-10 22:28:09 -07:00
David Sanders
3359f90389 ci: upload build effective cache hit rate stats to Datadog (#48509) 2025-10-10 19:55:21 -07:00
Erick Zhao
cf9fa5ef65 docs: unmark asar integrity as experimental and clean docs (#48434) 2025-10-10 12:56:48 -07:00
Niklas Wenzel
550e054168 docs: update Azure Trusted Signing availability (#48494)
* docs: update Azure Trusted Signing availability

Source: https://github.com/Azure/trusted-signing-action/issues/93#issuecomment-3383517386

* docs: remove unused link
2025-10-10 11:43:29 -04:00
Shelley Vohr
b992ead837 fix: dialog.showMessageBox defaultid on Windows (#48216)
* fix: dialog.showMessageBox defaultid on Windows

* Update shell/browser/ui/message_box_win.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-10-10 15:39:23 +02:00
Shelley Vohr
11f76118db fix: unexpected openExternal dialog on macOS Tahoe (#48502)
fix: unexpected openExternal dialog on macOS Tahoe
2025-10-10 12:48:44 +02:00
Robo
37c7487600 fix: crash when inspector evaluates on provisional frames (#48503) 2025-10-10 11:34:09 +02:00
reito
9e46efb8f7 feat: offscreen rendering support rgbaf16 hdr output format. (#48265)
* feat: offscreen rendering support rgbaf16

* docs: update doc

* docs: update doc.
2025-10-09 10:33:34 +02:00
dependabot[bot]
9c38917a14 build(deps): bump actions/github-script from 7.0.1 to 8.0.0 (#48329)
Bumps [actions/github-script](https://github.com/actions/github-script) from 7.0.1 to 8.0.0.
- [Release notes](https://github.com/actions/github-script/releases)
- [Commits](60a0d83039...ed597411d8)

---
updated-dependencies:
- dependency-name: actions/github-script
  dependency-version: 8.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-09 10:33:24 +02:00
zoy
3a53c71324 fix: broken transparent window styles on resizable change (#48378)
* fix: wrong api call

* fix: consistency of the resize state

* fix: edge cases

* chore: add detailed comments

* fix: lint

* chore: only windows

* chore: use transparent
2025-10-09 09:49:20 +02:00
David Sanders
0d478ec69c ci: ignore lost communication with server annotation in audit (#48493) 2025-10-09 09:48:56 +02:00
Erick Zhao
9143f7c6e2 docs: clarify postinstall requirements (#48485)
postinstall
2025-10-09 09:48:47 +02:00
Erick Zhao
df86312e2f docs: add note for node_modules for Yarn and pnpm (#48484)
* Add instructions on using node_modules with Yarn

* update text for pnpm

---------

Co-authored-by: CodingOtto <otto+github@fysiker.fi>
2025-10-09 09:48:22 +02:00
Ulises Gascón
ffbae02a95 docs: add security escalation policy (#48317) 2025-10-08 15:19:07 -07:00
Sam Maddock
a87ee21f5c build: bump version in .nvmrc to 22 (#48413) 2025-10-08 14:21:55 -04:00
electron-roller[bot]
ea8f43f9b9 chore: bump node to v22.20.0 (main) (#48383)
* chore: bump node in DEPS to v22.20.0

* chore: fixup patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-10-08 15:19:08 +02:00
Fedor Indutny
e8e91c331a feat: dynamic ESM import in preload without context isolation (#48375)
Dynamic ESM import in non-context-isolated preload

Extend `HostImportModuleWithPhaseDynamically`'s routing to support
Node.js import resolution in non-context-isolated preloads through
`v8_host_defined_options` length check. The length of host defined
options is distinct between Blink and Node.js and we can use it to
determine which resolver to use.
2025-10-08 10:44:09 +02:00
Charles Kerr
49c1139ab9 chore: remove unused reference to api::BrowserView (#48474)
chore: remove unused reference to api::BrowserView

Unused since #35658 / 15c60143
2025-10-08 10:43:28 +02:00
dependabot[bot]
16bcd645b5 build(deps): bump actions/stale from 9.1.0 to 10.1.0 (#48477)
Bumps [actions/stale](https://github.com/actions/stale) from 9.1.0 to 10.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](5bef64f19d...5f858e3efb)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-version: 10.1.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-10-08 09:56:23 +02:00
John Kleinschmidt
6756974828 build: fixup chromedriver and mksnapshot (#48470)
* build: update build tools to get proper exit codes from e build

xref: https://github.com/electron/build-tools/pull/759

* build: target zips directly

mksnapshot and chromedriver have issues with siso trying to run a separate build and zip step, so just target the zip target

* build: don't unzip chromedriver and mksnapshot in tests

The contents of these files are not used in testing, so we shouldn't unzip them.
2025-10-06 23:22:55 -04:00
Keeley Hammond
d6dfd4ed7a build: handle Metal toolchain being unbundled from Xcode 26 (#48467)
* chore: add metal patch dir

* chore: cherry-pick 2f564f1ca07b from angle (#48465)

* chore: update patch
2025-10-06 10:17:46 -04:00
Charles Kerr
a1ca9a8d55 refactor: DRY in App::SetAppLogPath() (#48452) 2025-10-05 12:32:28 -05:00
Charles Kerr
38e491689a perf: avoid a little extra work in InvokeIpcCallback() (#48456)
perf: two minor perf refactors in InvokeIpcCallback()

1. Allocate the CallbackScope on the stack instead of the heap
2. Skip a redundant call to  node::Environment::GetCurrent()
2025-10-04 21:52:53 -07:00
Niklas Wenzel
6e2be00f0f docs: recommend calling renderer process modules from preload script (#48427) 2025-10-04 18:44:10 +02:00
Charles Kerr
497b5a68a4 docs: clarify optional args in webFrame.executeJavaScript() (#48447) 2025-10-04 09:28:06 -05:00
Kaiichiro Ota
715808ecbe docs: mention that webUtils should be used via preload script (#45861)
* docs: mention that webUtils should be used via preload script

* docs: suppress lint errors

* docs: clarify webUtils usage scope

* docs: exclude potentially dangerous alert() in the example code

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: minor change

* docs: make linter happy

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: apply suggestion

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* docs: minor change

* docs: minor change

* docs: remove preload line

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-10-03 13:07:38 -07:00
Charles Kerr
01cab978f7 refactor: remove gin_helper::Arguments (#48374)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in StopRecording()

* refactor: use gin::Arguments in ImageView::New()

* refactor: use gin::Arguments in AppendSwitch()

* refactor: use gin::Arguments WebContentsView::New()

* refactor: make gin::Arguments arg const in WrappableBase::InitWithArgs()

This makes explicit that we are using it for wrapper + isolate, not the args values

* refactor: remove gin_helper::Arguments arg from ExposeAPI()

refactor: remove gin_helper::Arguments arg from ExposeAPIInWorld()

* refactor: remove gin_helper::Arguments arg from ElectronBindings::GetSystemMemoryInfo()

* refactor: remove gin_helper::Arguments arg from preload_utils::GetBinding()

* refactor: use gin::Arguments in OpenExternal()

* refactor: use gin::Arguments in ExecuteInWorld()

* refactor: use gin::Arguments in ExecuteJavaScript()

* refactor: use gin::Arguments in InvokeNew()

* refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

* refactor: remove unused GetNextArgument() marshaller for gin_helper::Arguments

* refactor: remove unused #include gin_helper/arguments.h

* chore: remove unused gin_helper::Arguments

* fixup! refactor: use gin::Arguments in ExecuteJavaScriptInIsolatedWorld()

Xref: https://github.com/electron/electron/pull/48447
2025-10-03 14:10:29 -05:00
zoy
7cb1552614 fix: accentColor set distinguishes the frame (#48405)
* fix: accentColor set distinguishes the frame

* chore: invalid change

* fix: lint
2025-10-03 20:10:18 +02:00
Niklas Wenzel
49c37b4daa docs: update allowed window.open options (#48428) 2025-10-03 01:29:26 +02:00
Robo
37a115b8fd fix: initialze featurelist before parsing features (#48411) 2025-10-03 01:18:14 +02:00
Shelley Vohr
e7e29ea876 fix: snapped window restoring to correct position (#48296) 2025-10-02 18:14:48 +02:00
Erick Zhao
b40a4befd4 docs: fix formatting in asar integrity (#48431) 2025-10-01 22:27:28 -07:00
dependabot[bot]
61a7303531 build(deps): bump github/codeql-action from 3.30.1 to 3.30.5 (#48420)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.30.1 to 3.30.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f1f6e5f6af...3599b3baa1)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-30 18:36:57 +02:00
Fedor Indutny
6f9cd718c4 fix: runtime JS error that crashes GetPackageJSON (#48293)
We overriden the `GetPackageJSON` in Node.js to let us read files
straight from the ASAR file instead of disk. The override works by
providing a JS method with the limitation that it should not throw a
runtime error. However, this invariant was accidentally violated by
`asar.splitPath` that sometimes contrary to its' TypeScript definition
returned `false`.
2025-09-30 18:32:13 +02:00
Samuel Attard
a95180e080 build: add missing copied tarball to cloudstore paths (#48408)
It's guarunteed that `iojs-*` and `node-*` were the same origin file (we azcopy them) but this was missing in logs and it annoyed me
2025-09-29 11:16:39 -07:00
BILL SHEN
d4a5fdc8fc fix: add missed enum SaveRequestType to PdfViewerPrivate function (#48372)
fix: add missed SaveRequestType enum to PdfViewerPrivate function
2025-09-26 16:34:06 -04:00
avarayr
3a7c6dd4a5 fix: MacOS 26 Tahoe - stop overriding private cornerMask API to fix WindowServer GPU load (#48376)
fix: macOS stop overriding private cornerMask API to fix WindowServer GPU load spike

Electron fetched a custom `_cornerMask` for `ElectronNSWindow` to smooth
vibrancy corners. On macOS 15 (Tahoe) that private hook forces the window
shadow to be rendered from a fully transparent surface, causing the
WindowServer GPU load regression. Remove the `cornerMask` property and
the `_cornerMask` override so we stay on Apple’s default shadow path.
2025-09-26 12:41:16 -07:00
Robo
26e886c517 fix: disable NSAutoFillHeuristicController on macOS 26 (#48379)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-09-26 08:40:55 +09:00
Charles Kerr
26a473db98 refactor: make api::Menu inherit from gin::Wrappable (#48351)
* refactor: make api::Menu inherit from gin::Wrappable*

* refactor: make api::Menu::kWrapperInfo const

* refactor: use three-arg version of GetConstructor in Menu

refactor: undo branch changes to two-arg version of GetConstructor

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

fix: return type of Menu::New

* fixup! refactor: make api::Menu inherit from gin::Wrappable*

make MenuMac's constructor public so that cppgc can use it

* refactor: Pinnable -> SelfKeepAlive
2025-09-24 19:42:22 -05:00
Charles Kerr
6661457cdf refactor: prefer upstream gin::Arguments::ThrowTypeError() over gin_helper (#48368)
* refactor: use gin::Arguments::ThrowTypeError() in AutoUpdater::SetFeedURL()

* refactor: use gin::Arguments::ThrowTypeError() in Browser::Focus()

* refactor: use gin::Arguments::ThrowTypeError() in SystemPreferences::SetUserDefault()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::Create()

* refactor: use gin::Arguments::ThrowTypeError() in UtilityProcessWrapper::PostMessage()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBundleMover::ShouldContinueMove()

* refactor: use gin::Arguments::ThrowTypeError() in OnClientCertificateSelected()

* refactor: use gin::Arguments::ThrowTypeError() in Session::ClearData()

* refactor: use gin::Arguments::ThrowTypeError() in ElectronBrowserContext::DisplayMediaDeviceChosen()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::ReplaceMisspelling()

* refactor: use gin::Arguments::ThrowTypeError() in WebContents::Print()

* chore: iwyu shell/common/gin_helper/error_thrower.h
2025-09-24 19:10:05 -05:00
John Kleinschmidt
b51e82c5fb test: rerun failed tests individually (#48205)
* test: rerun failed tests individually

* ci: use screencapture-nag-remover

Needed to bypass the popup message "bash" is requesting to bypass the system private window picker and directly access your screen and audio.

* Revert "chore: test with 1st quadrant of the window"

No longer needed because of the addition of the
screencapture-nag-remover script.

This reverts commit f4a7e04c0b.

* test: fixup navigationHistory flake

* rerun test up to 3 times
2025-09-24 13:35:14 -07:00
Charles Kerr
235fdc41f6 refactor: use gin::Arguments in BaseWindow (#48355)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in BaseWindow::MoveAbove()

refactor: use gin::Arguments in BaseWindow::SetAlwaysOnTop()

refactor: use gin::Arguments in BaseWindow::SetIgnoreMouseEvent()

* refactor: use gin::Arguments in BaseWindow::SetProgresBar()

* refactor: use gin::Arguments in BaseWindow::SetVisibleOnAllWorkspaces()

* refactor: use gin::Arguments in BaseWindow::SetVibrancy()

* refactor: use gin::Arguments in BaseWindow::SetAspectRatio()

* refactor: use gin::Arguments in BaseWindow::PreviewFile()

* refactor: use gin::Arguments in BaseWindow::SetThumbarButtons()

* refactor: use gin::Arguments in BaseWindow::SetBounds()

* refactor: use gin::Arguments in BaseWindow::SetContentBounds()

* refactor: use gin::Arguments in BaseWindow::SetSize()

* refactor: use gin::Arguments in BaseWindow::SetContentSize()

* refactor: use gin::Arguments in BaseWindow::SetSheetOffset()

* refactor: use gin::Arguments in BaseWindow::SetPosition()

* refactor: use gin::Arguments in BaseWindow::AddTabbedWindow()

* refactor: use gin::Arguments in BaseWindow::SetParentWindow()

* refactor: use gin::Arguments in BaseWindow::BaseWindow()

* refactor: use gin::Arguments in BaseWindow::SetAccentColor()

* refactor: use gin::Arguments in BaseWindow::SetTitleBarOverlay()
2025-09-24 09:39:16 -04:00
Charles Kerr
6bbbc1232e chore: remove unused, undocumented, untested executionMode arg from web_frame.executeJavaScriptInIsolatedWorld() (#48361)
chore: remove unused, undocumented execution mode arg from web_frame.executeJavaScriptInIsolatedWorld()
2025-09-24 08:13:49 -05:00
Niklas Wenzel
49335805d5 docs: mention setContentProtection macOS limitations (#48290) 2025-09-23 16:28:21 -05:00
John Kleinschmidt
b27e721f69 build: update patches (#48364)
chore: update patches
2025-09-23 16:37:38 -04:00
electron-roller[bot]
1fda08b8c8 chore: bump chromium to 142.0.7417.0 (main) (#48275)
* chore: bump chromium in DEPS to 142.0.7401.0

* 6911185: Reland "Send touch moves async immediately after scroll starts."

https://chromium-review.googlesource.com/c/chromium/src/+/6911185

* 6906887: mac: click through content area in main window

https://chromium-review.googlesource.com/c/chromium/src/+/6906887

* 6916667: Expose helper to eliminate duplicate recipes.

https://chromium-review.googlesource.com/c/chromium/src/+/6916667

* 6909842: Switch LegacyRenderWidgetHostHWND from atlcrack.h to msg_util.h.

https://chromium-review.googlesource.com/c/chromium/src/+/6909842

* 6884056: Remove the SecKeychain implementation for the Keychain interface

https://chromium-review.googlesource.com/c/chromium/src/+/6884056

* 6904906: Remove `WTF::` in renderer/core/[p-x].*/

https://chromium-review.googlesource.com/c/chromium/src/+/6904906

* 6556585: [persistent_cache]: PersistentCache for CodeCache

https://chromium-review.googlesource.com/c/chromium/src/+/6556585

* 6904864: Layout: Support abort on the text placeholder layout

https://chromium-review.googlesource.com/c/chromium/src/+/6904864

* chore: fixup patch indices

* chore: bump chromium in DEPS to 142.0.7402.0

* fixup! 6556585: [persistent_cache]: PersistentCache for CodeCache

* chore: fixup patch indices

* 6905244: [api] Remove deprecated `GetIsolate`

https://chromium-review.googlesource.com/c/v8/v8/+/6905244

* 6897694: Remove NativeTheme::UserHasContrastPreference().

https://chromium-review.googlesource.com/c/chromium/src/+/6897694

* 6897477: Remove GetPlatformHighContrastColorScheme() and enum.

https://chromium-review.googlesource.com/c/chromium/src/+/6897477

* 6918198: Reland "Rename display::Screen::GetScreen() to display::Screen::Get()"

https://chromium-review.googlesource.com/c/chromium/src/+/6918198

* 6907147: [LNA] add use counter for websocket mixed-content issues

https://chromium-review.googlesource.com/c/chromium/src/+/6907147

* 6914538: Replace WTF::String with blink::String

https://chromium-review.googlesource.com/c/website/+/6914538

* 6892538: [video pip] Allow touchscreen users to toggle live caption

https://chromium-review.googlesource.com/c/chromium/src/+/6892538

* chore: fix patch

* chore: bump chromium in DEPS to 142.0.7403.0

* build: remove ninja logs

* chore: fixup patch indices

* 6920670: [PDF] Change pdf_extension_util to return dictionaries

https://chromium-review.googlesource.com/c/chromium/src/+/6920670

* 6917864: Devirtualize and inline various NativeTheme getters.

https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6920873: [PDF] Simplify PDFDocumentHelperClient::OnSaveURL()

https://chromium-review.googlesource.com/c/chromium/src/+/6920873

* build: don't kill blink/web_tests

* 6923655: Roll libc++ from 954086abf121 to b87b2bb112f8 (4 revisions)

https://chromium-review.googlesource.com/c/chromium/src/+/6923655

* 6905242: Reland "[CSP] Clarify report-only console messages."

https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* fixup! 6897694: Remove NativeTheme::UserHasContrastPreference().

* chore: bump chromium in DEPS to 142.0.7405.0

* 6910012: [LNA] Enable LNA enforcement by default

https://chromium-review.googlesource.com/c/chromium/src/+/6910012

* 6929444: Combine GetInstanceForXXX() implementations.

https://chromium-review.googlesource.com/c/chromium/src/+/6929444

* 6927873: Rename native_widget_types.h -> native_ui_types.h

https://chromium-review.googlesource.com/c/chromium/src/+/6927873

* 6853978: Init perfetto really early in WebView

https://chromium-review.googlesource.com/c/chromium/src/+/6853978

* 6874886: Use only one picker observer to avoid getting duplicate notifications

https://chromium-review.googlesource.com/c/chromium/src/+/6874886

* chore: fixup patch indices

* fix: Protocol complex inline dtor

* chore: bump chromium in DEPS to 142.0.7407.0

* chore: bump chromium in DEPS to 142.0.7409.0

* chore: bump chromium in DEPS to 142.0.7411.0

* chore: bump chromium in DEPS to 142.0.7413.0

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

* 6927233: Remove NativeTheme "use dark colors" bit.

https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* chore: fixup patch indices

* 6899206: [PermissionOptions] Multi-state permission subscriptions & setting changes

https://chromium-review.googlesource.com/c/chromium/src/+/6899206

* chore: bump chromium in DEPS to 142.0.7415.0

* 6936895: [headless] Remove headless flag from views::Widget class

https://chromium-review.googlesource.com/c/chromium/src/+/6936895

We should probably followup on this to see if there is a way to do this without reverting this CL.

* 6937023: Reland "Use new DBus type system in dbus_xdg::Request"

https://chromium-review.googlesource.com/c/chromium/src/+/6937023

* chore: update patches

* 6944749: Add GN visibility list to //components/os_crypt/sync

https://chromium-review.googlesource.com/c/chromium/src/+/6944749

* Further replace sub_capture_target_version with CaptureVersion

https://chromium-review.googlesource.com/c/chromium/src/+/6935455

* fixup for lint

* chore: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 142.0.7417.0

* 6944136: Reorder NativeTheme headers/.cc files.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944136

* 6939701: [DSSC][4] Make FSVCI objects aware of their capture-version-source

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6939701

* 6944404: Remove extraneous callback call

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6944404

* 6936124: [FPF-CI]: Introduce blink::NoiseToken for fingerprinting protection

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6936124

* chore: update patches

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* fixup! 6917864: Devirtualize and inline various NativeTheme getters.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6917864

* 6937588: Add initial OsSettingsProvider object, supplying caret blink interval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6937588

* fixup! 6905242: Reland "[CSP] Clarify report-only console messages."

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6905242

* 6907515: Replace SingletonHwndObserver with a CallbackList on SingletonHwnd.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6907515

* 6910482: [Save to Drive] Implement retry functionality

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6910482

* fixup! 6927233: Remove NativeTheme "use dark colors" bit.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6927233

* Revert "build: remove ninja logs"

This reverts commit 72874740fd.

* test: fix flakey test picked from PR 48205

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Alice Zhao <alicelovescake@anthropic.com>
2025-09-22 20:16:27 -07:00
Charles Kerr
19256a07dd refactor: use gin::Arguments in api::Clipboard (#48354)
* refactor: make api::Clipboard::GetClipboardBuffer() private

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBuffer()

* refactor: remove unused gin_helper::Arguments* arg from Clipboard::ReadBookmark()

* refactor: move GetClipboadBuffer() into anonymous namespace

* refactor: use gin::Arguments in api::Clipboard
2025-09-23 04:12:47 +09:00
John Kleinschmidt
f62d7254c4 build: update build tools to get siso for forks fix (#48345) 2025-09-18 00:04:09 -04:00
Keeley Hammond
c7aa0b537d chore: cherry-pick ec6c18478382 from v8 (#48335)
* chore: cherry-pick ec6c18478382 from v8

* chore: update patches
2025-09-16 19:08:15 -07:00
Robo
048d620701 fix: remove unneeded handlescope from JS callbacks (#48318)
fix: remove handlescope from JS callbacks
2025-09-16 06:56:38 +09:00
Charles Kerr
15cdae1cf0 refactor: make api::NetLog inherit from gin::Wrappable (#48308)
* refactor: remove unused v8::Isolate* arg from NetLog ctor

* refactor: allocate api::NetLog on cpp heap

* refactor: make electron::api::Session::net_log_ a cppgc::Member<api::NetLog>

* refactor: remove unnecessary EscapableHandleScope

* chore: code style consistency
2025-09-16 06:29:46 +09:00
Shelley Vohr
bac383c219 feat: add fileSystem to ses.setPermissionCheckHandler (#48170)
feat: add fileSystem to ses.setPermissionCheckHandler
2025-09-15 17:00:58 -04:00
John Kleinschmidt
49eb165ef9 ci: Use Local Execution, Remote Caching (LERC) for fork PRS (#48319)
cleanup
2025-09-15 16:31:49 -04:00
Charles Kerr
a468ed7f10 refactor: narrow or remove gin arguments (#48300)
* refactor: narrow App:SetJumpList() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow WebContents::AddWorkSpace() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowMessageBox() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow ShowOpenDialog() arg from gin::Arguments* to v8::Isolate*

* refactor: remove unused gin::Arguments* arg from OverrideGlobalPropertyFromIsolatedWorld()

* refactor: narrow WebContents::StartDrag() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow NetLog::StopLogging() arg from gin::Arguments* to v8::Isolate*

* refactor: narrow Protocol::IsProtocolHandled() arg from gin::Arguments* to v8::Isolate*
2025-09-13 08:19:07 +09:00
Calvin
5444738721 fix: set ozone platform for wayland (#48301)
* fix: set ozone platform for wayland

* whoops, includes. thx charles
2025-09-13 08:17:06 +09:00
Charles Kerr
a6959ca97b refactor: allocate api::Debugger on cpp heap (#48266)
* refactor: remove unused isolate arg from Debugger ctor

* refactor: make Debugger ctor, dtor public

needed for cppgc::MakeGarbageCollected()

This is what upstream does, e.g. https://chromium-review.googlesource.com/c/chromium/src/+/6722236

* fixup! refactor: remove unused isolate arg from Debugger ctor

mark Debugger ctor as explicit

* refactor: in EventEmitterMixin, handle both old and new WrapperInfo types

* refactor: make electron::api::Debugger inherit from gin::Wrappable

* refactor: add api::Debugger::GetTypeName()

* refactor: add api::Debugger::GetClassName()
2025-09-11 16:03:17 -04:00
dependabot[bot]
45353ae38c build(deps): bump actions/setup-node from 4.4.0 to 5.0.0 (#48282)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.4.0 to 5.0.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](49933ea528...a0853c2454)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 21:35:54 -05:00
Charles Kerr
f702327dce refactor: avoid unused inheritance in ServiceWorkerMain (#48279)
ServiceWorkerMain does not need to inherit from EventEmitterMixin
2025-09-10 11:16:35 -05:00
dependabot[bot]
fda3a3d493 build(deps): bump github/codeql-action from 3.29.11 to 3.30.1 (#48283)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.11 to 3.30.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](3c3833e0f8...f1f6e5f6af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.30.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-09-10 09:47:34 -05:00
Michaela Laurencin
dae5dad167 docs: update release timeline for unsupported v35 (#48285) 2025-09-09 15:03:48 -07:00
John Kleinschmidt
940ebb6c7a chore: update patches (#48278) 2025-09-08 15:44:47 -04:00
electron-roller[bot]
793565e4be chore: bump chromium to 141.0.7390.7 (main) (#48212)
* chore: bump chromium in DEPS to 141.0.7381.3

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7382.0

* chore: update patches

* chore: bump chromium in DEPS to 141.0.7384.0

* chore: bump chromium in DEPS to 141.0.7386.0

* [Extensions] Move devtools_page and chrome_url_overrides handlers

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6862700

* Reland "[api] Advance deprecation of GetIsolate"

Refs https://chromium-review.googlesource.com/c/v8/v8/+/6875273

* Move "system integrated UI" concept out of NativeTheme.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6867375

* chore: update patches

* Reland "[PermissionOptions] Return PermissionResult in callback for requests"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6851838

* Reland "[exit-time-destructors] Enable by default"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update patches

* [FSA] Revoke Read access after removing file via FileSystemAccess API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6677249

* chore: IWYU

* [DevToolsUIBindings] Accept an object for `dispatchHttpRequest` params

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6877528

* chore: IWYU

* Pass navigation UI parameters on EnterFullscreen in EAM

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6874923

* chore: rm band-aid_over_an_issue_with_using_deprecated_nsopenpanel_api.patch

* Remove unused PreHandleMouseEvent

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6880411

* 6878583: siso: update to version 1.4.1

https://chromium-review.googlesource.com/c/chromium/src/+/6878583

* Fold native_theme_browser into native_theme.

https://chromium-review.googlesource.com/c/chromium/src/+/6882627

* fixup: Reland "[exit-time-destructors] Enable by default

https://chromium-review.googlesource.com/c/chromium/src/+/6859042

* chore: update filenames.libcxx.gni

* chore: IWYU

* fixup: chore: IWYU

* fixup: Reland "[exit-time-destructors] Enable by default

* fixup: Reland "[exit-time-destructors] Enable by default

* Remove common_theme.*; place its method in NativeTheme instead.

https://chromium-review.googlesource.com/c/chromium/src/+/6886029

* fixup: Reland "[exit-time-destructors] Enable by default

* Better track when WebPreferences need updates for color-related changes.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6886797

* chore: bump chromium in DEPS to 141.0.7390.7

* 6904664: Reland "Make BrowserContext::GetPath() const"

https://chromium-review.googlesource.com/c/chromium/src/+/6904664

* Restore read access after certain file modification operations

https://chromium-review.googlesource.com/c/chromium/src/+/6861041

* fixup: Move "system integrated UI" concept out of NativeTheme.

* fixup: Reland "[exit-time-destructors] Enable by default

* chore: update patches

* 6906096: Remove GetSysSkColor().

https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* Inline implementation of SysColorChangeListener into the lone user.

https://chromium-review.googlesource.com/c/chromium/src/+/6905083

Also 6906096: Remove GetSysSkColor(). | https://chromium-review.googlesource.com/c/chromium/src/+/6906096

* fixup: 6906096: Remove GetSysSkColor()

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-09-08 12:57:15 +02:00
electron-roller[bot]
1f322ebce3 chore: bump node to v22.19.0 (main) (#48222)
* chore: bump node in DEPS to v22.19.0

* chore: fixup patch indices

* crypto: add tls.setDefaultCACertificates()

https://github.com/nodejs/node/pull/58822

* esm: js-string Wasm builtins in ESM Integration

https://github.com/nodejs/node/pull/59179

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-09-05 17:16:45 -04:00
Samuel Attard
f009e077f2 build: update spec deps for clean audit (#48238) 2025-09-03 15:05:49 -04:00
Calvin
fed73040e2 docs: move some planned breaking changes to 39 (#48236) 2025-09-01 14:55:11 -07:00
Shelley Vohr
828fd59a72 fix: file-only picker incorrectly allowing some directories (#48198) 2025-08-29 13:14:45 -04:00
Shelley Vohr
e892840975 fix: ensure dragging works again after emitting contextmenu event (#48199) 2025-08-29 10:37:37 -04:00
Shelley Vohr
7373173e44 fix: showMessageDialog should center dialog to parent (#48181) 2025-08-29 09:56:51 +02:00
electron-roller[bot]
5d5e672f17 chore: bump chromium to 141.0.7361.0 (main) (#48054)
* chore: bump chromium in DEPS to 141.0.7352.0

* chore: update patches

* 6830573: Revert 'Migrate WrappableWithNamedPropertyInterceptor to gin::Wrappable' | https://chromium-review.googlesource.com/c/chromium/src/+/6830573

* chore: bump chromium in DEPS to 141.0.7354.0

* chore: bump chromium in DEPS to 141.0.7356.0

* chore: bump chromium in DEPS to 141.0.7357.0

* chore: bump chromium in DEPS to 141.0.7359.0

* chore: bump chromium in DEPS to 141.0.7361.0

* 6838518: [Mac] Correctly deallocate sandbox error buffers and prevent crash resulting from nullptr assignment | https://chromium-review.googlesource.com/c/chromium/src/+/6838518

* 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* chore: update patches

* fixup! 6850973: Reland "Use base::ByteCount in base::SysInfo." | https://chromium-review.googlesource.com/c/chromium/src/+/6850973

* fixup! 6506565: [FPF-CI] Create initial NoiseHash in the browser. | https://chromium-review.googlesource.com/c/chromium/src/+/6506565

* fix: unsafe buffer warning in fix_properly_honor_printing_page_ranges.patch

* fix: FTBFS in src_remove_dependency_on_wrapper-descriptor-based_cppheap.patch

This change should be upstreamed.

Fixes this error:

../../third_party/electron_node/src/env.cc:606:3: error: no matching function for call to 'Wrap'
  606 |   v8::Object::Wrap<v8::CppHeapPointerTag::kDefaultTag>(
      |   ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1076:14: note: candidate function template not viable: cannot convert argument of incomplete type 'void *' to 'v8::Object::Wrappable *' for 3rd argument
 1076 | void Object::Wrap(v8::Isolate* isolate, const v8::Local<v8::Object>& wrapper,
      |              ^
 1077 |                   v8::Object::Wrappable* wrappable) {
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1084:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const PersistentBase<Object>' for 2nd argument
 1084 | void Object::Wrap(v8::Isolate* isolate, const PersistentBase<Object>& wrapper,
      |              ^                          ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
../../v8/include/v8-object.h:1093:14: note: candidate function template not viable: no known conversion from 'Local<Object>' to 'const BasicTracedReference<Object>' for 2nd argument
 1093 | void Object::Wrap(v8::Isolate* isolate,
      |              ^
 1094 |                   const BasicTracedReference<Object>& wrapper,
      |                   ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
1 error generated.

* [v8-init] Access crash key only from main thread | https://chromium-review.googlesource.com/c/chromium/src/+/6827167

* chore: e patches all

* chore: remove chore_restore_some_deprecated_wrapper_utility_in_gin.patch from patches

this remove line got re-added when rebasing roller/chromium/main

* chore: e patches all

* fix: include base/time/time.h when using base::Time

* chore: update patches

* Make --host-rules an alias for --host-resolver-rules.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/4867872

* ci: update BUILD_TOOLS_SHA

Refs https://github.com/electron/build-tools/pull/746

* [Fontations] Remove Fontations suffix from font names

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6835930

* temp: debug macOS addon build failure

* Revert "temp: debug macOS addon build failure"

This reverts commit 40bc8abab65dc83e17c4ab97cb6e7522a193fb44.

* test: run tests with Xcode 16.4

* ci: fix tccdb update for macOS 15

* spec: disable opening external application for loadURL

on macOS opening unknown external application will bring
up dialog to choose apps from application store which will
break our other test suites that want to capture screen
for pixel matching.

The loadURL spec that tests bad-scheme://foo is sufficient
that we hit the permission handler for openExternal since
at that point we already know the runtime gave up on handling
the scheme.

* chore: rebase patches

* chore: disable codesiging tests

* ci: update ScreenCaptureApprovals.plist for /bin/bash

* ci: try updating tcc permissions

* ci: update TCC permissions

Refs https://www.rainforestqa.com/blog/macos-tcc-db-deep-dive

* chore: test with 1st quadrant of the window

* chore: adjust for macOS 15 menubar height

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-08-29 12:31:47 +09:00
LZL
e39943bf45 fix: BrowserWindow add the same BrowserView (#48053)
fix: BrowserWindow add the same BrowserView (#48057)
2025-08-28 10:31:41 +02:00
David Sanders
f331606e07 build: bump NMV to 140 (#48196) 2025-08-27 18:57:00 -07:00
David Sanders
cca55117e4 build: refactor Linux binary stripping to align with upstream (#47932) 2025-08-27 18:56:31 -07:00
Erick Zhao
bf29d2f0bd docs: fix some module headings (#48177) 2025-08-27 14:52:26 -07:00
John Kleinschmidt
fea1a2a987 ci: use free GH arm runners (#47872) 2025-08-27 10:01:36 -04:00
dependabot[bot]
a51c56aca9 build(deps): bump amannn/action-semantic-pull-request from 6.0.1 to 6.1.1 (#48175)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 6.0.1 to 6.1.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](fdd4d3ddf6...48f256284b)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.1.1
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:52:36 +02:00
dependabot[bot]
89f25e6af3 build(deps): bump github/codeql-action from 3.29.10 to 3.29.11 (#48174)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.10 to 3.29.11.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](96f518a34f...3c3833e0f8)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.11
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-27 13:49:43 +02:00
Robo
e0db4046b2 refactor: allocate gin_helper::internal::Event on cpp heap (#48161) 2025-08-27 09:30:50 +09:00
Calvin
3b9130d815 docs: add release timeline for Electron 39 (#48167) 2025-08-26 14:19:56 -07:00
Shelley Vohr
52ed4646d9 chore: remove upstream OSR temp fix (#48162) 2025-08-26 16:22:45 -04:00
John Kleinschmidt
68098c317f build: remove no longer needed arg for siso (#48164)
* build: remove no longer needed arg for siso

* chore: test ffmpeg zip

* build: fix ffmpeg build with siso

* Revert "chore: test ffmpeg zip"

This reverts commit 2bbcc86039.
2025-08-25 16:46:36 -04:00
dependabot[bot]
52e0307cc1 build(deps): bump github/codeql-action from 3.29.7 to 3.29.10 (#48113)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.7 to 3.29.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](51f77329af...96f518a34f)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.10
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 13:23:15 +02:00
dependabot[bot]
7fffe77909 build(deps-dev): bump stream-json and @types/stream-json (#48114)
Bumps [stream-json](https://github.com/uhop/stream-json) and [@types/stream-json](https://github.com/DefinitelyTyped/DefinitelyTyped/tree/HEAD/types/stream-json). These dependencies needed to be updated together.

Updates `stream-json` from 1.8.0 to 1.9.1
- [Commits](https://github.com/uhop/stream-json/compare/1.8.0...1.9.1)

Updates `@types/stream-json` from 1.7.7 to 1.7.8
- [Release notes](https://github.com/DefinitelyTyped/DefinitelyTyped/releases)
- [Commits](https://github.com/DefinitelyTyped/DefinitelyTyped/commits/HEAD/types/stream-json)

---
updated-dependencies:
- dependency-name: stream-json
  dependency-version: 1.9.1
  dependency-type: direct:development
  update-type: version-update:semver-minor
- dependency-name: "@types/stream-json"
  dependency-version: 1.7.8
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-25 12:58:38 +02:00
Robo
3ccb1bc0a8 refactor: allocate api::Session on cpp heap (#48141) 2025-08-25 18:52:06 +09:00
Shelley Vohr
0917ed5f6f fix: snapped restoration after minimization (#48142) 2025-08-22 14:37:45 -04:00
Samuel Attard
a67aad0f50 build: use siso instead of reclient (#47534) 2025-08-22 14:17:02 -04:00
reito
ceb6d28fd3 fix: webContent.fromId should be number instead of string (#48059) 2025-08-22 11:40:10 -04:00
Shelley Vohr
e12ab6708e chore: improve failed notification error messages on Windows (#48131) 2025-08-22 11:35:39 -04:00
Shelley Vohr
6101025368 fix: net.isOnline always true in utility processes (#48111)
* fix: net.isOnline always true in utilityProcesses

* Update shell/services/node/node_service.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-08-22 14:30:41 +02:00
dependabot[bot]
97b0280ad4 build(deps): bump amannn/action-semantic-pull-request from 5.5.3 to 6.0.1 (#48115)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 5.5.3 to 6.0.1.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](0723387faa...fdd4d3ddf6)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-version: 6.0.1
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-21 10:44:27 +02:00
John Kleinschmidt
1044fe675d build: use new 7z command line switch (#48136)
-snld20 replaces -snld
2025-08-20 17:05:25 -04:00
John Kleinschmidt
42af60cc7e docs: update 38.0 breaking changes (#48117) 2025-08-20 14:15:01 -04:00
John Kleinschmidt
cadba11088 build: fixup docs only condition (#48128) 2025-08-20 12:58:54 -04:00
Shelley Vohr
8aeee3f714 refactor: use XmlWriter for Windows toasts (#48065)
refactor: use XmlWriter for Windows toasts
2025-08-20 16:06:51 +02:00
Robo
dd54e84a58 refactor: allocate api::App on cpp heap (#48118) 2025-08-20 20:35:08 +09:00
John Kleinschmidt
d4b7d9e9cf build: get source cache for docs only pipeline (#48120) 2025-08-20 11:07:00 +02:00
BILL SHEN
83a5ba1e2c feat: add fileBacked and purgeable fields to process.getSystemMemoryInfo() for macOS (#47628)
* fix: Optimize the value of memory.free in the return data of getSystemMemoryInfo().

* fix: Improve the value of memory in the return data of getSystemMemoryInfo().

* fix: complete API doc.

* Update docs/api/process.md

Co-authored-by: Will Anderson <will@itsananderson.com>

* fix: update name to fileBacked.

* fix: fix with code conflict

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
2025-08-20 09:49:41 +02:00
Shelley Vohr
13d955a73e fix: system accent color parsing hex order (#48085)
fix: system accent color parsing
2025-08-19 10:01:41 +02:00
Samuel Attard
fdf29ce838 fix: ensure snapshot is valid (#48101) 2025-08-18 14:35:58 -07:00
Samuel Attard
3770bb31a7 fix: avoid deprecated login item methods (#48090) 2025-08-17 22:00:52 -07:00
dependabot[bot]
ed4a99ba5b build(deps-dev): bump @azure/storage-blob from 12.25.0 to 12.28.0 (#48055)
Bumps [@azure/storage-blob](https://github.com/Azure/azure-sdk-for-js) from 12.25.0 to 12.28.0.
- [Release notes](https://github.com/Azure/azure-sdk-for-js/releases)
- [Changelog](https://github.com/Azure/azure-sdk-for-js/blob/main/documentation/Changelog-for-next-generation.md)
- [Commits](https://github.com/Azure/azure-sdk-for-js/compare/@azure/storage-blob_12.25.0...@azure/storage-blob_12.28.0)

---
updated-dependencies:
- dependency-name: "@azure/storage-blob"
  dependency-version: 12.28.0
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-16 09:39:46 +02:00
Shelley Vohr
0e6c26096f fix: shell.openPath should be non-blocking (#48079)
fix: shell.openPath should be non-blocking
2025-08-15 13:55:31 -07:00
Keeley Hammond
7792ed1efa build: revert bump @octokit/rest from 20.1.2 to 22.0.0 (#48082)
Revert "build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.0 (#48014)"

This reverts commit 13ed526ca7.
2025-08-14 20:50:09 -07:00
Robo
c75c390ccf chore: add uma results in macOS keychain patch (#48080) 2025-08-15 11:10:37 +09:00
Shelley Vohr
4c3c3049e1 build: disallow non-maintainer changes to GitHub Actions workflows (#48038) 2025-08-14 13:54:05 -07:00
Shelley Vohr
68e7b38c05 build: use quick tunnels for ssh debugging (#47938)
* build: use dynamic local tunnels for ssh debugging

* weeee

* that'll do

* chore: pretty output

* build: allow ssh input

---------

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
2025-08-14 07:41:07 -04:00
dependabot[bot]
a051c7c274 build(deps): bump actions/download-artifact from 4.3.0 to 5.0.0 (#48052)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 4.3.0 to 5.0.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](d3f86a106a...634f93cb29)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 5.0.0
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-13 14:33:48 +02:00
Shelley Vohr
53003d7af9 fix: app.accessibilitySupportEnabled (#48041)
fix: app.accessibilitySupportEnabled on macOS
2025-08-12 16:51:27 -04:00
David Sanders
63d7f609cd ci: manually fetch author_association in workflow automations (#48013) 2025-08-12 10:30:41 -07:00
electron-roller[bot]
01291623af chore: bump chromium to 141.0.7350.0 (main) (#48032)
* chore: bump chromium in DEPS to 141.0.7349.0

* chore: bump chromium in DEPS to 141.0.7350.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-08-12 11:31:17 +02:00
dependabot[bot]
13ed526ca7 build(deps-dev): bump @octokit/rest from 20.1.2 to 22.0.0 (#48014)
Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.2 to 22.0.0.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.2...v22.0.0)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-12 11:18:08 +02:00
Shelley Vohr
afb0ee418c fix: re-entrancy issues in webContents.loadURL() (#48004)
fix: re-entrancy issues in webContents.loadURL()
2025-08-11 11:20:35 -04:00
electron-roller[bot]
55d8b71d72 chore: bump chromium to 141.0.7346.0 (main) (#47983)
* chore: bump chromium in DEPS to 141.0.7341.0

* chore: bump chromium in DEPS to 141.0.7342.0

* chore: update patches

manually resolved conflict in `osr_shared_texture_remove_keyed_mutex_on_win_dxgi.patch` due to https://crrev.com/c/6681354

* 6819541: WebShare: Improve mac share behavior when sharing a URL
https://chromium-review.googlesource.com/c/chromium/src/+/6819541

* Add missing include for SkBitmap

Couldn't quickly find where we lost the full definition in this file's includes. 🤷

* 6771055: [SxS] Move devtools to ContentsContainerView supporting side-by-side.
https://chromium-review.googlesource.com/c/chromium/src/+/6771055

There may be some simplification possible here (set_x, Rect position, ...), but this change is satisfactory to maintain the current behavior.

* 6813689: Switch SystemMemoryInfoKB to use ByteCount
https://chromium-review.googlesource.com/c/chromium/src/+/6813689

* 6818486: Track DevTools feature usage in new badge tracker
https://chromium-review.googlesource.com/c/chromium/src/+/6818486

* chore: bump chromium in DEPS to 141.0.7344.0

* Remove ELECTRON_OZONE_PLATFORM_HINT env var

6819616: Remove OzonePlatformHint | https://chromium-review.googlesource.com/c/chromium/src/+/6819616

See: https://github.com/electron/electron/issues/48001

* chore: update patches

* Add missing include for `base::NumberToString`

* Remove `DESKTOP_STARTUP_ID` code

This was removed upstream in https://chromium-review.googlesource.com/c/chromium/src/+/6819616 and I confirmed with the author that it was an intentional change. Going to mirror upstream and remove it here too.

* chore: bump chromium in DEPS to 141.0.7346.0

* chore: update patches

* 6828465: Reland "Remove BluezDBusThreadManager"
https://chromium-review.googlesource.com/c/chromium/src/+/6828465

* Patch change to Node.js test output

V8 enhanced the stack trace of "thenable" async tasks. A couple of Node.js tests needed to have their snapshots updates to accomodate the extra stack trace frames in the output.

This patch should be upstreamed to Node.js.

See:
6826001: fix thenable async stack trace
https://chromium-review.googlesource.com/c/v8/v8/+/6826001

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-11 12:57:31 +09:00
Calvin
b9ceaabb85 docs: deprecate ELECTRON_OZONE_PLATFORM_HINT env var (#48002) 2025-08-10 21:49:23 +02:00
David Sanders
d6c0691a63 fix: importing from electron/utility in ESM (#47998) 2025-08-09 09:47:47 +02:00
David Sanders
a201d6c541 build: drop @types/webpack-env in favor of webpack/module types (#47798)
* build: drop @types/webpack-env in favor of webpack/module types

* chore: improve type when assigning to global.require
2025-08-08 18:09:23 -07:00
John Kleinschmidt
51add3e847 ci: cleanup use new arc cluster (#47916) 2025-08-08 09:26:10 -04:00
reito
9dcdec5015 feat: paint event move texture data to handle, add colorSpace (#47315)
* feat: paint event move shared texture to handle, add color space

* feat: add breaking change

* fix: properties.

* fix: remove utf8 bom
2025-08-08 10:13:56 +02:00
reito
095e622a6a feat: context bridge support VideoFrame (#47316)
* feat: context bridge support VideoFrame

* docs: add VideoFrame to docs
2025-08-07 16:41:49 -04:00
Shelley Vohr
a0d983e4b5 feat: allow macOS tray to maintain position (#47838)
* feat: allow macOS tray to maintain position

* refactor: just use guid

* test: fixup tests

* docs: clarify UUID format
2025-08-07 19:25:50 +02:00
wujinli
f49a645c06 fix: compilation error when disabling extensions and pdf_viewer (#47964) 2025-08-07 11:18:32 -04:00
John Kleinschmidt
8ab5ac9069 ci: fixup mac runner hang (#47982) 2025-08-07 10:52:26 +02:00
Will Anderson
27a8cc531b chore: Remove redundant IS_WIN check inside electron_main_win.cc (#47967) 2025-08-07 09:54:13 +02:00
David Sanders
26ffc8505c fix: allow importing from electron/utility at runtime (#47968) 2025-08-07 09:53:42 +02:00
electron-roller[bot]
3b0f35a7e8 chore: bump chromium to 140.0.7339.2 (main) (#47929)
* chore: bump chromium in DEPS to 140.0.7330.0

* chore: bump chromium in DEPS to 140.0.7331.0

* chore: update patches

* fix: gn check failing on crashpad.h
Not yet sure what caused this

* fix: predictors::PreconnectManager -> content::PreconnectManager
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* chore: bump chromium in DEPS to 140.0.7333.0

* chore: bump chromium in DEPS to 140.0.7335.0

* chore: bump chromium in DEPS to 140.0.7337.0

* chore: update patches

* chore: restore some gin utility

* 6804057: [Extensions] Validate nodoc is specified as a boolean in schemas
https://chromium-review.googlesource.com/c/chromium/src/+/6804057

* fixup! chore: restore some gin utility

* fixup! fix: predictors::PreconnectManager -> content::PreconnectManager CL: https://chromium-review.googlesource.com/c/chromium/src/+/6788473

* 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected
https://chromium-review.googlesource.com/c/chromium/src/+/6772346

Not certain about what the "correct" argument to pass here is. A quick dive into the CL suggests that passing `false` is safe to keep things working. The blast radius if this assumption is wrong is that "fling" scroll gestures may not work as expected with the OSR.

* 6789383: Uninstall SODA language pack after 30 days of inactivity
https://chromium-review.googlesource.com/c/chromium/src/+/6789383

* chore: update libcxx filenames

* chore: bump chromium in DEPS to 140.0.7339.0

* chore: update patches

* fixup! 6772346: Reset MouseWheelPhaseHandler state when trackpoint scroll is detected https://chromium-review.googlesource.com/c/chromium/src/+/6772346

* chore: bump chromium in DEPS to 140.0.7339.2

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-08-06 20:14:23 -04:00
David Sanders
8769d5ba9e build: check zip manifest for chromedriver.zip (#47972) 2025-08-06 20:04:19 -04:00
dependabot[bot]
7f8b7c3873 build(deps-dev): bump @electron/lint-roller from 3.1.1 to 3.1.2 (#47963)
Bumps [@electron/lint-roller](https://github.com/electron/lint-roller) from 3.1.1 to 3.1.2.
- [Release notes](https://github.com/electron/lint-roller/releases)
- [Changelog](https://github.com/electron/lint-roller/blob/main/.releaserc.json)
- [Commits](https://github.com/electron/lint-roller/compare/v3.1.1...v3.1.2)

---
updated-dependencies:
- dependency-name: "@electron/lint-roller"
  dependency-version: 3.1.2
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-06 11:21:55 +02:00
David Sanders
8bf4260e3e test: add TS smoke test for electron/utility (#47969) 2025-08-06 10:30:39 +02:00
Charles Kerr
7a13c6f175 refactor: avoid deprecated v8::Context::GetIsolate() pt 4 (#47961)
* refactor: remove GetIsolate() calls from SetPrivate()

* refactor: remove excess GetIsolate() calls in PassValueToOtherContextInner()

* refactor: remove GetIsolate() calls from GetPrivate()

* refactor: add a v8::Isolate* local to ProxyFunctionWrapper()

* refactor: remove error_context->GetIsolate() call from PassValueToOtherContextInner()

* refactor: remove GetIsolate() call from ProxyFunctionWrapper()

* refactor: pass source and destination isolate as arg to CreateProxyForAPI()
2025-08-05 20:08:04 -05:00
Keeley Hammond
678fb400fd fix: video scrubbing on playback (#47703)
* fix: fix video scrubbing on playback

* chore: address review feedback

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-05 18:48:52 +02:00
Shelley Vohr
8806499904 fix: offscreen mode under window.open creation (#47868)
fix: offscreen mode under new window creation
2025-08-05 14:56:33 +02:00
dependabot[bot]
637a504e28 build(deps): bump github/codeql-action from 3.29.4 to 3.29.5 (#47962)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.4 to 3.29.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4e828ff8d4...51f77329af)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.5
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-05 14:41:57 +02:00
electron-roller[bot]
40cdfdb1d1 chore: bump node to v22.18.0 (main) (#47937)
* chore: bump node in DEPS to v22.18.0

* crypto: fix inclusion of OPENSSL_IS_BORINGSSL define

https://github.com/nodejs/node/pull/58845

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58960

* permission: propagate permission model flags on spawn

https://github.com/nodejs/node/pull/58853

* esm: syncify default path of ModuleLoader\.load

https://github.com/nodejs/node/pull/57419

* src: remove fast API for InternalModuleStat

https://github.com/nodejs/node/pull/58489

* src: simplify adding fast APIs to ExternalReferenceRegistry

https://github.com/nodejs/node/pull/58896/

* chore: fixup patch indices

* src: fix internalModuleStat v8 fast path

https://github.com/nodejs/node/pull/58054

* test: add tests to ensure that node.1 is kept in sync with cli.md

https://github.com/nodejs/node/pull/58878

* crypto: fix SHAKE128/256 breaking change introduced with OpenSSL 3.4

https://github.com/nodejs/node/pull/58942

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-08-04 14:40:36 -04:00
Robo
4ca10a1056 chore: move gin::Handle to gin_helper (#47959)
* chore: move gin::Handle to gin_helper

* chore: fix lint
2025-08-05 02:03:06 +09:00
Robo
9d05454dc7 chore: move gin::DeprecatedWrappable to gin_helper (#47958)
* chore: move gin::DeprecatedWrappable to gin_helper

This is in preparation for migrating to gin::Wrappable
based on cppgc #47922
The upstream class will be deleted soon via roller PR but
the cppgc migration should happen outside the roll, this
change retains the current functionality by copying the
implementation into //electron/shell/common/gin_helper.
The class can be deleted once the cppgc migration is complete.

* chore: fix lint:cpp
2025-08-04 23:28:01 +09:00
dependabot[bot]
0e862bba61 build(deps-dev): bump remark-preset-lint-markdown-style-guide from 4.0.0 to 6.0.1 (#47940)
build(deps-dev): bump remark-preset-lint-markdown-style-guide

Bumps [remark-preset-lint-markdown-style-guide](https://github.com/remarkjs/remark-lint) from 4.0.0 to 6.0.1.
- [Release notes](https://github.com/remarkjs/remark-lint/releases)
- [Changelog](https://github.com/remarkjs/remark-lint/blob/main/changelog.md)
- [Commits](https://github.com/remarkjs/remark-lint/commits)

---
updated-dependencies:
- dependency-name: remark-preset-lint-markdown-style-guide
  dependency-version: 6.0.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-04 14:29:36 +02:00
Shelley Vohr
4232ed2814 fix: crash on window.close() with webContents on blur (#47933)
fix: crash on window.close with WebContentsView on blur
2025-08-04 10:35:29 +02:00
Will Anderson
e7683bdd25 feat: Use DIR_ASSETS path to locate resource bundles (#47439)
* feat: Use DIR_ASSETS path to locate resource bundles

* Use DIR_ASSETS for calculating ASAR relative paths

* Add test to verify 'assets' matches parent dir of 'exe'

* Add Mac-specific test for assets path (but it is failing)

* test: Update app.getPath('assets') to expect an exception on Mac

* docs: Update docs for 'assets' path to indicate that it's only available on Windows + Linux

* fix: Don't define 'assets' mapping on macOS
2025-08-04 12:34:08 +09:00
Sam Maddock
bdaf3b9a2b refactor: replace webFrame.routingId with sync IPC (#47717)
* refactor: replace webFrame.routingId with sync IPC

* fix: GetConstructor missing isolate

* fix: missing isolate
2025-08-02 11:00:42 -04:00
Shelley Vohr
5c98e3609f feat: add {get|set}AccentColor on Windows (#47741)
* feat: add setAccentColor on Windows

* refactor: unify GetSystemAccentColor

* refactor: remove redundant parsing

* chore: fixup documentation

* Update docs/api/browser-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

* Update docs/api/base-window.md

Co-authored-by: Will Anderson <andersonw@dropbox.com>

---------

Co-authored-by: Will Anderson <andersonw@dropbox.com>
2025-08-01 22:29:02 +02:00
dependabot[bot]
2cfccac074 build(deps-dev): bump folder-hash from 2.1.2 to 4.1.1 (#47931)
Bumps [folder-hash](https://github.com/marc136/node-folder-hash) from 2.1.2 to 4.1.1.
- [Release notes](https://github.com/marc136/node-folder-hash/releases)
- [Changelog](https://github.com/marc136/node-folder-hash/blob/main/CHANGELOG.md)
- [Commits](https://github.com/marc136/node-folder-hash/compare/v2.1.2...v4.1.1)

---
updated-dependencies:
- dependency-name: folder-hash
  dependency-version: 4.1.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-08-01 19:16:43 +02:00
electron-roller[bot]
03aad28412 chore: bump chromium to 140.0.7327.0 (main) (#47902)
* chore: bump chromium in DEPS to 140.0.7324.0

* chore: bump chromium in DEPS to 140.0.7325.0

* chore: remove @dsanders11's unused include patch
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6782507

* fix: apply keychain patch to new apple subdir
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* chore: update chromium patches

* chore: update other patches

* chore: bump chromium in DEPS to 140.0.7327.0

* fix: mistake in reapplied patch

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* chore: update patches

* fix: remove OnPrivateNetworkAccessPermissionRequired override
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6769208

* fix: update colorSpace property to use new unified value
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6795085

* fix: include OverlayWindowLiveCaptionButton
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787420

* fixup! fix: apply keychain patch to new apple subdir CL: https://chromium-review.googlesource.com/c/chromium/src/+/6736212

* fix: format chromium_src/BUILD.gn
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

* fix: format BUILD.gn
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787427

* chore: include script/ in logged path

* fix: update filenames.libcxx.gni
CL: https://chromium-review.googlesource.com/c/chromium/src/+/6787279

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-31 18:11:00 -04:00
Sam Maddock
25e2459f31 feat: webFrameMain.fromFrameToken (#47850)
* feat: webFrameMain.fromFrameToken

* refactor: return null instead of undefined

* docs: mention renderer webFrame property

* chore: undo null->undefined in wfm.fromId api
this will be updated in another pr
2025-07-31 16:41:44 -04:00
Shelley Vohr
18af498cf1 build: roll build-images to 933c7d6 (#47880) 2025-07-31 12:08:45 -04:00
John Kleinschmidt
9f43503b3e chore: revert "ci: fixup mac runners" (#47917)
This reverts commit 06d7a51a58.
2025-07-31 11:08:43 -04:00
Shelley Vohr
ecb1eb0b5d feat: add app.getRecentDocuments() (#45839)
feat: add app.getRecentDocuments()
2025-07-31 16:15:33 +02:00
dependabot[bot]
2c916cfa33 build(deps-dev): bump @octokit/rest from 20.1.1 to 20.1.2 (#47818)
* build(deps-dev): bump @octokit/rest from 20.1.1 to 22.0.0

Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.1 to 22.0.0.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.1...v22.0.0)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 22.0.0
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: bump octokit/rest to 20.1.2

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-07-31 14:30:45 +02:00
Shelley Vohr
4c9ab8765b fix: dark mode on Linux default themeing (#47869) 2025-07-31 10:54:55 +02:00
dependabot[bot]
051f78dd1d build(deps): bump actions-cool/issues-helper from 3.6.0 to 3.6.2 (#47905)
Bumps [actions-cool/issues-helper](https://github.com/actions-cool/issues-helper) from 3.6.0 to 3.6.2.
- [Release notes](https://github.com/actions-cool/issues-helper/releases)
- [Changelog](https://github.com/actions-cool/issues-helper/blob/main/CHANGELOG.md)
- [Commits](a610082f8a...50068f49b7)

---
updated-dependencies:
- dependency-name: actions-cool/issues-helper
  dependency-version: 3.6.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-31 10:54:25 +02:00
dependabot[bot]
c796a74467 build(deps): bump github/codeql-action from 3.29.2 to 3.29.4 (#47904)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.29.2 to 3.29.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](181d5eefc2...4e828ff8d4)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.4
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-31 10:54:03 +02:00
John Kleinschmidt
0d0cbaf7b4 ci: use new arc cluster (#47897) 2025-07-30 13:45:24 -04:00
Charles Kerr
63c452dcc7 refactor: avoid deprecated v8::Context::GetIsolate() calls pt 3 context get isolate pt 3 (#47901)
* refactor: add a v8::Isolate* arg to RendererClientBase::IsWebViewFrame()

Needed for creating gin dictionaries

refactor: add a v8::Isolate* arg to ShouldLoadPreload()

Needed for calling IsWebViewFrame()

* refactor: add a v8::Isolate* arg to electron::util::CompileAndCall()

* refactor: add a v8::Isolate* arg to OnCreatePreloadableV8Context()

* refactor: add a v8::Isolate* arg to InvokeEmitProcessEvent()

* refactor: add a v8::Isolate* arg to ServiceWorkerData's constructor

* refactor: add a v8::Isolate* arg to RendererClientBase::SetupMainWorldOverrides()

* refactor: add a v8::Isolate* arg to RendererClientBase::WilLReleaseScriptContext()

* docs: update docs to avoid v8::Context::GetIsolate()

* refactor: add a v8::Isolate* arg to ElectronSandboxedRendererClient::InitializeBindings()

* refactor: avoid v8::Context::GetIsolate() call in PromiseBase::SettleScope::~SettleScope()
2025-07-30 09:14:38 -05:00
electron-roller[bot]
f6407b4949 chore: bump chromium to 140.0.7314.0 (main) (#47882)
* chore: bump chromium in DEPS to 140.0.7314.0

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

* 6632993: PDF Searchify IPH: Use embedder WebContents for GuestView PDF

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6632993

* 6769214: [ios blink] Set IOSurface shared memory region on all GMB handles

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769214

* chore: update patches

* 6769572: [soft navs]: Move AsyncSameDocumentNavigationStarted to TaskAttributionTracker

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769572

* chore: node gen-libc++-filenames.js

* 6765740: [SxS] Implement support for split view in extensions API

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765740

* 6769821: Delegate checking whether preconnect is enabled.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769821

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-28 15:31:54 -07:00
John Kleinschmidt
06d7a51a58 ci: fixup mac runners (#47877)
ci: make sure camera and bluetooth are available on macos

ci: turn off spotlight indexing
2025-07-28 13:37:05 -04:00
Charles Kerr
2255bb620a refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 2) (#47879)
* refactor: add a v8::Isolate* arg to Constructible::GetConstructor()

* refactor: add a v8::Isolate* arg to NodeBindings::Initialize()

This is needed for the GetConstructor() call

* refactor: avoid v8::Context::GetIsolate() call in GetIpcObject() by taking it as an arg

* refactor: avoid v8::Context::GetIsolate() call in ipc_native::EmitIPCEvent() by taking it as an arg
2025-07-28 10:22:27 -05:00
Charles Kerr
084c6ef549 refactor: prefer GetCreationContextChecked(v8::Isolate*) over GetCreationContextChecked() (#47878)
* refactor: pass an isolate when calling GetCreationContextChecked() in V8FunctionInvoker

* refactor: pass an isolate when calling GetCreationContextChecked() in RendererClientBase

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::Completed()

* refactor: pass an isolate when calling GetCreationContextChecked() in ScriptExecutionCallback::CopyResultToCallingContextAndFinalize()

* refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()

* refactor: pass an isolate when calling GetCreationContextChecked() in gin_helper::internal::CallMethodWithArgs()

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalPropertyFromIsolatedWorld()

* refactor: pass an isolate when calling GetCreationContextChecked() in OverrideGlobalValueFromIsolatedWorld()

* refactor: pass an isolate when calling GetCreationContextChecked() in ProxyFunctionWrapper()

* refactor: pass an isolate when calling GetCreationContextChecked() in PassValueToOtherContextInner()

* fixup! refactor: pass an isolate when calling GetCreationContextChecked() in electron::GetRenderFrame()
2025-07-25 09:06:57 -05:00
Shelley Vohr
01faaa30ea fix: window content protection on older Windows versions (#47856) 2025-07-24 12:05:28 -07:00
electron-roller[bot]
c569d5e4ba chore: bump chromium to 140.0.7312.0 (main) (#47862)
* chore: bump chromium in DEPS to 140.0.7312.0

* 6769540: Move NetworkTrafficAnnotationTag out of PreconnectManager.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6769540

* 6771377: Roll libc++ from 3eda1e62e799 to 569aa83b4bbc (7 revisions)

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771377

* 6771398: Remove unnecessary std::optional wrappers in ResolveHostClient

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6771398

* chore: update patches

* 6776165: Use shared session bus for MPRIS

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6776165

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-23 16:26:30 -07:00
Shelley Vohr
670da27305 ci: add ability to debug SSH sessions in CI (#47819) 2025-07-23 10:57:06 -04:00
dependabot[bot]
5f901174c5 build(deps): bump slackapi/slack-github-action from 2.1.0 to 2.1.1 (#47748)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 2.1.0 to 2.1.1.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](b0fa283ad8...91efab103c)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-version: 2.1.1
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-07-23 11:24:17 +02:00
xufuhang
b39a1fb877 fix: webContents.downloadURL() did not support referer header (#47625)
Signed-off-by: xufuhang <576484918@qq.com>
2025-07-23 10:37:24 +02:00
Robo
2156ccb577 ci: update llvmobjdump package as part of fix sync (#47858) 2025-07-23 17:05:30 +09:00
electron-roller[bot]
9e2f7065a0 chore: bump chromium to 140.0.7309.0 (main) (#47848)
* chore: bump chromium in DEPS to 140.0.7309.0

* 6762172: Replace MSG_ROUTING_NONE with IPC::mojom::kRoutingIdNone.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6762172

* 6759543: [exit-time-destructors] Exclude target with warnings

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759543

* 6765167: Split PreconnectManager into interface and implementation.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6765167

* 6766775: [media] Clarify coded and visible size in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6766775

* 6760878: Move PreconnectRequest to //content/public

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6760878

* 6718973: Implement media playback trust check for the video PiP overlay window

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6718973

* chore: add missing include of <iterator> in ada

* chore: update patches

* chore: node gen-libc++-filenames.js

* 6759633: [media] Use format from shared image in FrameResources

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6759633

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-07-22 16:09:47 -07:00
Niklas Wenzel
51bfe07da9 build: extend Chromium options in bug report template (#47829)
* build: extend Chromium options in bug report template

As predicted by @dsanders11 and others, we got a bunch of bug reports with clearly incorrect values for "does this issue appear in Chromium?" because people didn't test or didn't know how to test.

This PR adds an "I didn't know how to test" option.

* build: update wording to use present tense
2025-07-21 15:26:02 -04:00
Shelley Vohr
4699761649 build: improve check-zip-manifest (#47828)
* build: improve check-zip-manifest

* fix: unicode on Windows
2025-07-21 15:20:27 -04:00
electron-roller[bot]
26e1bda335 chore: bump chromium to 140.0.7301.0 (main) (#47747)
* chore: bump chromium in DEPS to 140.0.7296.0

* chore: update patches

* 6702959: Remove OwnedByWidgetPassKey usage from content analysis dialog tests | https://chromium-review.googlesource.com/c/chromium/src/+/6702959

* 6722750: Remove un-used `stream_id` argument for `AidaCodeComplete` | https://chromium-review.googlesource.com/c/chromium/src/+/6722750

* 6696478: Reland Reland [video pip] Add fade in/out animation to controls visibility changes | https://chromium-review.googlesource.com/c/chromium/src/+/6696478

* chore: update libc++-filenames

* build: explicitly include cstdlib in Boyer-Moore patch

* chore: bump chromium in DEPS to 140.0.7297.0

* chore: update patches

* 6729537: [FPF] Pipe flag state from the browser to the renderer | https://chromium-review.googlesource.com/c/chromium/src/+/6729537

* 6727996: [Win] Detect pre-IPC crashes in sandboxed utility processes | https://chromium-review.googlesource.com/c/chromium/src/+/6727996

* 6707182: Move wtf/cross_thread_copier*.* to "blink" namespace | https://chromium-review.googlesource.com/c/chromium/src/+/6707182

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

* chore: bump chromium in DEPS to 140.0.7299.0

* chore: update patches

* chore: update main patches

* build: reset the minimum macOS SDK to 15 to match upstream

This reverts commit 499e987c77.

* 6730215: Remove IPC_MESSAGE_LOG_ENABLED ifdef blocks. | https://chromium-review.googlesource.com/c/chromium/src/+/6730215

* 6690442: Delete ppapi/buildflags/buildflags.h | https://chromium-review.googlesource.com/c/chromium/src/+/6690442

* [wip]: 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

* chore: bump chromium in DEPS to 140.0.7301.0

* chore: update patches

* 6656309: extensions: Port proxy API to desktop Android | https://chromium-review.googlesource.com/c/chromium/src/+/6656309

* 6758510: Reland 'Move GN enable_plugins variable out of //ppapi' | https://chromium-review.googlesource.com/c/chromium/src/+/6758510

* 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

* 6735979: [FSA] Replace `request_writable` with a new enum `FileSystemAccessPermissionMode`. | https://chromium-review.googlesource.com/c/chromium/src/+/6735979

* 6712080: Reland "Turn on gender translation PAK generation everywhere" | https://chromium-review.googlesource.com/c/chromium/src/+/6712080

* 6730796: extensions: Extract safe browsing/telemetry methods to new client class | https://chromium-review.googlesource.com/c/chromium/src/+/6730796

* build: restore minimum macOS SDK to 10, restore patch

This reverts commit a04c579b99.

* fixup! 6701466: [Extensions] Remove NaCl arch info from Update Client URLs | https://chromium-review.googlesource.com/c/chromium/src/+/6701466

* chore: correct node patches

* fixup! 6667681: Use more binaries from clang toolchain in mac build | https://chromium-review.googlesource.com/c/chromium/src/+/6667681

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-21 09:32:53 -07:00
Shelley Vohr
cf871bce4e build: fix ffmpeg generation on Windows non-x64 (#47768)
* build: fix ffmpeg generation on Windows non-x64

* test: ffmpeg artifact
2025-07-21 11:33:42 -04:00
Charles Kerr
39cca586f6 refactor: avoid deprecated v8::Context::GetIsolate() calls (pt 1) (#47760)
* refactor: avoid redundant GetIsolate() calls in NodeBindings::CreateEnvironment()

Xref: https://chromium-review.googlesource.com/c/v8/v8/+/6563615

* refactor: use v8::Isolate::GetCurrent() in Initialize() methods

* refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

* fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

* refactor: add v8::Isolate* arg to RendererClientBase::DidCreateScriptContext()

* fixup! refactor: add v8::Isolate* arg to NodeBindings::CreateEnvironment()

* fixup! fixup! refactor: use v8::Isolate::GetCurrent() in Initialize() methods

refactor: prefer JavascriptEnvironment::GetIsolate() in the browser layer
2025-07-21 16:34:38 +02:00
Shelley Vohr
2f4a070c39 fix: dialog file filters and macOS app bundles (#47825) 2025-07-21 13:57:50 +02:00
electron-roller[bot]
2b098408a8 chore: bump node to v22.17.1 (main) (#47776)
* chore: bump node in DEPS to v22.17.1

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-18 15:18:18 -04:00
Shelley Vohr
fa844268ec ci: remove kTCCServiceMicrophone change (#47816)
ci: remove kTCCServiceMicrophone change
2025-07-18 10:02:06 +02:00
Shelley Vohr
a29a72c3ab build: update codespace on-create-command (#47810)
build: update codespace on-create-command
2025-07-18 10:01:49 +02:00
Shelley Vohr
4601aeccde chore: clean up NativeWindowMac::UpdateVibrancyRadii (#47665)
chore: clean up NativeWindowMac::UpdateVibrancyRadii
2025-07-17 11:45:24 -04:00
Shelley Vohr
31b18c9830 fix: abnormal behavior of windows background material (#47386)
* fix: abnormal behavior of windows background material

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* chore: update patches

* fix: setting background material after init

---------

Co-authored-by: zoy <zoy-l@outlook.com>
Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-17 14:50:12 +02:00
Shelley Vohr
895bf9103e fix: handle missing NativeWindowMac in ElectronNSWindow (#47751)
fix: handle missing NativeWindowMac in ElectronNSWindow
2025-07-17 14:49:37 +02:00
David Sanders
bf51d345c8 build(dev-deps): drop unused @types/webpack dep (#47767) 2025-07-17 11:04:11 +02:00
Shelley Vohr
6eef170d9a test: re-enable native module tests (#46747) 2025-07-17 11:03:15 +02:00
Shelley Vohr
31725b4a86 fix: window accentColor should adhere to native window behavior (#47740)
* fix: window accentColor should adhere to native window behavior

* fix: address review feedback

* chore: remove duplicate UpdateWindowAccentColor call in ctor
2025-07-17 10:59:42 +02:00
John Kleinschmidt
ec748eb915 test: cleanup RenderFrame lifespan tests (#47746)
* test: cleanup RenderFrame lifespan tests

* test: disable navigator.serial tests on arm64 mac

debug the hang

test: disable navigator.bluetooth on arm64 mac

Revert "test: disable navigator.bluetooth on arm64 mac"

This reverts commit 4b53a8485a5ff391832c7da93d859f1aa8722e70.

Revert "debug the hang"

This reverts commit 00338f0d49a7918224822087b4510fa9db0686c3.

Revert "test: disable navigator.serial tests on arm64 mac"

This reverts commit fb515ce447a9d42185e84b17b460e4fb6d1bf71d.

Reapply "test: disable navigator.serial tests on arm64 mac"

This reverts commit 0e5608108ffebbe8b8b27af9ea06aadae2ea85dd.

Reapply "test: disable navigator.bluetooth on arm64 mac"

This reverts commit f4c7d3fc0624a22421cba5d3d75df8c5d4367eea.

fixup

* test: add waitUntil for flaky test
2025-07-16 16:19:55 -04:00
Shelley Vohr
5feb91e2f4 test: fix extensions console flake (#47750) 2025-07-16 18:27:20 +02:00
Shelley Vohr
5128ebeddb test: deflake clipboard read/write specs (#47752) 2025-07-16 18:27:11 +02:00
Calvin
389927dce8 fix: corner smoothing feature gate crash (#47759)
* fix: corner smoothing feature gate crash

* Fix ElectronCornerSmoothing::CSSValueFromComputedStyleInternal
2025-07-16 08:39:17 -07:00
Calvin
67afc10b75 fix: add macos memory query fallback patch to avoid crash (#47765) 2025-07-16 08:18:54 -07:00
Pratyush
f570e6967f docs: fix broken sentence in crashReporter.start() documentation (#47688) 2025-07-16 15:05:45 +02:00
Shelley Vohr
09ab71de43 fix: deprecation warning crash when no Node.js environment available (#47700) 2025-07-16 12:45:59 +02:00
Milan Burda
21b325b034 docs: improve win.setContentProtection() docs (#46596)
* docs: improve win.setContentProtection() docs

* docs: update Windows display affinity value

* docs: update Windows behavior description

* Revert "docs: update Windows behavior description"

This reverts commit 6d1942c53a.

* Revert "docs: update Windows display affinity value"

This reverts commit c15363e75d.

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-07-15 15:16:56 -07:00
Erick Zhao
cc9ca4bee2 docs: add Menu module tutorials (#47268)
* docs: add `Menu` module tutorials

* link API docs to new tutorials

* removed unreferenced fiddles

* add wording for new types

* fix import sort errors

* delete accelerator.md

* fixes
2025-07-15 15:09:32 -07:00
Shelley Vohr
17dba93587 fix: missing SQLite builtin support in Node.js (#47706)
https://github.com/nodejs/node/pull/58122
2025-07-15 15:39:16 +02:00
electron-roller[bot]
603cafad7e chore: bump chromium to 140.0.7281.0 (main) (#47616)
* chore: bump chromium in DEPS to 140.0.7269.2

* chore: bump chromium in DEPS to 140.0.7270.0

* chore: bump chromium in DEPS to 140.0.7271.0

* chore: bump chromium in DEPS to 140.0.7273.0

* 6516731: [ExclusiveAccessForAndroid] remove unneeded includes & deps | https://chromium-review.googlesource.com/c/chromium/src/+/6516731

* 6694809: dbus: Ensure systemd scope is started before using any portal services | https://chromium-review.googlesource.com/c/chromium/src/+/6694809

* chore: patch chromium

* chore: export patches

* chore: bump chromium in DEPS to 140.0.7275.0

* 6677511: [pepper] More pepper removal | https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: export chromium patches

* 6513641: [gin] Rename gin::Wrappable to gin::DeprecatedWrappable | https://chromium-review.googlesource.com/c/chromium/src/+/6513641

* chore: bump chromium in DEPS to 140.0.7277.0

* chore: bump chromium in DEPS to 140.0.7279.0

* chore: bump chromium in DEPS to 140.0.7281.0

* 6677314: Plumb enabled client hints in the network requestion to network layer

https://chromium-review.googlesource.com/c/chromium/src/+/6677314

* 6351556: [source-phase-imports] Support Wasm Source Phase Imports

https://chromium-review.googlesource.com/c/chromium/src/+/6351556

* 6700077: [renderer] Avoid calls to deprecated GetIsolate methods

https://chromium-review.googlesource.com/c/chromium/src/+/6700077

* 6692873: Reland "Reland "FSA: Only normalize the hardcoded rules once during initialization""

https://chromium-review.googlesource.com/c/chromium/src/+/6692873

* 6686234: [gin] Cleanup NamedPropertyInterceptor for Wrappable

https://chromium-review.googlesource.com/c/chromium/src/+/6686234

* chore: export patches

* 6667723: Remove content_enable_legacy_ipc GN arg.

https://chromium-review.googlesource.com/c/chromium/src/+/6667723

* 6646566: ui: Move NativeWindowTracker to its own directory

https://chromium-review.googlesource.com/c/chromium/src/+/6646566

* fix: add missing includes

* 6580522: [WAR, DNR] Fix unsafe redirect error to web accessible resource

https://chromium-review.googlesource.com/c/chromium/src/+/6580522

* 6680477: Implement `completeCode` endpoint and expose to DevTools

https://chromium-review.googlesource.com/c/chromium/src/+/6680477

* 6677511: [pepper] More pepper removal

https://chromium-review.googlesource.com/c/chromium/src/+/6677511

* 6696689: Rename views::WidgetFocusManager -> NativeViewFocusManager

https://chromium-review.googlesource.com/c/chromium/src/+/6696689

* 6702812: Move wtf/text/string_impl*.* to "blink" namespace

https://chromium-review.googlesource.com/c/chromium/src/+/6702812

* chore: fix dialog patch

* 6702431: [animation-trigger] Parse timeline-trigger-name

https://chromium-review.googlesource.com/c/chromium/src/+/6702431

* chore: fixup patch indices

* feat: replace webFrame.routingId with webFrame.frameToken

* feat: WebFrameMain.prototype.frameToken

* test: refactor to use replacement APIs

* chore: fixup pip patch

* test: adjust webFrame tests for frameToken changes

* 6703757: Reland "Enable -fsanitize=array-bounds in non-UBSan builds"

https://chromium-review.googlesource.com/c/chromium/src/+/6703757

* test: switch to frameTokens

* test: routingId is fine to test in the main process

* docs: add routingId to breaking changes

* docs: update plugin-crashed event

* chore: fixup linux dialog patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-07-14 13:42:37 -07:00
Shelley Vohr
09f269426e test: add response to bluetooth request possibilities (#47725) 2025-07-14 13:12:27 -04:00
Shelley Vohr
3bbb82b42b ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK (#47694)
ci: roll BUILD_TOOLS_SHA for macOS 15.5 SDK
2025-07-14 13:11:07 -04:00
Shelley Vohr
a9504abde9 build: roll sysroots (#47710) 2025-07-14 11:27:19 -04:00
BILL SHEN
9f3636ffe2 build: add platform-specific conditions to the source_set in chromium_src (#47627)
* build: Add platform-specific if conditions to the source sets in chromium_src.

* build: Add platform-specific if conditions to the source sets in chromium_src.
2025-07-14 11:25:16 +02:00
Shelley Vohr
4a89068fb7 ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors (#47726)
ci: add kTCCServiceAppleEvents perm override to fix AppleScript errors
2025-07-13 21:05:52 +02:00
John Kleinschmidt
137d4ec329 build: cleanup symlinks in cache (#47727)
* build: cleanup symlinks in cache

* build: ignore broken links

* try --ignore-failed-read

* build: dont deref symlinks

* build: add flag to 7zip to resolve symlink error

Needed to ignore Dangerous symbolic link path was ignored errors

* Revert "build: cleanup symlinks in cache"

This reverts commit 69e53cdc88.
2025-07-11 16:13:12 -04:00
David Sanders
624d085632 build: deep update brace-expansion to resolve an audit alert (#47692) 2025-07-11 09:57:41 +02:00
Robo
600b6b3315 build: reenable v8_enable_temporal_support (#47699)
* build: reenable v8_enable_temporal_support

* ci: test with increased vm map count

* chore: backport PA use fewer vmas by default on linux

* chore: update patches

* Revert "ci: test with increased vm map count"

This reverts commit b626c9a5ab7ad3f01e17d77c330abfd8096a8b02.

* ci: remove logs

---------

Co-authored-by: patchup[bot] <73610968+patchup[bot]@users.noreply.github.com>
2025-07-11 02:49:54 +09:00
David Sanders
9e67bd3508 ci: update audit CI workflow dependencies (#47691)
* ci: update audit CI workflow dependencies

* ci: bump to @electron/fiddle-core@2.0.1
2025-07-10 19:19:36 +02:00
Shelley Vohr
909fd3d55a ci: set git core.longpaths to true (#47695)
ci: set git core.longpaths to true
2025-07-10 19:13:39 +02:00
Niklas Wenzel
f2429c31c1 build: ask bug reporters to check if it is a Chromium issue (#47702)
* build: ask bug reporters to check if it is a Chromium issue

Inspiration: https://github.com/electron/electron/issues/47672#issuecomment-3051298922

* build: fix options
2025-07-10 08:47:04 -07:00
Shelley Vohr
fbb83be785 refactor: use dbus_thread_linux::GetSharedSessionBus() (#47685)
refactor: use dbus_thread_linux::GetSharedSessionBus()
2025-07-10 10:17:34 +02:00
Shelley Vohr
1eab19fc7c build: remove unused script (#47642) 2025-07-09 10:35:04 -04:00
Shelley Vohr
02f2feabe6 docs: update build prerequisites (#47680) 2025-07-09 12:07:24 +02:00
David Sanders
712262597d build: drop eslint-plugin-unicorn (#47676) 2025-07-08 15:20:56 +02:00
Shelley Vohr
31bc5ca903 fix: default to system accent color on invalid user color (#47660)
fix: default to system accent color on invalid user color"
2025-07-08 11:15:13 +02:00
Shelley Vohr
03a02fc31e fix: fullscreen for windows without rounded corners (#47664) 2025-07-08 11:14:14 +02:00
Shelley Vohr
5ef6897bc7 fix: accent color should reflect system settings without restart (#47629)
fix: accentColor should reflect system settings without restart
2025-07-03 18:13:39 +02:00
Charles Kerr
bc585b6a3f refactor: avoid a few unnecessary strings (#47644)
* perf: replace string temporary with string_view in GetXdgAppId()

* perf: replace string temporary with string_view in ToV8(WindowOpenDisposition)

* perf: replace string temporary with string_view in ToV8(electron::api::WebContents::Type)
2025-07-03 11:08:59 -05:00
David Sanders
4c460df0a4 ci: fix audit workflow alerting on stale results (#47643) 2025-07-03 14:42:04 +02:00
Shelley Vohr
cf193b279b fix: crash on source capture with empty thumbnail size (#47641) 2025-07-03 14:41:19 +02:00
Shelley Vohr
655037fbdf fix: window.open popups are always resizable (#47540)
fix: window.open popups are always resizable

Closes https://github.com/electron/electron/issues/43591.

Per current WHATWG spec, the `window.open` API should always
create a resizable popup window. This change updates the
`parseFeaturesString` function to ensure that windows opened
with `window.open` are always resizable, regardless of the
`resizable` feature string.
2025-07-02 15:02:59 +02:00
Samuel Attard
07338bb1cf build: update yarn to 1.22.22 (#47635) 2025-07-02 12:11:42 +02:00
reito
fb0b77b731 feat: add ColorSpace (#47314) 2025-07-02 00:09:09 -07:00
Keeley Hammond
499e987c77 build: set the minimum macOS SDK to 10.15 (#47634)
* build: set the minumum macOS SDK to 10.15

* build: revert "Update mac_sdk_min to match minimum required SDK version"

This reverts commit 3d4654fc18.
2025-07-01 18:51:08 -07:00
Cas_
f7138344d8 docs: discoverability of chromium switches (#44947)
* docs: document discoverability of chromium switches

* docs: fixed typo

* docs: reference chromium endorsed list of swithes

* docs: reorder command-line-switches

* fix: address review

* fix: typo

* fix: wording

* Update command-line-switches.md

fix: lint space

* fix: Update docs/api/command-line-switches.md

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-07-01 14:31:49 -07:00
dependabot[bot]
b9248e6782 build(deps): bump github/codeql-action from 3.29.0 to 3.29.2 (#47622) 2025-07-01 11:12:15 +02:00
Shelley Vohr
af39dcfb09 refactor: use non-deprecated macOS API in RemoveAsDefaultProtocolClient (#47506)
refactor: use non-deprecated macOS API in RemoveAsDefaultProtocolClient
2025-07-01 10:19:28 +02:00
Samuel Attard
d347632046 build: write abi version to published npm package (#47598) 2025-06-30 15:01:09 -07:00
electron-roller[bot]
4f69c5835e chore: bump chromium to 140.0.7261.0 (main) (#47561)
* chore: bump chromium in DEPS to 140.0.7259.0

* chore: update patches

* Add fade in animation to Picture-in-Picture windows

https://chromium-review.googlesource.com/c/chromium/src/+/6538268

* [v8] Use V8 Apis that don't return JSGlobalObject

Refs https://issues.chromium.org/issues/333672197

* chore: IWYU

* chore: bump chromium in DEPS to 140.0.7261.0

* chore: update patches

* revert: update to siso-chromium image

* [v8] Use v8::Object::WrapGlobal()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6650977

* chore: IWYU

* chore: fix --trace-startup spec

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-30 12:30:05 -04:00
Taiki Komoda
fa15332587 docs: update automated-testing.md (#47017)
* Update automated-testing.md

* fixed lint error
2025-06-30 10:56:48 +02:00
Shelley Vohr
e299a1d098 feat: support complete WebUSB device properties (#47459)
* feat: support complete WebUSB device properties

* docs: correct type consistency
2025-06-30 10:28:21 +02:00
Charles Kerr
c2302960a8 refactor: reduce scope of temporaries when getting dictionary values (#47581)
refactor: reduce scale of temporaries when getting dictionary values
2025-06-29 21:58:18 +02:00
Charles Kerr
5e862f398e fix: Reland "[accessibility] Platform node lifetime cleanups" (#47590)
Reland "[accessibility] Platform node lifetime cleanups"

https://chromium-review.googlesource.com/c/chromium/src/+/6462552
2025-06-29 21:57:48 +02:00
Shelley Vohr
61c245761c test: fix nan tests on macOS (#47583) 2025-06-29 21:57:44 +02:00
Charles Kerr
7c55b24be2 refactor: avoid copies of large objects in range based for loops (#47588)
* Avoid copies of large objects in range-based for-loops.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6527689

* Avoid copies of large objects in range-based for-loops in Browser::ShowAboutPanel()
2025-06-29 21:32:26 +02:00
Charles Kerr
4af248f2b6 perf: avoid copying a vector when calling ConvertToWeakPtrVector() (#47593) 2025-06-29 21:32:03 +02:00
Erick Zhao
69e9b653ba docs: update example apps (#47597) 2025-06-29 21:31:42 +02:00
electron-roller[bot]
4dccccadbb chore: bump node to v22.17.0 (main) (#47557)
* chore: bump node in DEPS to v22.17.0

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* chore: adjust crypto specs:

- https://github.com/nodejs/node/pull/58117
- https://github.com/nodejs/node/pull/58387

* deps: update libuv to 1.51.0

https://github.com/nodejs/node/pull/58124

* test: fix test-buffer-tostring-range on allocation failure

https://github.com/nodejs/node/pull/58416

* build: use FILE_OFFSET_BITS=64 esp. on 32-bit arch

https://github.com/nodejs/node/pull/58090

* build: use //third_party/simdutf by default in GN

https://github.com/nodejs/node/pull/58115

* inspector: add protocol method Network.dataReceived

https://github.com/nodejs/node/pull/58001

* test: force slow JSON.stringify path for overflow

https://github.com/nodejs/node/pull/58181

* chore: fixup patch indices

* 6049967: Remove protocol::Maybe and roll inspector_protocol

https://chromium-review.googlesource.com/c/chromium/src/+/6049967

* chore: fixup crypto test patch

* src: fix module buffer allocation

https://github.com/nodejs/node/pull/57738

* crypto: expose process.features.openssl_is_boringssl

https://github.com/nodejs/node/pull/58387

* util: add internal assignFunctionName() function

https://github.com/nodejs/node/pull/57916

* build: fix pointer compression builds

https://github.com/nodejs/node/pull/58171

* chore: put back config options

* fixup! deps: update libuv to 1.51.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-06-28 16:33:09 +02:00
Charles Kerr
79cd6a2614 refactor: sync IsKillURL() with upstream impl in extension_tab_util.cc (#47580)
Use base::MakeFixedFlatSet()
2025-06-27 15:49:41 -05:00
Charles Kerr
2ba8fe9140 refactor: extract-constant static Windows registry keys in Browser code (#47569)
* refactor: extract-constant for registry key in GetProcessExecPath()

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

* refactor: extract-constant for registry key in Browser::SetLoginItemSettings()

* refactor: extract-constant for registry key in Browser::GetLoginItemSettings()

* chore: document the symbolic constants

* refactor: prefer base::wcstring_view::c_str() to data() to make zero-termination clearer
2025-06-27 10:34:55 -05:00
Charles Kerr
b21c4b0f88 refactor: make context bridge's private keys hidden, constexpr string_views (#47562)
* refactor: local functions GetPrivate(), SetPrivate() now take std::string_views

* refactor: make local keys std::string_views instead of C-style char arrays

* refactor: make local keys constexpr

* refactor: move local keys into local anonymous namespace
2025-06-27 09:29:53 -05:00
Charles Kerr
f50ad3d022 refactor: remove stray .c_str() calls for absl::StrFormat() (#47548)
refactor: remove stray .c_str() calls for absl::StrFormat()

StrFormat() understands std::string, std::string_view
2025-06-26 11:41:30 +02:00
Keeley Hammond
7a274a711c fix: revert upstream MacOS mouse event routing (#47560)
* fix: revert upstream MacOS mouse event routing

* fix: reduce patch surface area

* chore: update patches
2025-06-26 11:41:11 +02:00
Niklas Wenzel
bc499ffb8a docs: fix --experimental-network-inspection spelling (#47565)
doc: fix `--experimental-network-inspection` spelling
2025-06-26 11:40:55 +02:00
Niklas Wenzel
0a74e91580 docs: update asar integrity fuse availability (#47528) 2025-06-25 23:15:59 +02:00
electron-roller[bot]
035879357e chore: bump chromium to 139.0.7256.0 (main) (#47481)
* chore: bump chromium in DEPS to 139.0.7242.0

* chore: update render_widget_host_view_mac.patch

no code changes; just updating patch context

Do a cleanup pass on the history swiper code | https://chromium-review.googlesource.com/c/chromium/src/+/6604367

* chore: update mas_avoid_private_macos_api_usage.patch.patch

no code changes; just updating patch context

[tracing] Delete base/trace_event/base_tracing.h | https://chromium-review.googlesource.com/c/chromium/src/+/6624012

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

no manual changes; just updating patch context

[ActorFramework] Refactor Actor Task Management | https://chromium-review.googlesource.com/c/chromium/src/+/6618684

* chore: update fix_move_autopipsettingshelper_behind_branding_buildflag.patch

[pip] Tuck picture-in-picture windows when a file dialog is open | https://chromium-review.googlesource.com/c/chromium/src/+/6449682

Reland "[document pip] Restrict the size that a website can request" | https://chromium-review.googlesource.com/c/chromium/src/+/6372104

* chore: update feat_corner_smoothing_css_rule_and_blink_painting.patch

Xref: corner-shape: constraint radii based on opposite corner overlap | https://chromium-review.googlesource.com/c/chromium/src/+/6592572

* chore: update revert_code_health_clean_up_stale_macwebcontentsocclusion.patch

no manual changes; just updating patch context

* chore: update fix_rename_sqlite_win32_exports_to_avoid_conflicts_with_node_js.patch

no code changes; just updating patch context

* chore: e patches all

* Plumb Verify2QwacBinding and hook it up in QwacWebContentsObserver

https://chromium-review.googlesource.com/c/chromium/src/+/6624719

* [Extensions] Remove host delegate OnMainFrameCreatedForBackgroundPage

https://chromium-review.googlesource.com/c/chromium/src/+/6631123

* Extensions: Rename GetResourceURL to ResolveExtensionURL

https://chromium-review.googlesource.com/c/chromium/src/+/6625053

* [NonClientFrameView] Consolidate NativeFrameViewMac

https://chromium-review.googlesource.com/c/chromium/src/+/6614239

* ICWYU

* [views-ax] Remove dead code WidgetAXTreeIDMap

https://chromium-review.googlesource.com/c/chromium/src/+/6619701

* Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS"

https://chromium-review.googlesource.com/c/chromium/src/+/6630056

* NavigationThrottleRunner2: Remove MaybeAddThrottle

https://chromium-review.googlesource.com/c/chromium/src/+/6628079

* [pip] Tuck picture-in-picture windows when a file dialog is open

https://chromium-review.googlesource.com/c/chromium/src/+/6449682

* build: fix snapshot_blob.bin build error

xref: https://issues.chromium.org/issues/416540976

* chore: e patches all

* build: freeup disk space on macos

* chore: bump chromium in DEPS to 139.0.7244.0

* chore: update printing.patch

no manual changes; just updating patch context

* chore: remove upstreamed ignore_parse_errors_for_resolveshortcutproperties.patch

Prevent Windows crash on unexpected shortcut type | https://chromium-review.googlesource.com/c/chromium/src/+/6633298

* chore: e patches all

* Revert "Reland "extensions: Add `WillPrepareForEvaluation` to setup MojoJS""

This reverts commit 77c4f967a6.

Revert CL for the high confidence crash culprit for http://crash/28f897bb9743dfe0 | https://chromium-review.googlesource.com/c/chromium/src/+/6641819

* Fix spec's expected base64-encoded PNG strings to match upstream changes.

[rust png] Enable by default. | https://chromium-review.googlesource.com/c/chromium/src/+/6085801

* chore: bump chromium in DEPS to 139.0.7246.0

* chore: e patches all

* chore: bump chromium in DEPS to 139.0.7248.0

* chore: update patches

* siso: Enable Siso by default for non-Google builds

https://chromium-review.googlesource.com/c/chromium/src/+/6638830

Disabling for now until we are ready to build siso on all platforms.

* Revert "revert Don't use static variable for UseExternalPopupMenus"

This reverts commit e91e3894e6.

* Update mac_sdk_min to match minimum required SDK version

https://chromium-review.googlesource.com/c/chromium/src/+/6493969
(cherry picked from commit 3e7cbe912d)

* [video pip] Use default window styling on Mac

https://chromium-review.googlesource.com/c/chromium/src/+/6648665

* Reland "Force the unintentional renderer process creation check by default"

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* chore: bump chromium in DEPS to 139.0.7249.0

* fixup: Reland "Force the unintentional renderer process creation check by default

https://chromium-review.googlesource.com/c/chromium/src/+/6626905

* chore: update patches

* chore: bump chromium in DEPS to 139.0.7250.0

* chore: bump chromium in DEPS to 139.0.7252.0

* chore: bump chromium in DEPS to 139.0.7254.0

* 6638187: browser level TOCTOU check for coordinate target

https://chromium-review.googlesource.com/c/chromium/src/+/6638187

* chore: fixup patch indices

* chore: add missing base/notimplemented includes

* 6652910: [Frame Cleanup] Push down/hide implementation-specific API

https://chromium-review.googlesource.com/c/chromium/src/+/6652910

* chore: bump chromium in DEPS to 139.0.7256.0

* chore: fix lint

* fixup! 6652910: [Frame Cleanup] Push down/hide implementation-specific API

* fix: move HandleScope location

* chore: bump chromium in DEPS to 139.0.7258.0

* fixup! [NonClientFrameView] Consolidate NativeFrameViewMac

* Revert "chore: bump chromium in DEPS to 139.0.7258.0"

This reverts commit 264b2e934f.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-26 00:12:49 +09:00
Felix Rieseberg
e4c37e4b38 docs: Add C++/Linux tutorial (#46822) 2025-06-25 12:57:43 +02:00
Calvin
828fc84e60 build: update NMV to 139 (#47529) 2025-06-24 12:24:17 -04:00
Shelley Vohr
51fbc964a6 fix: ensure /dev/null fd is closed on failure (#47525)
* fix: ensure /dev/null fd is closed on failure

* chore: ignore closehandle for windows

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-06-24 17:44:50 +02:00
Shelley Vohr
3e8e87d186 feat: support customizing window accent color on Windows (#47285) 2025-06-24 14:43:02 +02:00
Samuel Attard
498f4bc98c build: rewrite push-patch to use the github API instead of local git commits to ensure commits are signed (#47401)
* build: rewrite push-patch to use the github API instead of local git commits to ensure commits are signed

* again

(cherry picked from commit a21afc3e45)

* use pr head ref

(cherry picked from commit 0edcc985fa)
2025-06-23 22:26:43 -07:00
Michaela Laurencin
a6ad5a6e60 docs: update timelines for E38 (#47488)
Update electron-timelines.md
2025-06-23 15:50:22 +02:00
Shelley Vohr
93d5152a25 fix: chrome://accessibility loading correctly (#47497)
fix: chrome://accessibility loading correctly
2025-06-23 14:38:29 +02:00
Shelley Vohr
fb65124234 chore: fix nightly issues getting unsupported label comment (#47503)
* chore: fix nightly issues getting unsupported label comment

* chore: address review feedback
2025-06-23 14:22:41 +02:00
dependabot[bot]
93f4b3cf9f build(deps): bump github/codeql-action from 3.28.19 to 3.29.0 (#47486)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.19 to 3.29.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](fca7ace96b...ce28f5bb42)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.29.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-06-23 11:24:18 +02:00
Charles Kerr
bb22eaccec refactor: simplify titlebar overlay initialization (#47480) 2025-06-23 11:24:05 +02:00
David Sanders
90a14299fd ci: fix sending Slack message in CI audit workflow (#47494) 2025-06-23 11:23:39 +02:00
Shelley Vohr
60924690d9 build: combine dependent libc patch (#47491) 2025-06-23 11:22:35 +02:00
John Kleinschmidt
9b158238dc build: update cache action to latest (#47501) 2025-06-23 11:22:14 +02:00
Samuel Attard
dac5e0cd1a build: add siso backend.star (#47509) 2025-06-20 11:25:27 -07:00
Robo
626895848e fix: utilityProcess running user script after process.exit is called (#47469)
* fix: utilityProcess running user script after process.exit is called

* docs: update breaking changes

* chore: update spec

* chore: update spec/api-utility-process-spec.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* chore: remove interface bound checks

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-06-18 04:36:22 +09:00
Keeley Hammond
3536d4976a fix: revert moving IsClosed() and IsClosable() into NativeWindow::Close() (#47482)
Revert "refactor: move `IsClosed()` and `IsClosable()` tests into `NativeWindow::Close()` (#46888)"

This reverts commit 3faddd5ae2.
2025-06-16 16:41:19 -07:00
Shelley Vohr
2ad762e075 feat: support HIDDevice.collections (#47391)
* feat: support HIDDevice.collections

* Update docs/api/structures/hid-device.md

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>

---------

Co-authored-by: Erick Zhao <ezhao@slack-corp.com>
2025-06-16 15:56:08 -04:00
electron-roller[bot]
6779769d22 chore: bump chromium to 139.0.7219.0 (main) (#47348)
* chore: bump chromium in DEPS to 139.0.7205.0

* 6543986: Mac: decouple deserializing and applying sandbox policy

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6543986

* 6580079: Reland 'Remove the third-party blocking feature'
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6580079

* 6505716: guest-contents: Add components/guest_contents
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6505716

* 6572556: Move LogMessageManager out of gpu_service_impl.cc.
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6572556

* 6566111: Change UtilityProcessHost to manage its instance internally
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6566111

* 6550237: Rename ReconnectEventObserver to ConnectionChangeObserverClient
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6550237

* 6565918: Validate path is valid UTF8 in SelectFileDialogLinuxPortal
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6565918

* 6579713: Remove base::NotFatalUntil::M130 usage
6566111: Change UtilityProcessHost to manage its instance internally
Refs
https://chromium-review.googlesource.com/c/chromium/src/+/6579713
https://chromium-review.googlesource.com/c/chromium/src/+/6566111

* chore: update chromium patches

* chore: update remaining patches

* fixup! 6566111: Change UtilityProcessHost to manage its instance internally Refs https://chromium-review.googlesource.com/c/chromium/src/+/6566111

* 6577970: Remove superfluous includes for base/strings/stringprintf.h in headers
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6577970

* 6568811: Add FunctionCall structured metrics event for DevTools
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6568811

* [PDF Ink Signatures] Support PdfAnnotationsEnabled policy
https://chromium-review.googlesource.com/c/chromium/src/+/6558970

* build: disable libcxx modules for rbe

* chore: bump chromium in DEPS to 139.0.7217.0

* chore: bump chromium in DEPS to 139.0.7218.0

* chore: update patches

fix_use_delegated_generic_capturer_when_available.patch was updated to handle a small change:
6582142: Use content::Create*Capturer in DesktopCaptureDevice. | https://chromium-review.googlesource.com/c/chromium/src/+/6582142

* chore: bump chromium in DEPS to 139.0.7219.0

* chore: update patches

* 6594615: Change Chromium's deployment target to macOS 12
https://chromium-review.googlesource.com/c/chromium/src/+/6594615

Updated the assertion message to match the docs structure now too. I removed the callout to the supported versions doc because it has moved and doesn't contain minimum platform version information.

* 6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_
https://chromium-review.googlesource.com/c/chromium/src/+/6606232

|NativeWindow::GetContentMinimumSize| and |NativeWindow::GetContentMaximumSize| may be good opportunities for a refactor now.

* add squirrel.mac patch for removed function

This was triggered by the macOS 12.0 deployment upgrade change.

See: https://developer.apple.com/documentation/coreservices/1444079-uttypeconformsto?language=objc

* 6582142: Use content::Create*Capturer in DesktopCaptureDevice.
https://chromium-review.googlesource.com/c/chromium/src/+/6582142

* 6579732: Two minor API "quality of life" cleanups in OSCrypt Async
https://chromium-review.googlesource.com/c/chromium/src/+/6579732

* chore: add include for base::SingleThreadTaskRunner

Not sure what change caused this, I expect it would be a removed include somewhere else, but it's likely not important to track down.

* chore: update libcxx filenames

* chore: update CI build-tools commit target for macOS SDK 15.4

The following change uses an API that was added in the macOS 15.4 SDK. Support for that SDK version was added later than the current build-tools commit target.

6575804: Use a quick-and-dirty solution to avoid glitching with paste-and-go | https://chromium-review.googlesource.com/c/chromium/src/+/6575804

See: https://developer.apple.com/documentation/appkit/nspasteboard/accessbehavior-swift.enum?language=objc

* fixup! 6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_ https://chromium-review.googlesource.com/c/chromium/src/+/6606232

* chore: bump chromium in DEPS to 139.0.7220.0

* chore: update patches

Minor changes due to:

6613978: pwa: let events fall through in the transparent area of TopContainerView | https://chromium-review.googlesource.com/c/chromium/src/+/6613978
6614778: Refactor auto pip tab observer for Android support | https://chromium-review.googlesource.com/c/chromium/src/+/6614778

* 6543986: Mac: decouple deserializing and applying sandbox policy
https://chromium-review.googlesource.com/c/chromium/src/+/6543986

The DecodeVarInt and DecodeString functions look benign from a MAS perspective. I suspect they were patched out to avoid "unused function" errors. Their complements for encoding are unpatched, supporting this idea.

The code that uses these functions was refactored out of the section that we patch out. Instead of patching out that new function, I decided to treat it the same as the serialization function that is unpatched.

* chore: bump chromium in DEPS to 139.0.7222.0

* chore: bump chromium in DEPS to 139.0.7224.0

* chore: bump chromium in DEPS to 139.0.7226.0

* chore: bump chromium in DEPS to 139.0.7228.0

* chore: update patches

* Don't use static variable for UseExternalPopupMenus

https://chromium-review.googlesource.com/c/chromium/src/+/6534657

* Reland "Roll libc++ from a01c02c9d4ac to a9cc573e7c59

https://chromium-review.googlesource.com/c/chromium/src/+/6607589

* chore: bump chromium in DEPS to 139.0.7219.0

* chore: update patches

* revert Don't use static variable for UseExternalPopupMenus

* tls: remove deprecated tls.createSecurePair and SecurePair

https://github.com/nodejs/node/pull/57361

* Revert "Reland "Roll libc++ from a01c02c9d4ac to a9cc573e7c59"

This reverts commit 33e1436a0c.

* test: cleanup api-desktop-capturer-spec.ts

* test: more cleanup of api-desktop-capturer-spec.ts

* chore: debug dcheck error in webrtc on linux

* fixup patch

* add debugging to desktop capturer spec

* test: fixup api-desktop-capturer-spec.ts for linux

* chore: remove debugging patch

* Revert "fixup! 6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_ https://chromium-review.googlesource.com/c/chromium/src/+/6606232"

This reverts commit 32e75651c1.

* Revert "6606232: [views] Remove DesktopWindowTreeHostWin::window_enlargement_"

This reverts commit 89c51aa1c7.

* [views] Remove DesktopWindowTreeHostWin::window_enlargement_

https://chromium-review.googlesource.com/c/chromium/src/+/6606232

Reverting as we need this functionality for now.

* fixup: remove patch that was accidentally added back

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-06-16 12:46:06 -05:00
Shelley Vohr
96fcc2f8c8 chore: exempt upgrade-follow-up issues from stale (#47460)
chore: exempt upgrade-follow-upissues from stale
2025-06-14 21:43:57 -07:00
Charles Kerr
3c9b8475a2 refactor: move gin::Converter<PreloadScript> impl to a .cc file (#47445)
refactor: move gin::Converter<PreloadScript> impl to a .cc file
2025-06-13 10:15:32 +02:00
Charles Kerr
6f915e85e2 refactor: have ShowSaveDialogSync() return a std::optional<base::FilePath> (#47428)
* refactor: have ShowSaveDialogSync() return a std::optional<base::FilePath>

* fixup! refactor: have ShowSaveDialogSync() return a std::optional<base::FilePath>
2025-06-12 12:25:40 +02:00
Anny Yang
0259abe920 docs: update remaining references to electron-quick-start (#47405)
* chore: udpate remaining references to electron-quick-start

* chore: Update docs/tutorial/tutorial-1-prerequisites.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: Update docs/tutorial/tutorial-3-preload.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: Update docs/tutorial/tutorial-2-first-app.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: linebreak

* chore: swap minimal-repro for npx create-electron-app

* chore: add back code commands

* chore: add whitespace

* chore: remove reference to repo containing old quick start

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-06-12 10:32:17 +02:00
Shelley Vohr
38fe14041d fix: crash calling Fetch.continueResponse with WebContentsView (#47434)
fix: crash calling Fetch.continueResponse with WebContentsView
2025-06-11 15:43:47 +02:00
dependabot[bot]
996945d3e3 build(deps): bump github/codeql-action from 3.28.18 to 3.28.19 (#47426)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.18 to 3.28.19.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](ff0a06e83c...fca7ace96b)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.28.19
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-06-11 11:24:03 +02:00
Niklas Wenzel
d7ef8b79ae docs: mention kwallet6 command line option (#47427) 2025-06-10 16:12:31 -04:00
Erick Zhao
6aa3665b96 docs: no class inheritance (#47403) 2025-06-10 10:00:06 +02:00
Robo
c964296ec3 feat: add support for --no-experimental-global-navigator (#47370)
chore: add support for --no-experimental-global-navigator
2025-06-09 14:57:27 +09:00
David Sanders
6f48e3ab12 ci: fix up branch CI audit workflow (#47404) 2025-06-07 09:58:48 +02:00
Shelley Vohr
06bc59be88 fix: rework lifetime mgmt of ClearDataTask/ClearDataOperation (#47361)
* fix: rework lifetime mgmt of ClearDataTask/ClearDataOperation

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-06-07 08:00:30 +02:00
David Sanders
0b84c68229 ci: ignore network-related error annotations in audit (#47333)
* ci: ignore network-related error annotation in audit

* chore: add another error message
2025-06-06 16:52:25 -04:00
Shelley Vohr
09a0926c5b fix: printing PDF via webContents.print() (#47377)
fix: printing PDF via webContents.print()
2025-06-06 14:20:37 -04:00
Shelley Vohr
6606230813 fix: silent printing of PDFs with webContents.print (#47378)
fix: silent printing
2025-06-06 14:19:08 -04:00
David Sanders
a42afaa866 chore: fix docs lint (#47389) 2025-06-06 10:01:26 +02:00
John Kleinschmidt
b1f0ab11c5 build: cache gitcache dir (#47328)
* revert build: migrate to new chromium git auth

* build: cache gitcache dir
2025-06-05 17:00:21 -04:00
David Sanders
4c3e2eb560 build(deps-dev): bump husky and lint-staged (#47291) 2025-06-05 20:23:55 +02:00
Niklas Wenzel
72340e79e8 docs: remove electron-quick-start from README (#47359)
Refs https://github.com/electron/.permissions/pull/293

The repo was renamed to `minimal-repro` and is no longer intended to be used as a way to start new projects (see PR above).

Since we really want bugs in `electron/electron` to be reported with a Fiddle gist instead of a standalone repo (makes reproducing and bisecting sooo much easier and safer!), I removed the repo from the README completely instead of mentioning as an issue reproduction starting point.
2025-06-05 20:12:21 +02:00
Niklas Wenzel
7196a28d3a docs: mention Azure Trusted Signing (#47323) 2025-06-05 19:13:39 +02:00
Shelley Vohr
6c96979b6c chore: remove unused spec-chromium (#47367)
chore: remove unused spec-chromium
2025-06-05 15:50:19 +02:00
Felix Rieseberg
5cbab906c9 docs: Add Swift/macOS tutorial (#46697)
Co-authored-by: Felix Rieseberg <fr@makenotion.com>
2025-06-05 15:45:04 +02:00
Erick Zhao
2a51a997eb docs: update link to runAsNode fuse (#47350) 2025-06-05 10:03:58 +02:00
Shelley Vohr
fbb3fa7503 feat: allow intercepting mouse events (#47280)
* feat: allow intercepting mouse events

* test: add specs

* Update spec/api-web-contents-spec.ts

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-06-04 14:10:33 +02:00
Shelley Vohr
c22f94037a docs: document possible print failureReasons (#47337)
docs: document possible print failureReasons
2025-06-04 14:09:24 +02:00
John Kleinschmidt
ba7c3bbdf7 chore: update patches (#47346) 2025-06-03 13:52:17 -04:00
electron-roller[bot]
53fd879043 chore: bump chromium to 138.0.7190.0 (main) (#47107)
* chore: bump chromium in DEPS to 138.0.7180.0

* 6546797: Add a metric for the overall success of the "safe storage" item retrieval.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6546797

* 6548078: extensions: Fix TODO in ScriptInjectionTracker for desktop Android

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6548078

* 6544950: Revert "FSA: Only normalize the hardcoded rules once during initialization"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6544950

* chore: bump chromium in DEPS to 138.0.7181.0

* chore: update patches

* fix: correctly clamp HSL shift values between 0 and 1

* chore: bump DEPS to 138.0.7183.0

* 6553142: Remove SelectFileDialogLinuxKde | https://chromium-review.googlesource.com/c/chromium/src/+/6553142

* chore: update patches

* chore: bump chromium in DEPS to 138.0.7184.0

* chore: bump chromium in DEPS to 138.0.7186.0

* chore: bump chromium in DEPS to 138.0.7190.0

* chore: update patches

* 6547778: Remove some superfluous //ui/gfx includes from //chrome headers | https://chromium-review.googlesource.com/c/chromium/src/+/6547778

* 6556022: Reland FSA: Only normalize the hardcoded rules once during initialization | https://chromium-review.googlesource.com/c/chromium/src/+/6556022

* fix: remove pdf_extension_util::AddAdditionalData
https://chromium-review.googlesource.com/c/chromium/src/+/4099130

This was removed 2 years ago in Chrome.

* fix: provide BrowserContext to pdf_extension_util::AddAdditionalData
https://chromium-review.googlesource.com/c/chromium/src/+/6558173

* fixup! 6556022: Reland FSA: Only normalize the hardcoded rules once during initialization | https://chromium-review.googlesource.com/c/chromium/src/+/6556022

* fix: pass in navigation throttle registry
https://chromium-review.googlesource.com/c/chromium/src/+/6536175

* fixup! 6556022: Reland "FSA: Only normalize the hardcoded rules once during initialization" | https://chromium-review.googlesource.com/c/chromium/src/+/6556022

This partially reverts commit 20d709dd15ba0ff332e24ee314149d642dc5d47c.

* 6545984: corner-shape: render dashed & dotted borders
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6545984

* Update corner smoothing expected images

* Apply "future" revert commit to fix windows build

> Reason for revert: Multiple eng reporting that this is causing build failures due to too-long pathnames, with no immediate feasible workaround

This issue also affects our CI builds.

Problematic CL in current roll: 6494836: [webgl] Add stub WebGL[2]RenderingContextWebGPU | https://chromium-review.googlesource.com/c/chromium/src/+/6494836
"Future" revert CL: 6565622: Revert "[webgl] Add stub WebGL[2]RenderingContextWebGPU" | https://chromium-review.googlesource.com/c/chromium/src/+/6565622

This patch should automatically disappear when we roll the revert.

* 6533919: win: don't add WS_CAPTION style to popup windows
https://chromium-review.googlesource.com/c/chromium/src/+/6533919

This mirrors the change made earlier to the code ours is based on: 6374074: [headless] Provide headless aware window metrics on Windows | https://chromium-review.googlesource.com/c/chromium/src/+/6374074

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: clavin <clavin@electronjs.org>
2025-06-03 11:19:20 -04:00
Shelley Vohr
5f5e8d012d fix: add back fallback wasm-trap handling (#47186)
* fix: add back fallback wasm-trap handling

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5372409

This change sets up wasm-trap handling for the case where content_shell
has not enabled crash reporting but moves the responsibility to
ElectronRendererClient. The default ContentRendererClient assumes
that crash reporting is enabled (crashpad enabled by default) and does
not set up its own handler.

* chore: fix build

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-06-03 15:31:23 +02:00
Calvin
508c601996 fix: do not load source for electron module in ESM loader synchronous flow (#46810) 2025-06-03 12:50:17 +02:00
Sta Zhu
158176f0f3 fix: addChildView() crashes when adding a closed WebContentsView (#47099)
fix: addChildView() crashes when add a closed WebContentsView
2025-06-03 10:53:25 +02:00
dependabot[bot]
d1e64c37a2 build(deps): bump ossf/scorecard-action from 2.4.1 to 2.4.2 (#47329)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.1 to 2.4.2.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](f49aabe0b5...05b42c6244)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-version: 2.4.2
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-06-03 10:18:03 +02:00
Shelley Vohr
17ba863f69 docs: correct 'select-bluetooth-device' requirement (#47325) 2025-06-03 10:16:16 +02:00
electron-roller[bot]
82a59d9894 chore: bump node to v22.16.0 (main) (#47217)
* chore: bump node in DEPS to v22.16.0

* crypto: remove BoringSSL dh-primes addition

https://github.com/nodejs/node/pull/57023

* tools: enable linter in test/fixtures/test\-runner/output

https://github.com/nodejs/node/pull/57698

* src: improve thread safety of TaskQueue

https://github.com/nodejs/node/pull/57910

* buffer: define global v8::CFunction objects as const

https://github.com/nodejs/node/pull/57676

* src: disable abseil deadlock detection

https://github.com/nodejs/node/pull/57582

* zlib: fix pointer alignment

https://github.com/nodejs/node/pull/57727

* chore: fixup patch indices

* src: set default config as node.config.json

https://github.com/nodejs/node/pull/57171

* src: update std::vector<v8::Local<T>> to use v8::LocalVector<T>

https://github.com/nodejs/node/pull/57578

* test: disable chmod tests failing in Docker

https://github.com/nodejs/node/issues/58326

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-06-02 17:30:15 -04:00
David Sanders
55006fe9a8 ci: change patches stats DataDog metric type to gauge (#47319) 2025-06-02 14:49:44 -04:00
zeeker999
dc5efca0f6 feat: [net] add "priority" option to net.request (#42628)
document the default value of priority option

Update the priority test to not use the httpbin.org as server

Fixed the lint errors

Fixed the build error
2025-05-30 15:28:13 -04:00
David Sanders
cf6c662702 ci: upload stats about patches to DataDog (#47206) 2025-05-30 11:14:57 -04:00
Shelley Vohr
c84e8c6c22 feat: expose win.isContentProtected() (#47242)
* feat: expose win.isContentProtected()

* chore: remove stray _isContentProtected
2025-05-30 11:00:13 +02:00
John Kleinschmidt
46921d3652 docs: document commit signing requirement (#47290) 2025-05-30 10:59:29 +02:00
David Sanders
b303413a04 build: drop shx dependency (#47293) 2025-05-30 10:59:11 +02:00
David Sanders
83524adf17 chore: fix lint for ImageView doc (#47304) 2025-05-29 17:10:41 -04:00
David Sanders
14b3183eb5 ci: add a problem matcher for ESLint output (#47303) 2025-05-29 16:58:17 -04:00
David Sanders
0d70389ccb chore: lint code blocks in docs with ESLint (#42113) 2025-05-29 12:45:26 -07:00
Niklas Wenzel
4e61f5b26f fix: Squirrel.Mac crash when zip extraction fails (#47271)
* fix: Squirrel.Mac crash when zip extraction process fails to launch

* chore: add end-to-end test
2025-05-29 10:31:46 -07:00
Will Anderson
5b5f900e34 docs: add documentation for ImageView (#46760)
* docs: Add documentation for ImageView

* docs: Add ImageView main process module list in README.md

* test: Add some basic tests for ImageView

* test: Fill out Window embedding tests to better reflect how someone might use an ImageView

* docs: Add notes about using ImageView as a splash screen

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* docs: Update ImageView example to show a more complete splash screen example

* docs: Remove view resizing logic since the ImageView automatically gets resized

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-05-29 10:24:16 -07:00
David Sanders
2e0b4eca94 build: remove unnecessary eslint-plugin-standard package (#47283) 2025-05-28 13:58:14 +02:00
David Sanders
3a32f25750 ci: audit important branches for CI errors (#47207)
* ci: audit important branches for CI errors

* chore: move message to Slack workflow
2025-05-27 11:35:33 -04:00
Erick Zhao
f6b8ee0731 chore: add .eslintrc.json for docs/fiddles (#47269) 2025-05-27 09:13:10 -05:00
Robo
5ccbfa2faf fix: regression with directory selection in macOS dialogs (#47259) 2025-05-27 19:08:11 +09:00
Shelley Vohr
f89c2a0ef4 fix: titlebar showing in content protected window (#47241)
Closes https://github.com/electron/electron/issues/47152.
2025-05-26 09:46:04 +02:00
Shelley Vohr
c6f368acc6 chore: debug crash on DevTools SetOwnerWindow (#47243) 2025-05-26 09:45:43 +02:00
David Sanders
5e3b5ef04c chore: update @electron/lint-roller to 3.1.1 (#47202)
* chore: update @electron/lint-roller to 3.1.1

* docs: fix broken link in breaking-changes.md

* chore: fix for Node.js versions without require(esm)
2025-05-25 07:58:55 -05:00
John Kleinschmidt
ac5e3c76f3 build: migrate to new chromium git auth (#47230) 2025-05-25 07:57:20 -05:00
Gellert Hegyi
b9b96a96f7 feat: add menu item role palette and header (#45538)
* feat: add menu item role `palette` and `header`

* adds comments

* refactors new role items to new item types

* docs: custom type

* docs: note types only available on mac 14+

---------

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-05-23 12:43:49 -04:00
Charles Kerr
2248de847d refactor: use base::fixed_flat_set in NativeWindowViews::SetAlwaysOnTop() (#47201)
refactor: use base::fixed_flat_set in NativeWindowViews::SetAlwaysOnTop()
2025-05-22 18:20:39 -05:00
Charles Kerr
38e7ff944e refactor: make NativeWindow::has_frame_ const (#47200)
* refactor: make NativeWindow::is_modal_ const

* refactor: make NativeWindow::title_bar_style_ const and private

* refactor: make NativeWindow::has_client_frame() protected

refactor: make NativeWindow::transparent() protected

* refactor: make NativeWindow::enable_larger_than_screen() protected

* refactor: make NativeWindow::has_frame_ const

* fixup! refactor: make NativeWindow::has_client_frame() protected

fix: GetExpandedWindowSize()
2025-05-22 17:32:46 -05:00
David Sanders
8f09d7037b ci: add problem matcher for patch conflict output (#47183) 2025-05-22 09:27:23 -04:00
David Sanders
d0102ff392 ci: add problem matcher for clang output (#46577) 2025-05-22 09:25:57 -04:00
Keeley Hammond
274e1df1ca build: revert bump @octokit/rest from 20.1.1 to 21.1.1 (#47208)
Revert "build(deps-dev): bump @octokit/rest from 20.1.1 to 21.1.1 (#47159)"

This reverts commit 517f5c15b9.
2025-05-21 18:39:24 -07:00
John Kleinschmidt
b2d0074cc6 build: fix depot tool pathing on Windows (#47194)
build: properly set depot_tools pathing for Windows
2025-05-21 16:05:50 -07:00
Charles Kerr
2e8fc17f07 refactor: pass views::Widget* into constructors of our TreeHosts and NativeWidgets (#47177)
* refactor: remove unnecessary downcast in MenuViews::PopupAt()

* refactor: pass a views::Widget as an arg to the ElectronDesktopWindowTreeHostLinux ctor

* refactor: pass a views::Widget as an arg to the ElectronDesktopNativeWidgetAura ctor

* refactor: pass a views::Widget as an arg to the ElectronDesktopWindowTreeHostWin ctor

* refactor: create desktop_window_tree_host_ in the ElectronDesktopNativeWidgetAura constructor

* fixup! refactor: create desktop_window_tree_host_ in the ElectronDesktopNativeWidgetAura constructor

fix: tyop
2025-05-21 16:02:55 -05:00
Charles Kerr
4af0c5d762 refactor: make NativeWindow::transparent_ const (#47172)
* refactor: use in-class member initialization for NativeWindow::widget_

* refactor: make NativeWindow::transparent_ const

refactor: make NativeWindow::enable_larger_than_screen_ const

* chore: make linter happy after rebase
2025-05-21 19:42:08 +02:00
Charles Kerr
a7a3e10300 refactor: prefer base::circular_deque over std::deque (#47171)
* refactor: use base::circular_deque in ResolveProxyHelper

* refactor: use base::circular_deque in GetExtraCrashKeys()

refactor: reduce visibility of kMaxCrashKeyValueSize

This change is to match Chromium's usage advice from
base/containers/README.md: `base:circular_deque` is preferred over
`std::deque` to provide consistent performance across platforms.
2025-05-21 12:04:36 -05:00
Shelley Vohr
7b77a24211 fix: remove extra 'suspend'/'resume' handling from powerMonitor (#47162)
fix: remove extra 'suspend'/'resume' handling from powerMonitor
2025-05-21 10:00:38 -05:00
David Sanders
7112c592c9 test: strip color output in ESM spec (#47185) 2025-05-21 10:50:06 +02:00
Charles Kerr
d6638f9564 refactor: make NativeWindow::pending_transitions_ a base::queue (#47157)
refactor: make NativeWindow::pending_transitions a base::queue

Follow the base/containers/README.md advice that "Chromium code should
always use `base::circular_deque` or `base::queue` in preference to
`std::deque` or `std::queue` due to memory usage and platform variation."
2025-05-20 17:35:51 -05:00
Charles Kerr
9f8bcc4d98 refactor: make NativeWindow::has_client_frame_ const (#47156) 2025-05-20 17:14:28 -05:00
Charles Kerr
21155679a0 refactor: add NativeWindowViews::GetClientFrameViewLinux() (#47130)
* refactor: add NativeWindowViews::GetClientFrameViewLinux()

* chore: clarify code comment
2025-05-20 14:15:06 -05:00
Charles Kerr
211faed848 refactor: add NativeWindow::IsActive() (#47148)
this was already present on macOS; use in NativeWindowViews too
2025-05-20 11:08:44 -04:00
Shelley Vohr
296e39456a refactor: match upstream macOS a11y handling (#47144) 2025-05-20 11:06:57 -04:00
John Kleinschmidt
a19198d784 build: update_depot_tools on initial install (#47160)
this ensures that python is setup for proper use from depot_tools
2025-05-20 10:40:48 -04:00
reito
263c76df09 fix: prevent gc monitor 2nd pass crash (#46987) 2025-05-20 22:54:03 +09:00
dependabot[bot]
517f5c15b9 build(deps-dev): bump @octokit/rest from 20.1.1 to 21.1.1 (#47159)
Bumps [@octokit/rest](https://github.com/octokit/rest.js) from 20.1.1 to 21.1.1.
- [Release notes](https://github.com/octokit/rest.js/releases)
- [Commits](https://github.com/octokit/rest.js/compare/v20.1.1...v21.1.1)

---
updated-dependencies:
- dependency-name: "@octokit/rest"
  dependency-version: 21.1.1
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-20 09:57:30 +02:00
dependabot[bot]
d29293556d build(deps): bump github/codeql-action from 3.28.15 to 3.28.18 (#47158)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.15 to 3.28.18.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](45775bd823...ff0a06e83c)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.28.18
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-20 09:56:54 +02:00
Shelley Vohr
e0ea069859 build: remove fix_linter_error.patch (#47150)
build: remove fix_linter_error.patch
2025-05-19 22:52:01 +02:00
electron-roller[bot]
7cc76c094a chore: bump node to v22.15.1 (main) (#47105)
* chore: bump node in DEPS to v22.15.1

* chore: fixup patch indices

* src: fix error handling on async crypto operations

https://github.com/nodejs-private/node-private/pull/709

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-19 16:12:48 -04:00
Charles Kerr
3660432f42 refactor: NativeWindows should prefer widget() over GetWidget() for internal use (#47133) 2025-05-19 21:43:16 +02:00
Charles Kerr
687e50b4f3 refactor: add NativeWindowViews::SetTitleBarOverlay() (#47126)
* refactor: move SetTitleBarOverlay() impl to NativeWindowViews

* refactor: make NativeWindowViews::set_overlay_button_color() private

refactor: make NativeWindowViews::set_overlay_symbol_color() private

refactor: make NativeWindow::set_titlebar_overlay_height() protected

* refactor: simplify downcasting in NativeWindowViews::SetTitleBarOverlay()
2025-05-19 08:19:03 -05:00
David Sanders
d426667a01 build(dev-deps): update @electron/lint-roller and markdownlint-cli2 (#47082) 2025-05-19 14:19:04 +02:00
Charles Kerr
208bbc0504 refactor: add NativeWindow::SetShape() (#47131)
use NativeWindow::SetShape() in api::BaseWindow
2025-05-19 10:29:29 +02:00
dependabot[bot]
e2f496cfbc build(deps-dev): bump @typescript-eslint/eslint-plugin from 8.7.0 to 8.32.1 (#47135)
build(deps-dev): bump @typescript-eslint/eslint-plugin

Bumps [@typescript-eslint/eslint-plugin](https://github.com/typescript-eslint/typescript-eslint/tree/HEAD/packages/eslint-plugin) from 8.7.0 to 8.32.1.
- [Release notes](https://github.com/typescript-eslint/typescript-eslint/releases)
- [Changelog](https://github.com/typescript-eslint/typescript-eslint/blob/main/packages/eslint-plugin/CHANGELOG.md)
- [Commits](https://github.com/typescript-eslint/typescript-eslint/commits/v8.32.1/packages/eslint-plugin)

---
updated-dependencies:
- dependency-name: "@typescript-eslint/eslint-plugin"
  dependency-version: 8.32.1
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-19 10:27:22 +02:00
Charles Kerr
1da150f9a3 chore: remove gclient sync macOS CI hack patch (#47123)
chore: remove hack_to_allow_gclient_sync_with_host_os_mac_on_linux_in_ci.patch
2025-05-19 10:26:58 +02:00
Calvin
5dd6481e53 fix: explicit microtask scope DCHECK condition (#47134) 2025-05-19 12:08:59 +09:00
dependabot[bot]
d72e622a3f build(deps): bump slackapi/slack-github-action from 2.0.0 to 2.1.0 (#47060)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 2.0.0 to 2.1.0.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](485a9d42d3...b0fa283ad8)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-version: 2.1.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-05-16 12:55:00 -05:00
Charles Kerr
8efd24c339 perf: don't create unused menuitem icons (#47100)
GTK >= 3.90.0 removed support for menuitem icons. When Electron is
built with GTK >= 3.90.0, our code builds these icons and then throws
them away unused. Instead, let's just not build them.

Our gtk_util::GdkPixbufFromSkBitmap utility uses BGRAToRGBA and is
expensive to call.
2025-05-16 02:43:03 -05:00
Erick Zhao
dc34e8732c docs: add note on DIP and DPI (#47080) 2025-05-15 16:51:49 -05:00
Charles Kerr
77c58658c5 refactor: decouple NativeWindowViews and GlobalMenuBarX11 (#47094)
The GlobalMenuBar used to hold a raw_ptr reference to its NativeWindow;
but since it doesn't use it & only wants the gfx::AcceleratedWidget info,
let's remove the NativeWindowViews reference.

AFAICT, GlobalMenuBarX11::window_ has never been used
2025-05-15 16:10:56 -05:00
Charles Kerr
d720aea700 refactor: make TrackableObject::weak_map_id() constexpr (#47092)
* refactor: make TrackableObject::weak_map_id() constexpr

refactor: make BaseWindow::GetID() inline and constexpr

* refactor: make NativeWindow::window_id() constexpr too
2025-05-15 16:10:33 -05:00
Charles Kerr
e2bcd8f0aa test: fix desktopCapturer mocha syntax (#47088)
* test: fix desktopCapturer mocha syntax

do not nest `it` calls in desktopCapturer specs

* empty commit
2025-05-15 16:54:49 -04:00
Robo
99a3e360ec fix: opening package paths as directory on macOS (#47077) 2025-05-15 12:47:46 -05:00
electron-roller[bot]
883f48b9b4 chore: bump chromium to 138.0.7178.0 (main) (#47086)
* chore: bump chromium in DEPS to 138.0.7178.0

* 6351556: [source-phase-imports] Support Wasm Source Phase Imports

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6351556

* chore: update patches

* 6509682: extensions: Use ChromeExtensionsBrowserClient on desktop Android, part 2

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6509682

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-05-15 12:47:07 -05:00
Charles Kerr
9a7b73b533 refactor: use kKeyModifiers in IsAltModifier() (#47066)
We probably didn't use this before because IsAltModifier() was written
two years before the KeyModifiers mask was added upstream in 98ec378a.
2025-05-14 11:00:00 -04:00
Charles Kerr
6170a5af40 chore: combine all the "patch out Profiles" changes into a single patch (#47063)
* chore: fold the profile patches into one patch

* chore: e patches all

* chore: patch out ProfileSelections::ApplyProfileSelection()

Another profile reference. Referenced iff making a debug build.
2025-05-14 09:21:11 -05:00
electron-roller[bot]
d65a856bf3 chore: bump chromium to 138.0.7177.0 (main) (#47081)
* chore: bump chromium in DEPS to 138.0.7177.0

* 6530423: [WebContents] Fix IsNeverComposited() calls during initialization

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6530423

* 6512551: [ios] Enable -Wobjc-property-assign-on-object-type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6512551

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-05-14 10:08:31 -04:00
Shelley Vohr
f2639d13cc refactor: remove CreateViewForWidget patch (#46981)
* refactor: remove CreateViewForWidget patch

* chore: rm unintended osr change

* Trigger CI

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-05-14 21:43:23 +09:00
Charles Kerr
11fa915724 refactor: remove introduce_ozoneplatform_electron_can_call_x11_property.patch (#47075)
* refactor: use x11_util::IsX11() in BuildSubmenuFromModel()

* refactor: use x11_util::IsX11() in ElectronDesktopWindowTreeHostLinux::OnBoundsChanged()

* refactor: use skia_can_fall_back_to_x11 in x11_util::IsX11()

it is identical in practice to electron_can_call_x11 and does not require a Chromium patch

* chore: remove introduce_ozoneplatform_electron_can_call_x11_property.patch

* refactor: use ui::GetOzonePlatformId() to test for x11
2025-05-14 13:38:35 +09:00
David Sanders
9aacc473e6 build: remove patch that landed upstream (#47079) 2025-05-13 20:10:48 -05:00
Charles Kerr
c218128675 chore: remove disable_unload_metrics.patch (#47059) 2025-05-13 14:55:59 -04:00
electron-roller[bot]
e3e647d21e chore: bump chromium to 138.0.7175.0 (main) (#46986)
* chore: bump chromium in DEPS to 138.0.7166.0

* chore: bump chromium in DEPS to 138.0.7166.2

* 6508373: Add WebContents, Tab getters for future Clank navigation capture rework

https://chromium-review.googlesource.com/c/chromium/src/+/6508373

* 6470924: Introduce auto-populated Search Engine icons.

https://chromium-review.googlesource.com/c/chromium/src/+/6470924

* 6502977: Force same tab navigation while actor coordinator is acting on a tab

https://chromium-review.googlesource.com/c/chromium/src/+/6502977

* chore: bump chromium in DEPS to 138.0.7168.0

* chore: update patches

* fix grit patch

* chore: bump Chromium to 138.0.7169.2

* fixup! 6508373: Add WebContents, Tab getters for future Clank navigation capture rework

* 6493688: NavigationThrottleRunner2: void CreateThrottlesForNavigation

https://chromium-review.googlesource.com/c/chromium/src/+/6493688

* 6488755: Reland "WebSQL: Remove WebPreference"

https://chromium-review.googlesource.com/c/chromium/src/+/6488755

* 6428707: FSA: Only normalize the hardcoded rules once during initialization

https://chromium-review.googlesource.com/c/chromium/src/+/6428707

* chore: fixup patch indices

* chore: bump chromium in DEPS to 138.0.7170.0

* 6514121: Remove origin calculation debug info and related methods

 https://chromium-review.googlesource.com/c/chromium/src/+/6514121

* chore: bump chromium in DEPS to 138.0.7172.0

* chore: bump chromium in DEPS to 138.0.7173.0

* chore: bump chromium in DEPS to 138.0.7175.0

* fixup! 6514121: Remove origin calculation debug info and related methods

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6514121

* 6531585: Don't retry LayerTreeSink creation on the high priority queue

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6531585

* 6512253: Modernize base::apple's base bundle ID

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6512253

* fixup! 6428707: FSA: Only normalize the hardcoded rules once during initialization

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6428707

* fixup! 6508373: Add WebContents, Tab getters for future Clank navigation capture rework

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6508373

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-05-13 14:51:20 -04:00
Shelley Vohr
7ab032f594 fix: white window flicker on window creation (#47022) 2025-05-10 18:24:35 -05:00
Erick Zhao
2493e530d0 docs: unify [!NOTE] structure (#46893)
* docs: unify [!NOTE] structure

* Update docs/api/command-line.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update docs/api/browser-window.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update docs/api/download-item.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* Update docs/api/global-shortcut.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* revert line break

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-05-09 14:36:42 -07:00
Michaela Laurencin
10e4f9ad37 feat: enable secondary label for macOS menu (#46887)
* feat: enable secondary label for macOS menu

* Update shell/browser/ui/cocoa/electron_menu_controller.mm

Co-authored-by: Robo <hop2deep@gmail.com>

* fix for lint

* update docs for sublabel

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-05-09 12:05:26 -04:00
Michaela Laurencin
b9f0aebb2f feat: enable innerWidth and innerHeight for window open (#46749)
* feat: enable innerWidth and innerHeight for window open

* update comment for added special innerWidth and innerHeight

* update 100 min spec requirement handling

* update testing to include getContentSize

* update macOS min requirement handling

* adjust refactored consts

* update const values from nativewindowviews
2025-05-09 12:03:45 -04:00
Shelley Vohr
8ecd731e96 fix: webview crash on focus (#46979) 2025-05-09 17:56:22 +02:00
Shelley Vohr
75cf8ea96d fix: restore previous Windows screenshotting (#47020)
Fixes https://github.com/electron/electron/issues/45990

We previously made a change in https://github.com/electron/electron/pull/45868
to fix content protection being lost on hide and re-show. However, this
cause a breaking change where protected windows were made opaque black
instead of being hidden as before. This overrides relevant methods in
ElectronDesktopWindowTreeHostWin to restore the previous behavior.
without regressing the original issue.
2025-05-09 09:38:27 -05:00
Aman Karmani
376634c75a feat: add support for --experimental-network-inspection (#46690)
* feat: add support for `--experimental-network-inspection`

* docs: fix minor formatting issues

visible on both GH[1] and the docs site[2]

[1] https://github.com/electron/electron/blob/main/docs/api/command-line-switches.md#nodejs-flags
[2] https://www.electronjs.org/docs/latest/api/command-line-switches#--inspect-brkhostport

* docs: add entry for new nodejs flag
2025-05-09 09:44:14 -04:00
Robo
8e8d3a4f3e fix: use-after-move of bus connection in xdg portal detection (#47008) 2025-05-09 18:32:08 +09:00
Charles Kerr
2cbd968da5 refactor: use gin_helper::Dictionary::ValueOrDefault() (#46982)
* refactor: use ValueOrDefault() in electron_api_web_contents.cc

* refactor: use ValueOrDefault() in electron_api_url_loader.cc

* refactor: use ValueOrDefault() in electron_download_manager_delegate.cc

* refactor: use ValueOrDefault() in electron_touch_bar.mm

* refactor: use ValueOrDefault() in electron_url_loader_factory.cc

* refactor: use ValueOrDefault() in electron_browser_context.cc

* refactor: use ValueOrDefault() in electron_touch_bar.mm

* refactor: use ValueOrDefault() in blink_converter.cc

* feat: add ValueOrDefault() to PersistentDictionary

* empty commit

* refactor: use ValueOrDefault() in blink_converter.cc

* refactor: inline the rectangle base::Value::Dict

* refactor: remove has_scroll temporary

---------

Co-authored-by: Deepak Mohan <hop2deep@gmail.com>
2025-05-08 14:17:22 -05:00
Keeley Hammond
aea7b4ae8c build: update hasher return value (#47009) 2025-05-08 11:34:21 -07:00
Charles Kerr
9f8a629126 refactor: reduce use of NativeWidgetPrivate (#46942)
* refactor: do not use native_widget_private() in NativeWindowViews::SetContentProtection()

refactor: do not use native_widget_private() in NativeWindowViews::IsContentProtected()

* refactor: do not use native_widget_private() in NativeWindowViews::Show()

* chore: remove native_widget_private #include from native_window_views_win

Not needed since Feb 2025: 9199d5c6
2025-05-08 09:02:19 -05:00
Charles Kerr
d4ca829069 test: enable hasShadow tests on Linux (#46984)
refactor: enable hasShadow tests on Linux
2025-05-08 10:07:10 +02:00
Charles Kerr
54a6bbb4cb build: remove skip_atk_toolchain_check.patch (#46988)
chore: remove skip_atk_toolchain_check.patch
2025-05-08 10:06:55 +02:00
Charles Kerr
24f1f7ed57 build: remove deps_add_v8_object_setinternalfieldfornodecore.patch (#46992)
chore: remove deps_add_v8_object_setinternalfieldfornodecore.patch

This was a Node 20-specific workaround that's no longer needed in Node 22.

Xref: https://github.com/nodejs/node/pull/49874.
2025-05-08 09:39:58 +02:00
Keeley Hammond
153dae5b48 build: move release script to new hasher function (#46989)
build: move to new hasher function
2025-05-08 01:15:08 -05:00
Calvin
580fa57a29 refactor: Node.js temporary "explicit" microtask policy scope pattern (#46973)
refactor: Node.js explicit microtask scope pattern
2025-05-08 10:21:39 +09:00
Calvin
37639b5400 refactor: replace gin_helper::MicrotasksScope with v8::MicrotasksScope (#46963)
* Remove microtasks_scope.h and microtasks_scope.cc

* Use v8::MicrotasksScope when ignoring browser checkpoint

These call always skip the browser checkpoint, so they are equivalent to using v8::MicrotasksScope directly (modulo the optional wrapper behavior).

* Remove MicrotasksScope from node_bindings.cc

This code seems contradictory: it explicitly specifies "do not run microtasks" yet runs a microtask checkpoint in the browser process.

Looking at its history, it [was introduced][1] with the intention to not run microtasks, but a [subtle C++ language behavior][2] caused it to do the opposite later in the same roll. Since the original intention was to not run microtasks, and since that is also the simplest explanation, we can assume `ignore_browser_checkpoint` should be true and migrate this to `v8::MicrotasksScope` as it is equivalent (modulo the optional wrapper behavior).

[1]: a4ea80dd47 (diff-efe58cf03c97028f37f801db044d396a5f428686da6595d2c692f1c052bbd09c)
[2]: https://github.com/electron/electron/pull/43185

* Migrate gin_helper/promise.h and gin_helper/promise.cc to v8::MicrotasksScope

Restores the [original][1] behavior of running the microtask checkpoint at destruction, but preserves the behavior of running microtasks in the browser process. This had last changed in the migration to gin_helper::MicroTasks.

[1]: https://github.com/electron/electron/pull/16401
2025-05-07 14:10:34 -05:00
electron-roller[bot]
a8695d4387 chore: bump chromium to 138.0.7166.0 (main) (#46975)
* chore: bump chromium in DEPS to 138.0.7165.0

* 6492127: Add new less invasive context menu mode for mobile interesttarget

https://chromium-review.googlesource.com/c/chromium/src/+/6492127

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-07 13:04:15 -04:00
Charles Kerr
924a8da940 refactor: use WidgetDelegate::SetAccessibleTitle() (#46765)
* refactor: use WidgetDelegate::SetAccessibleTitle()

* test: add window.accessibleTitle tests
2025-05-07 10:44:53 -05:00
Shelley Vohr
c16ea8d54e fix: printing when no mediaSize specified (#46937)
fix: printing when no mediaSize specified
2025-05-06 19:12:25 -05:00
Charles Kerr
b7ae162716 refactor: add gin_helper::Dictionary::ValueOrDefault() (#46939)
* feat: add gin_helper::Dictionary::ValueOrDefault()

A convenience function for using a default value if the
specified key isn't present in the dictionary.

* refactor: use ValueOrDefault() in native_window.cc

* refactor: use ValueOrDefault() in native_window_mac.mm

* refactor: use ValueOrDefault() in native_window_views.cc

* refactor: use ValueOrDefault() in electron_api_native_image.cc
2025-05-06 15:20:12 -05:00
Shelley Vohr
e876cecbc7 test: test menu rendering accelerators (#44634)
* test: test menu rendering accelerators

* Update spec/api-menu-spec.ts

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-05-06 14:09:35 -04:00
electron-roller[bot]
c4ac192aa4 chore: bump chromium to 138.0.7164.0 (main) (#46948)
* chore: bump chromium in DEPS to 138.0.7164.0

* 6508870: Add missing PermissionType mapping and remove default case.

https://chromium-review.googlesource.com/c/chromium/src/+/6508870

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-06 14:01:37 -04:00
Charles Kerr
8308ac29c8 refactor: pass gfx::ResizeEdge by value (#46935)
refactor: pass gfx::ResizeEdge by value

It is an enum class, so no reason to pass by reference
2025-05-06 11:57:53 -05:00
Shelley Vohr
206544cbc0 fix: crash on macOS dialog after window-all-closed (#46927)
fix: crash on dialog after window-all-closed
2025-05-06 07:47:50 -05:00
Shelley Vohr
a5ec3f7476 fix: allowed dialog file types with one filter (#46900) 2025-05-06 10:31:00 +02:00
Erick Zhao
be399f2fee docs: use correct heading level for API function (#46892) 2025-05-05 16:10:37 -05:00
electron-roller[bot]
b90de7d07e chore: bump chromium to 138.0.7160.0 (main) (#46915)
* chore: bump chromium in DEPS to 138.0.7158.0

* chore: bump chromium in DEPS to 138.0.7160.0

* 6509206: Move Keychain UI suppression code into apple_keychain.cc

https://chromium-review.googlesource.com/c/chromium/src/+/6509206

* 6489036: Fix DesktopDataControlsDialog for Glic

https://chromium-review.googlesource.com/c/chromium/src/+/6489036

* chore: fixup patch indices

* 6506662: Reland "NavigationThrottleRunner2: content::NavigationThrottleRegistry"

https://chromium-review.googlesource.com/c/chromium/src/+/6506662

* 6499811: [video pip] Add live caption dialog

https://chromium-review.googlesource.com/c/chromium/src/+/6499811

* 6487926: Add GetMaxImageDimension function to ScreenAI service API for OCR.

https://chromium-review.googlesource.com/c/chromium/src/+/6487926

* 6494942: [json] Activate stringify fast-path by default

https://chromium-review.googlesource.com/c/v8/v8/+/6494942

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-05 13:58:40 -04:00
Charles Kerr
9460300506 refactor: devirtualize NativeWindow methods (#46904)
* refactor: devirtualize NativeWindow::SetSize()

refactor: devirtualize NativeWindow::GetSize()

refactor: devirtualize NativeWindow::SetPosition()

refactor: devirtualize NativeWindow::GetPosition()

* refactor: devirtualize NativeWinodw::SetMinimumSize()

refactor: devirtualize NativeWinodw::GetMinimumSize()

refactor: devirtualize NativeWinodw::SetMaximumSize()

refactor: devirtualize NativeWinodw::GetMaximumSize()

* refactor: devirtualize NativeWindow::SetSheetOffset()

refactor: devirtualize NativeWindow::GetSheetOffsetX()

refactor: devirtualize NativeWindow::GetSheetOffsetY()

* refactor: devirtualize NativeWindow::GetContentMinimumSize()

refactor: devirtualize NativeWindow::GetContentMaximumSize()
2025-05-05 09:29:05 -05:00
Charles Kerr
3362db0655 refactor: remove some NativeWindow public API (#46919)
* refactor: make NativeWindow::titlebar_overlay_height_ private

* refactor: make NativeWindow::set_has_frame() protected

* refactor: remove NativeWindow::background_material()

It's only used once, in NativeWindow, so use |background_material_| directly.

* refactor: remove NativeWindow::vibrancy()

It's only used once, in a NativeWindow method, so use |vibrancy_| directly.

* refactor: unfriend api::BrowserView

It was added in Oct 2022 by 23d4a25 for access to protected NativeWindow
methods add_inspectable_view() and remove_inspectable_view().

That dependency was removed in Nov 2022 by 184ac2b, so BrowserView
doesn't need access to NativeWindow's private fields & methods anymore.

* refactor: make NativeWindow::ContentBoundsToWindowBounds() protected

refactor: make NativeWindow::WindowBoundsToContentBounds() protected
2025-05-05 09:28:49 -05:00
Charles Kerr
2e2776611f refactor: simplify NativeWindow::FullScreenTransitionState (#46918)
* refactor: make NativeWindow::fullscreen_transition_state_ private

* refactor: add NativeWindow::is_transitioning_fullscreen() helper

* refactor: remove unused NativeWindow::fullscreen_transition_state()

* refactor: replace NativeWindow::set_fullscreen_transition_state() with NativeWindow::set_is_transitioning_fullscreen()

refactor: remove unused NativeWindow::FullScreenTransitionState
2025-05-05 09:28:29 -05:00
Charles Kerr
1f4f1b4afc refactor: add NativeWindow::FromWidget() helper (#46917)
refactor: add NativeWindow::FromWidet() helper

refactor: make kElectronNativeWindowKey a protected field
2025-05-05 09:27:41 -05:00
electron-roller[bot]
cb445b3bbd chore: bump node to v22.15.0 (main) (#46742)
* chore: bump node in DEPS to v22.15.0

* inspector: fix GN build

https://github.com/nodejs/node/pull/56798

* test: search cctest files

https://github.com/nodejs/node/pull/56791

* crypto: fix missing OPENSSL_NO_ENGINE guard

https://github.com/nodejs/node/pull/57012

* test,crypto: make tests work for BoringSSL

https://github.com/nodejs/node/pull/57021

* module: use synchronous hooks for preparsing in import(cjs)

https://github.com/nodejs/node/pull/55698

* deps: update simdjson to 3.12.0

https://github.com/nodejs/node/pull/56874

* build: remove explicit linker call to libm on macOS

https://github.com/nodejs/node/pull/56901

* test: make eval snapshot comparison more flexible

https://github.com/nodejs/node/pull/57020

* src: allow embedder customization of OOMErrorHandler

https://github.com/nodejs/node/pull/57325

* src: do not pass nullptr to std::string ctor

https://github.com/nodejs/node/pull/57354

* src: lock the isolate properly in IsolateData destructor

https://github.com/nodejs/node/pull/57031

* chore: shrink --trace-atomics-wait patch

* chore: fixup patch indices

* build: fix GN build failure

https://github.com/nodejs/node/pull/57013

* crypto: expose security levels

https://github.com/nodejs/node/pull/56601

* zlib: add zstd support

https://github.com/nodejs/node/pull/52100

* test: move crypto related common utilities in common/crypto

https://github.com/nodejs/node/pull/56714

* cli: move --trace-atomics-wait to eol

https://github.com/nodejs/node/pull/52747

* test: disable test-https-client-renegotiation-limit

BoringSSL doesn't support caller-initiated renegotiation - see
https://source.chromium.org/chromium/chromium/src/+/main:third_party/boringssl/src/ssl/ssl_lib.cc;l=1627-1631

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-05-05 10:23:17 +02:00
Robo
91626a8eac fix: xdg portal version detection for file dialogs on linux (#46905)
* chore: use dbus thread for portal version detection

* Update shell/browser/ui/file_dialog_linux_portal.cc

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-05-05 16:57:20 +09:00
electron-roller[bot]
5390728cb7 chore: bump chromium to 138.0.7156.0 (main) (#46902)
* chore: bump chromium in DEPS to 138.0.7156.0

* chore: update patches

* chore: ICWYU

* Allow SecKeychain and SecItem implementations of AppleKeychain to coexist

https://chromium-review.googlesource.com/c/chromium/src/+/6444777

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-05-02 21:06:50 -04:00
Derek Cicerone
074b9344b5 fix: prevent log files being written to current directory on Windows (#44413)
* fix: prevent log files being written to current directory on Windows

* Update shell/common/logging.cc

Co-authored-by: Robo <hop2deep@gmail.com>

* chore: add test

* chore: update includes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6418805

* chore: address review feedback

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-05-02 16:27:29 -05:00
Charles Kerr
3faddd5ae2 refactor: move IsClosed() and IsClosable() tests into NativeWindow::Close() (#46888)
refactor: devirtualize NativeWindow::IsClosed()
2025-05-02 13:21:29 -05:00
Yuri
7153008bfa docs: clarified usage of createFromPath() (#46809)
* docs: clarified usage of createFromPath()

* Update docs/api/native-image.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-05-02 11:11:54 +02:00
Charles Kerr
f6b297a06a refactor: use base::ObserverList::Notify() (#46875)
* refactor: use ObserverList::Notify() in shell/browser/window_list.cc

* refactor: use ObserverList::Notify() in shell/browser/web_contents_zoom_controller.cc

* refactor: use ObserverList::Notify() in shell/browser/usb/usb_chooser_context.cc

* refactor: use ObserverList::Notify() in shell/browser/usb/electron_usb_delegate.cc

* refactor: use ObserverList::Notify() in shell/browser/ui/views/menu_delegate.cc

* refactor: use ObserverList::Notify() in shell/browser/ui/tray_icon.cc

* refactor: use ObserverList::Notify() in shell/browser/ui/electron_menu_model.cc

* refactor: use ObserverList::Notify() in shell/browser/serial/serial_chooser_context.cc

* refactor: use ObserverList::Notify() in shell/browser/native_window.cc

* refactor: use ObserverList::Notify() in shell/browser/serial/electron_serial_delegate.cc

* refactor: use ObserverList::Notify() in shell/browser/browser.cc

* refactor: use ObserverList::Notify() in shell/browser/api/electron_api_web_contents.cc

* refactor: use ObserverList::Notify() in shell/browser/hid/electron_hid_delegate.cc

* refactor: use ObserverList::Notify() in shell/browser/hid/hid_chooser_context.cc
2025-05-02 11:10:52 +02:00
Shelley Vohr
ede84fc327 feat: support dip <-> screen conversion on Linux X11 (#46211)
feat: support dip <-> screen conversion on Linux
2025-05-02 10:31:45 +02:00
electron-roller[bot]
2b07e6450c chore: bump chromium to 138.0.7154.0 (main) (#46872)
* chore: bump chromium in DEPS to 138.0.7152.0

* chore: update patches

* chore: bump chromium in DEPS to 138.0.7154.0

* chore: update patches

* ozone/wayland: Fix bookmark dropdown right click context menu

https://chromium-review.googlesource.com/c/chromium/src/+/6488801

* Use base::cstring_view in base::Environment

https://chromium-review.googlesource.com/c/chromium/src/+/6494292

* [A11yPerformance] Remove Add/Remove AXMode methods

https://chromium-review.googlesource.com/c/chromium/src/+/6418444

xref: https://chromium-review.googlesource.com/c/chromium/src/+/6383275

* build: update filenames.libcxx.gni

* Use base::cstring_view in base::Environment

https://chromium-review.googlesource.com/c/chromium/src/+/6494292

* Use getters to expose NativePixmapHandle from GpuMemoryBufferHandle

https://chromium-review.googlesource.com/c/chromium/src/+/6374406

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-05-01 23:53:40 -05:00
Keeley Hammond
63114e2b8e fix: revert macOS content protection logic refactor (#46886)
Revert "refactor: use upstream content protection logic on macOS (#46813)"

This reverts commit 34adb976b6.
2025-05-01 13:49:55 -07:00
Charles Kerr
df4564dc39 refactor: don't call deprecated WidgetDelegate API in NativeWindowViews (#46858)
* refactor: don't call RegisterDeleteDelegateCallback()

move NativeWindowViews' on-widget-delegate-destroyed callback logic to
the NativeWindowViews destructor.

Since NativeWindowViews subclasses from WidgetDelegate and |this| *is*
the delegate being destroyed, we can handle this more cleanly in
~NativeWindowViews() instead of in a separate callback.

* chore: remove NativeWindowViews from the grandfathered-classes-that-can-call-deprecated-views-behavior patch

* refactor: don't call RegisterDeleteDelegateCallback()

RegisterDeleteDelegateCallback() is private upstream API, so we
shouldn't be using it.

Move the on-widget-delegate-destroyed callback logic over to our methods
NativeWindowViews::OnWidgetDestroying() and
NativeWindowViews::OnWidgetDestroyed().
2025-05-01 12:07:20 -05:00
David Sanders
4f89c31956 refactor: add EmitDeprecationWarning helper (#46860)
* refactor: add EmitDeprecationWarning helper

Also switches EmitWarning to using Node's ProcessEmitWarningGeneric

* chore: use node namespace for function call
2025-04-30 13:48:35 -05:00
Charles Kerr
25d77fd1ce refactor: use WidgetDelegate's title property (#46849)
* refactor: use WidgetDelegate::SetTitle()

* Make NativeWindow::SetTitle() and NativeWindow::GetTitle() non-virtual.
  Use WidgetDelegate for their implementation.

* Add NativeWindow::OnTitleChanged(), a new protected virtual method to update
  subclasses (e.g. NativeWindowMac needs to redraw the button proxy).

* In NativeWindowMac, replace SetTitle() and GetTitle() with OnTitleChanged().

* In NativeWindowViews, replace SetTitle() and GetTitle() with OnTitleChanged().

* test: enable BrowserWindow.title tests on Linux

* test: add a test to confirm win.title changes when document.title is set in the renderer
2025-04-30 08:22:27 -07:00
electron-roller[bot]
d842d17ff3 chore: bump chromium to 137.0.7151.0 (main) (#46854)
* chore: bump chromium in DEPS to 137.0.7151.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-04-29 16:49:44 -04:00
dependabot[bot]
ecd745305e build(deps): bump actions/download-artifact from 4.2.1 to 4.3.0 (#46852)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 4.2.1 to 4.3.0.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](95815c38cf...d3f86a106a)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-version: 4.3.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-04-29 11:20:23 -04:00
Charles Kerr
2734088d20 fix: fix and enable accessibilitySupportEnabled tests (#46825)
* test: do not skip visibleOnAllWorkspaces tests on Windows

That feature is supported on Linux, so move the test from the
"window states (excluding Linux)" section into the
"window states" section.

* fix: nested it() calls in visibleOnAllWorkspaces specs

* test: enable accessibilitySupportEnabled tests

test: check both getters after calling each setter

fix: do not assume the default initial value of accessibilitySupportEnabled

* chore: remove redundant test case

* chore: disable accessibilitySupportEnabled tests on Linux
2025-04-28 23:52:26 -05:00
zoy
4641bc9619 fix: fullscreen fillet / recovery is incorrect (#46641)
* fix: fullscreen fillet / recovery is incorrect

Signed-off-by: ZOY\zoy-l <zoy-l@outlook.com>

* fix: maintain frameless consistency on windows 11

* fix: maintain frameless consistency on windows 11

* chore: modify the comments

---------

Signed-off-by: ZOY\zoy-l <zoy-l@outlook.com>
2025-04-28 16:54:08 -04:00
Charles Kerr
3f3c297c7a fix: enable some tests that were accidentally disabled (#46816)
* test: add platform test on visibleOnAllWorkspaces tests

visibleOnAllWorkspaces is not supported on Windows

* test: do not skip visibleOnAllWorkspaces tests on Windows

That feature is supported on Linux, so move the test from the
"window states (excluding Linux)" section into the
"window states" section.

* fix: nested it() calls in visibleOnAllWorkspaces specs

* chore: make the process.platform test simpler

* fix: tests that were not run in api-app-spec due to nested it()

* fix: tests that were not run in api-browser-window-spec due to nested it()

* chore: annotate disabled test

* fix: enable `autoHideMenuBar` tests on Linux and Windows (#46818)

* fix: enable autoHideMenuBar tests

* docs: mark autoHideMenuBar as supported on Linux, Windows
2025-04-28 12:32:57 -05:00
Bruno Pitrus
062d3a6168 fix: build error with enable_electron_extensions=false (#46812)
Fix build error with enable_electron_extensions=false

In file included from ../../base/allocator/partition_allocator/src/partition_alloc/pointers/raw_ptr_backup_ref_impl.h:13,
                 from ../../base/allocator/partition_allocator/src/partition_alloc/pointers/raw_ptr.h:50,
                 from ../../base/memory/raw_ptr.h:11,
                 from ../../base/memory/weak_ptr.h:82,
                 from ../../electron/shell/browser/usb/electron_usb_delegate.h:14,
                 from ../../electron/shell/browser/usb/electron_usb_delegate.cc:5:
../../base/allocator/partition_allocator/src/partition_alloc/partition_address_space.h:279:3: warning: multi-line comment [-Wcomment]
  279 |   //       \
      |   ^
../../base/allocator/partition_allocator/src/partition_alloc/partition_address_space.h:281:3: warning: multi-line comment [-Wcomment]
  281 |   //         \
      |   ^
In file included from /usr/include/c++/14/memory:78,
                 from ../../electron/shell/browser/usb/electron_usb_delegate.h:8:
/usr/include/c++/14/bits/unique_ptr.h: In instantiation of ‘void std::default_delete<_Tp>::operator()(_Tp*) const [with _Tp = device::mojom::UsbDeviceInfo]’:
/usr/include/c++/14/bits/unique_ptr.h:399:17:   required from ‘std::unique_ptr<_Tp, _Dp>::~unique_ptr() [with _Tp = device::mojom::UsbDeviceInfo; _Dp = std::default_delete<device::mojom::UsbDeviceInfo>]’
  399 |           get_deleter()(std::move(__ptr));
      |           ~~~~~~~~~~~~~^~~~~~~~~~~~~~~~~~
../../mojo/public/cpp/bindings/struct_ptr.h:48:3:   required from ‘constexpr void std::destroy_at(_Tp*) [with _Tp = mojo::StructPtr<device::mojom::UsbDeviceInfo>]’
   48 |   ~StructPtr() = default;
      |   ^
/usr/include/c++/14/bits/stl_construct.h:149:22:   required from ‘constexpr void std::_Destroy(_Tp*) [with _Tp = mojo::StructPtr<device::mojom::UsbDeviceInfo>]’
  149 |       std::destroy_at(__pointer);
      |       ~~~~~~~~~~~~~~~^~~~~~~~~~~
/usr/include/c++/14/bits/stl_construct.h:163:19:   required from ‘static constexpr void std::_Destroy_aux<<anonymous> >::__destroy(_ForwardIterator, _ForwardIterator) [with _ForwardIterator = mojo::StructPtr<device::mojom::UsbDeviceInfo>*; bool <anonymous> = false]’
  163 |             std::_Destroy(std::__addressof(*__first));
      |             ~~~~~~~~~~~~~^~~~~~~~~~~~~~~~~~~~~~~~~~~~
/usr/include/c++/14/bits/stl_construct.h:193:44:   required from ‘constexpr void std::_Destroy(_ForwardIterator, _ForwardIterator) [with _ForwardIterator = mojo::StructPtr<device::mojom::UsbDeviceInfo>*]’
  193 |         return std::_Destroy_aux<false>::__destroy(__first, __last);
      |                ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~^~~~~~~~~~~~~~~~~
/usr/include/c++/14/bits/alloc_traits.h:981:20:   required from ‘constexpr void std::_Destroy(_ForwardIterator, _ForwardIterator, allocator<_T2>&) [with _ForwardIterator = mojo::StructPtr<device::mojom::UsbDeviceInfo>*; _Tp = mojo::StructPtr<device::mojom::UsbDeviceInfo>]’
  981 |       std::_Destroy(__first, __last);
      |       ~~~~~~~~~~~~~^~~~~~~~~~~~~~~~~
/usr/include/c++/14/bits/stl_vector.h:735:15:   required from ‘constexpr std::vector<_Tp, _Alloc>::~vector() [with _Tp = mojo::StructPtr<device::mojom::UsbDeviceInfo>; _Alloc = std::allocator<mojo::StructPtr<device::mojom::UsbDeviceInfo> >]’
  735 |         std::_Destroy(this->_M_impl._M_start, this->_M_impl._M_finish,
      |         ~~~~~~~~~~~~~^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
  736 |                       _M_get_Tp_allocator());
      |                       ~~~~~~~~~~~~~~~~~~~~~~
../../electron/shell/browser/usb/electron_usb_delegate.cc:231:74:   required from here
  231 |     std::move(callback).Run(std::vector<device::mojom::UsbDeviceInfoPtr>());
      |                                                                          ^
/usr/include/c++/14/bits/unique_ptr.h:91:23: error: invalid application of ‘sizeof’ to incomplete type ‘device::mojom::UsbDeviceInfo’
   91 |         static_assert(sizeof(_Tp)>0,
      |                       ^~~~~~~~~~~
2025-04-28 11:56:17 -04:00
electron-roller[bot]
f2240e07f0 chore: bump chromium to 137.0.7149.0 (main) (#46777)
* chore: bump chromium in DEPS to 137.0.7144.0

* chore: bump chromium in DEPS to 137.0.7145.0

* chore: bump chromium in DEPS to 137.0.7147.0

* chore: update patches

* Remove deprecated GetVar(std::string_view, std::string*) overload

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6468873

* fixup! Remove deprecated GetVar(std::string_view, std::string*) overload

* fixup! Remove deprecated GetVar(std::string_view, std::string*) overload

* chore: bump chromium in DEPS to 137.0.7149.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-04-28 11:39:12 -04:00
David Sanders
0c103f390c test: refactor deprecate-helpers.ts to warning-helpers.ts (#46808)
Add a generic expectWarningMessages and start checking warning names
2025-04-28 11:18:34 -04:00
Charles Kerr
27f6adf8df fix: run visibleOnAllWorkspaces tests on the right platforms (#46815)
* test: add platform test on visibleOnAllWorkspaces tests

visibleOnAllWorkspaces is not supported on Windows

* test: do not skip visibleOnAllWorkspaces tests on Windows

That feature is supported on Linux, so move the test from the
"window states (excluding Linux)" section into the
"window states" section.

* fix: nested it() calls in visibleOnAllWorkspaces specs

* chore: make the process.platform test simpler
2025-04-28 10:34:00 -04:00
Shelley Vohr
b03c71213e refactor: use upstream content protection logic on macOS (#46780)
* refactor: use upstream content protection logic on macOS

* Update shell/browser/native_window.h

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-04-26 11:31:30 -05:00
Charles Kerr
c2ab63f6d7 refactor: use absl::InlinedVector in ToV8(ElectronPermissionManager) (#44854)
perf: use a stack-allocated string_view array in ToV8(USBProtectedClasses)
2025-04-25 16:11:15 -05:00
Calvin
b92c68b053 docs: call out breaking change for GTK 4 default on GNOME (#46793)
docs: add breaking change for GTK 4 default on GNOME
2025-04-25 13:31:28 -07:00
Charles Kerr
450b2d0ba3 refactor: remove public method BrowserWindow::GetWeakPtr() (#46763)
refactor: remove public method electron::api::BrowserWindow::GetWeakPtr()
2025-04-25 15:01:52 -05:00
Charles Kerr
b40b4dc015 refactor: use std::map::try_emplace() over std::map::insert() (#46761)
refactor: prefer std::map::try_emplace() over std::map::insert()
2025-04-25 13:11:53 -05:00
Evan Simkowitz
8fa7d324d1 fix: set XDG_CURRENT_DESKTOP env var back to original value before invoking xdg utils (#45310)
* Fix XDG_CURRENT_DESKTOP before invoking XDGUtil

* apply suggestion

* use existing XDG_CURRENT_DESKTOP const
2025-04-25 11:31:36 -05:00
Felix Rieseberg
7fa297a849 docs: Add ObjC/macOS tutorial (#46694) 2025-04-25 10:29:25 -05:00
John Kleinschmidt
55505ba4df docs: additional update of breaking changes for 36-x-y (#46781) 2025-04-25 11:28:33 -04:00
Shelley Vohr
372cdb5dee fix: bluetooth crash in select-bluetooth-device event (#46745)
fix: bluetooth crash on bluetooth off
2025-04-25 10:26:19 -05:00
Calvin
973e5d0249 build: update NMV to 136 for Electron 37 (#46764)
build: update NMV to 136 for Electron 36
2025-04-25 11:20:29 -04:00
Michaela Laurencin
0171f648b1 docs: correct breaking-changes.md for 36.0.0 release (#46762) 2025-04-25 16:10:35 +02:00
Charles Kerr
74c4ae0b55 refactor: use net::CanonicalCookie::IsDomainMatch() (#46748)
* refactor: use net::CanonicalCookie::IsDomainMatch()

Previously we had been rolling our own impl

* test: add pattern-matching tests for our cookie API
2025-04-25 16:08:16 +02:00
Charles Kerr
06a99d6770 refactor: make node Buffers more friendly to base::span / std::span (#46724)
* refactor: add electron::Buffer namespace; move the Buffer as_byte_span() into it

* feat: add electron::Buffer::Copy()

a span-friendly version of node::Buffer::Copy()

* refactor: use electron::Buffer::Copy() in electron_api_base_window.cc

* refactor: use electron::Buffer::Copy() in electron_api_data_pipe_holder.cc

* refactor: use electron::Buffer::Copy() in electron_api_safe_storage.cc

* refactor: use electron::Buffer::Copy() in electron_api_clipboard.cc

* refactor: use electron::Buffer::Copy() in osr_converter.cc

* refactor: use electron::Buffer::Copy() in electron_api_native_image.cc

* refactor: use electron::Buffer::Copy() in net_converter.cc

* refactor: use electron::Buffer::Copy() in electron_api_web_contents.cc

* refactor: make NewEmptyBuffer() return a Local<Value>
2025-04-25 08:00:09 -05:00
Shelley Vohr
1976e935e7 fix: missing HandleScope in RemoveFromParentChildWindows (#46758) 2025-04-25 14:04:25 +02:00
Calvin
51dbe69e45 fix: vibrancy window border (#46648)
* fix: vibrancy window border

* Use WidgetDelegate::OnWidgetInitialized instead
2025-04-25 11:42:48 +02:00
Calvin
08318dc05d fix: corner smoothing with 0 radii (#46751) 2025-04-25 10:54:04 +02:00
wujinli
3e78bbde6a fix: crash when renderer process crashes while webview is reloading (#46735)
WebView uses WebContentsViewChildFrame, which doesn't have a Focus impl
and triggers a fatal NOTREACHED.
2025-04-25 10:10:27 +02:00
electron-roller[bot]
37f8db15e9 chore: bump chromium to 137.0.7143.0 (main) (#46757)
* chore: bump chromium in DEPS to 137.0.7142.0

* chore: bump chromium in DEPS to 137.0.7143.0

* Add accelerator API to get shortcut vector representation

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6442193

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-04-25 14:53:51 +09:00
electron-roller[bot]
08b7a1f801 chore: bump chromium to 137.0.7141.0 (main) (#46725)
* chore: bump chromium in DEPS to 137.0.7139.0

* chore: bump chromium in DEPS to 137.0.7141.0

* chore: update patches

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6474596
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6443472
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6471184

* [ServiceWorker] Pipe is_for_service_worker into OverrideURLLoaderFactoryParams

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6459481

* Reland "[PermissionOptions] Use PermissionDescriptorPtr in PermissionControllerDelegate"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6455975

* clickiness: Check attestation and user settings on origins

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6356796

* extensions : Move ReloadExtension from ExtensionService

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6472812
Refs https://chromium-review.googlesource.com/c/chromium/src/+/6472777

* fixup! Update AppleKeychain API to be friendlier

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6443472

* chore: script/gen-libc++-filenames.js

* Rename ColorVariant::CovertToSkColor() to ColorVariant::ResolveToSkColor()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6373793

* [headless] Provide headless aware window metrics on Windows

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6374074

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-04-24 17:18:38 +09:00
Charles Kerr
e9f279afd1 chore: remove WebContents.getNativeView() (#46734)
chore: remove never-used WebContents.getNativeView().

This was added in https://github.com/electron/electron/pull/10308 but
was never used and never documented, not even as experimental API.
2025-04-23 20:33:50 -05:00
Charles Kerr
c7b0bdab7e fix: explicitly call GetNativeNSView() on macOS (#46733)
* fix: explicitly call GetNativeNSView() on macOS

* chore: move macOS impl to a .mm file

This is needed in order to access gfx::NativeView::GetNativeNSView()
2025-04-23 17:55:18 -05:00
Charles Kerr
686ae47696 refactor: remove redundant NativeImage::GetBitmap() (#46696)
* refactor: remove redundant NativeImage::GetBitmap()

* docs: mark NativeImage.getBitmap() as deprecated

* have getBitmap() emit a deprecation warning

* docs: update obsolete refefence to getBitmap()

* test: update obsolete refefences to getBitmap()

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-04-23 11:00:43 +02:00
electron-roller[bot]
dd03cceda0 chore: bump chromium to 137.0.7128.1 (main) (#46482)
* chore: bump chromium in DEPS to 137.0.7107.0

* chore: bump chromium in DEPS to 137.0.7109.0

* chore: bump chromium in DEPS to 137.0.7111.0

* chore: bump chromium in DEPS to 137.0.7113.0

* 6384240: Remove double-declaration for accessibility on macOS | https://chromium-review.googlesource.com/c/chromium/src/+/6384240

* 6422872: Remove unused includes in isolation_info_mojom_traits.h | https://chromium-review.googlesource.com/c/chromium/src/+/6422872

* chore: update patches

* 6400733: Avoid ipc_message_macros.h usage in some foo_param_traits_macros.h files | https://chromium-review.googlesource.com/c/chromium/src/+/6400733

* chore: update patches

* 6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

* chore: iwyu

* refactor: prefer value initialization over memset()

From the looks up upstream commits in base/, it looks like memset()
could trigger `-Wunsafe-buffer-usage` warnings soon?

Value initialization is more C++ish and less error-prone anyway,
due to memset()'s easily swappable parameters.

* refactor: NotifyIcon::InitIconData() returns a NOTIFYICONDATA

This follows F.20 in the C++ Core Guidelines and also removes the need
for memset()

* 6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

remove all uses of:

- strcmp()

* fixup!  6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

* 6433203: Add a PassKey to RegisterDeleteDelegateCallback(). | https://chromium-review.googlesource.com/c/chromium/src/+/6433203

* chore: bump chromium in DEPS to 137.0.7115.0

* 6387077: [PermissionOptions] Generalize PermissionRequestDescription | https://chromium-review.googlesource.com/c/chromium/src/+/6387077

* chore: update patches

* 6387077: [PermissionOptions] Generalize PermissionRequestDescription | https://chromium-review.googlesource.com/c/chromium/src/+/6387077

* fix: add pragma for MacSDK unsafe buffers | 6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

* chore: bump chromium in DEPS to 137.0.7117.0

* chore: update patches

* chore: update filesnames.libcxx.gni

* 6431756: Replace SetOwnedByWidget() bool arg with a PassKey. | https://chromium-review.googlesource.com/c/chromium/src/+/6431756

* 6387077: [PermissionOptions] Generalize PermissionRequestDescription | https://chromium-review.googlesource.com/c/chromium/src/+/6387077

* 6428345: Remove ExtensionService usage from ChromeExtensionRegistrarDelegate | https://chromium-review.googlesource.com/c/chromium/src/+/6428345

* 6384315: Migrate extensions_enabled from ExtensionService to Registrar | https://chromium-review.googlesource.com/c/chromium/src/+/6384315

* 6428749: [extensions] Refactor ExtensionService for AddNewAndUpdateExtension. | https://chromium-review.googlesource.com/c/chromium/src/+/6428749

* chore: bump chromium in DEPS to 137.0.7119.0

* 6440290: corner-shape: support inset shadow | https://chromium-review.googlesource.com/c/chromium/src/+/6440290

* 6429230: FSA: Move blocked paths to the PermissionContext class | https://chromium-review.googlesource.com/c/chromium/src/+/6429230

* chore: update patches

* chore: bump chromium in DEPS to 137.0.7121.0

* chore: update patches

* fix: partially revert 6443473: Remove ItemDelete from the Mac version of AppleKeychain | https://chromium-review.googlesource.com/c/chromium/src/+/6443473

* fix: update filenames.libcxx.gni

* chore: bump chromium in DEPS to 137.0.7123.0

* chore: update patches

* chore: "grandfather in" electron views too

Lock further access to View::set_owned_by_client() | https://chromium-review.googlesource.com/c/chromium/src/+/6448510

* chore: update feat_corner_smoothing_css_rule_and_blink_painting.patch

corner-shape: support inset shadow | https://chromium-review.googlesource.com/c/chromium/src/+/6440290

* refactor: grandfather in AutofillPopupView as a subclass of WidgetDelegateView

Add a PassKey for std::make_unique<WidgetDelegateView>() | https://chromium-review.googlesource.com/c/chromium/src/+/6442265

* Provide dbus appmenu information on Wayland | https://chromium-review.googlesource.com/c/chromium/src/+/6405535

* [extensions] Move OnExtensionInstalled out of ExtensionService. | https://chromium-review.googlesource.com/c/chromium/src/+/6443325

* refactor: grandfather in NativeWindowViews for delete callbacks

6433203: Add a PassKey to RegisterDeleteDelegateCallback(). | https://chromium-review.googlesource.com/c/chromium/src/+/6433203

* chore: merge the four "grandfather" patches into one

* [A11yPerformance] Remove IsAccessibilityAllowed() | 6404386: [A11yPerformance] Remove IsAccessibilityAllowed() | https://chromium-review.googlesource.com/c/chromium/src/+/6404386

NB: the changes here are copied from the upstream changes in
chrome/browser/ui/webui/accessibility/accessibility_ui.cc

* 6420753: [PermissionOptions] Use PermissionDescriptorPtr in PermissionController | https://chromium-review.googlesource.com/c/chromium/src/+/6420753

* 6429573: [accessibility] Move mode change out of AccessibilityNotificationWaiter | https://chromium-review.googlesource.com/c/chromium/src/+/6429573

* chore: e patches all

* 6419936: [win] Change ScreenWin public static methods to virtual | https://chromium-review.googlesource.com/c/chromium/src/+/6419936

* 6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

remove all uses of:

- fprintf()
- fputs()
- snprintf()
- vsnprintf()

* fix: size conversion FTBFS on Win

* 6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

remove all uses of:

- wcscpy_s()

* 6423410: Enable unsafe buffer warnings for chromium, try #3. | https://chromium-review.googlesource.com/c/chromium/src/+/6423410

remove all uses of:

- wcsncpy_s()

* chore: update mas_avoid_private_macos_api_usage.patch.patch

6394283: Remove double-declaration for accessibility on iOS | https://chromium-review.googlesource.com/c/chromium/src/+/6394283

Lots of context shear in this commit but the only interesting part is:

-+  return nullptr;
++  return {};

Which is needed because the return type is sometimes not a pointer.

* chore: e patches all

* chore: disable -Wmacro-redefined warning in electron_main_win.cc

* chore: bump chromium in DEPS to 137.0.7123.5

* refactor: patch electron PermissionTypes into blink

6387077: [PermissionOptions] Generalize PermissionRequestDescription | https://chromium-review.googlesource.com/c/chromium/src/+/6387077

* chore: e patches all

* chore: remove the box_painter_base.cc part of feat_corner_smoothing_css_rule_and_blink_painting.patch

as per code review @ https://github.com/electron/electron/pull/46482#pullrequestreview-2777338370

* test: enable window-smaller-than-64x64 test on Linux

* chore: bump chromium in DEPS to 137.0.7124.1

* chore: bump chromium in DEPS to 137.0.7125.1

* chore: bump chromium in DEPS to 137.0.7127.3

* 6459201: [Extensions] Remove ExtensionSystem::FinishDelayedInstallationIfReady() | https://chromium-review.googlesource.com/c/chromium/src/+/6459201

* 6454796: [Extensions] Move (most) registrar delayed install logic to //extensions | https://chromium-review.googlesource.com/c/chromium/src/+/6454796

* chore: bump chromium in DEPS to 137.0.7128.1

* chore: e patches all

* chore: node ./script/gen-libc++-filenames.js

* [views] Gate DesktopWindowTreeHostWin::window_enlargement_ behind flag

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6428649

* feat: allow opt-out animated_content_sampler.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6438681

* Trigger CI

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-04-22 15:53:29 -04:00
Kolja
d0e13cc262 fix: file dialog filters not working correctly (#46660) 2025-04-22 13:31:04 +02:00
Shelley Vohr
858a93f886 build: don't kill ssh sessions on checkout failure (#46708) 2025-04-22 13:30:27 +02:00
Michaela Laurencin
e383eaa465 fix: stop menu minimization if set false (#46279) 2025-04-22 10:58:30 +02:00
Milan Burda
274b148554 docs: cleanup docs/tutorial/custom-window-styles.md (#46597) 2025-04-22 10:23:35 +02:00
Charles Kerr
7083419361 refactor: make electron::api::BaseWindow fields private (#46689)
refactor: make electron::api::BaseWindow fields private
2025-04-22 10:19:11 +02:00
reito
ac2c0c76fe fix: osr stutter fix backport for electron. (#46650)
* fix: osr stutter fix backport for electron.

* nit: chromium upstream patch link
2025-04-22 10:18:21 +02:00
Michaela Laurencin
3ad87787f8 docs: update timelines for E37 (#46704) 2025-04-21 13:34:02 -07:00
Robo
ec8f7f185e fix: crash on reconversion with google IME and editcontext on macOS (#46688) 2025-04-21 09:49:14 +09:00
Calvin
f15fa56e38 refactor: reduce & remove no-op MicrotasksScope calls (#46681)
* fix: do not run microtasks in V8Serializer in browser process

* Remove no-op MicrotasksScope in `shell/browser/api/electron_api_auto_updater.cc`

This call was added in https://github.com/electron/electron/pull/40576 as an expansion of `gin_helper::EmitEvent`.

Since this only runs in the browser process and `bool ignore_browser_checkpoint = true` this code is a no-op.

Node should perform a microtask checkpoint if necessary in `node::MakeCallback`.

* Remove no-op MicrotasksScope in `shell/common/api/electron_bindings.cc`

This method is only called by the browser process. The containing function, `ElectronBindings::DidReceiveMemoryDump`, is only used in two places:

* `ElectronBindings::GetProcessMemoryInfo` in the same file, which has a `CHECK` that it's running in the browser process at the top.
* From `shell/browser/api/electron_api_web_contents.cc`, which is only run in the browser process.

Added a DCHECK for clarity and validation.

* Replace `gin_helper::MicrotasksScope` with `v8::MicrotasksScope` in `shell/renderer/`

The browser check is unnecessary in the renderer. Since `gin_helper::MicrotasksScope` will always act exactly like `v8::MicrotasksScope`, it's clear to just use the v8 object directly. This also brings them in line with the many other uses of `v8::MicrotasksScope` in `shell/renderer/`.
2025-04-19 12:18:03 -05:00
Charles Kerr
297c4297b1 perf: avoid triple map lookup in ElectronHidDelegate::GetContextObserver() (#46672)
perf: avoid triple map lookup in ElectronHidDelegate::GetContextObserver()
2025-04-19 10:51:52 -05:00
Calvin
3a982ecad5 fix: do not run microtasks in V8Serializer in browser process (#46668) 2025-04-19 11:43:02 +09:00
Charles Kerr
926a6ee8bd refactor: remove WebContentsPermissionHelper::PermissionTypes::KEYBOARD_LOCK (#46670)
refactor: remove electron::WebContentsPermissionHelper::PermissionTypes::KEYBOARD_LOCK

This was added in 344aba0. In the time when this PR initially went up and
when 344aba0 landed, upstream added blink::PermissionTypes::KEYBOARD_LOCK.
Our duplicate copy can be removed.
2025-04-18 16:14:45 -05:00
Shelley Vohr
437542767a fix: backgroundMaterial on initial activate (#46657)
* fix: backgroundMaterial on initial activate

Closes https://github.com/electron/electron/issues/38466

* Update patches/chromium/fix_activate_background_material_on_windows.patch

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-04-17 20:34:45 +02:00
Shelley Vohr
a29e1170b9 feat: support Web Serial & WebUSB blocklists (#46600) 2025-04-17 20:34:34 +02:00
Shelley Vohr
352a403efd fix: postMessage crash with invalid transferrable (#46639) 2025-04-17 15:09:48 +02:00
John Kleinschmidt
e8117f8e40 build: update build tools (#46656)
* build: update build tools

* chore: fix core.fscache

* chore: fix core.preloadindex

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-04-17 10:32:17 +02:00
Shelley Vohr
32fea719b3 refactor: migrate to non-deprecated allowedContentTypes on macOS (#46623)
refactor: migrated to non-deprecated allowedContentTypes on macOS
2025-04-15 09:51:34 -05:00
Shelley Vohr
14df4aab83 fix: window border on Gnome Wayland (#46624) 2025-04-15 15:45:33 +02:00
dependabot[bot]
24e46849c7 build(deps): bump actions/setup-node from 4.3.0 to 4.4.0 (#46636)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.3.0 to 4.4.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](cdca7365b2...49933ea528)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-version: 4.4.0
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-04-15 15:44:04 +02:00
Shelley Vohr
489d30edfb build: roll build-images (#46625) 2025-04-14 16:10:46 -04:00
Shelley Vohr
e748b521b2 test: fix node spec disabled tests (#46627) 2025-04-14 11:38:27 -04:00
Shelley Vohr
51bffb533e fix: paint and flash issues on macOS (#46615)
* fix: paint and flash issues on macOS

* Adhere to paintWhenInitiallyHidden
2025-04-14 16:29:07 +02:00
Shelley Vohr
62b5b5f99d fix: handle potential missing close event property (#46605)
fix: handle missing close event property
2025-04-11 13:07:26 -04:00
Keeley Hammond
a9b2ec514b fix: fallback to old MacOS context menu behavior if no frame is present (#46595)
* fix: fallback to old MacOS context menu behavior if no frame is present

Co-authored-by: georgexu99 <georgexu99@electronjs.org>
Co-authored-by: erickzhao <erickzhao@electronjs.org>
Co-authored-by: clavin <calvin@electronjs.org>

* docs: add additional option for focusedFrame

* fix: handle frame found, but no view update from rfh

* fix: fix conditional

Co-authored-by: Calvin <clavin@users.noreply.github.com>

---------

Co-authored-by: georgexu99 <georgexu99@electronjs.org>
Co-authored-by: erickzhao <erickzhao@electronjs.org>
Co-authored-by: clavin <calvin@electronjs.org>
Co-authored-by: Calvin <clavin@users.noreply.github.com>
2025-04-11 10:15:35 -04:00
Shelley Vohr
3064b24c9d refactor: use default printing path when no user options (#46587) 2025-04-11 10:14:29 -04:00
David Sanders
74d641c7b3 build: ignore files in .git when running markdownlint-cli2 (#46608) 2025-04-10 18:37:07 -05:00
Shelley Vohr
446d0769ed feat: expose nativeTheme.shouldUseDarkColorsForSystemIntegratedUI (#46438)
feat: expose shouldUseDarkColorsForSystemIntegratedUI

Closes https://github.com/electron/electron/issues/46429.
Refs https://github.com/electron/electron/pull/19735.

This PR adds a new API `shouldUseDarkColorsForSystemIntegratedUI` to the
`nativeTheme` module. This API returns a boolean indicating whether the
system is using dark colors for system integrated UI elements. This is
useful for applications that want to adapt their UI to match the system
theme, especially for those that use system integrated UI elements like
the shell theme or taskbar appearance.
2025-04-10 12:08:29 +02:00
Jemil Suleimanov
013133867b docs: unify documentation example and fiddle for IPC pattern-1 (#46517)
* docs: unify documentation examples and fiddle

* docs: remove changes in ipc documentation
2025-04-10 12:08:10 +02:00
Yuri
de407e82b7 docs: updated tray doc with tooltip removing (#46515)
added tooltip removing doc
2025-04-09 11:50:08 -04:00
Charles Kerr
c6e6a03a24 fix: NativeWindow.window_id() returns same value for all windows (#46562)
fix: NativeWindow.window_id() returns same value for all windows
2025-04-09 10:45:06 -05:00
Shelley Vohr
c1c74b0a6c fix: re-enable OOP printing on Linux (#46529) 2025-04-09 15:42:16 +02:00
Shelley Vohr
45a0494287 fix: remove obsoleted --inspect-brk logic (#46560)
fix: remove obsoleted --inspect-brk logic
2025-04-09 15:35:40 +02:00
Shelley Vohr
521108e2a5 fix: crash on parent window close and focur/blur (#46559) 2025-04-09 15:35:30 +02:00
dependabot[bot]
93a51cc756 build(deps): bump github/codeql-action from 3.28.13 to 3.28.15 (#46554)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.13 to 3.28.15.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](1b549b9259...45775bd823)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-version: 3.28.15
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-04-09 10:36:38 +02:00
Charles Kerr
ab23758e51 refactor: use v8::True(isolate) and v8::False(isolate) (#46544) 2025-04-08 12:58:39 -05:00
Charles Kerr
9069542d0b refactor: remove unnecessary const_cast (#46543)
refactor: remove unnecessary const_cast

unnecessary since July 2019 in 50b9c70
2025-04-08 12:58:28 -05:00
Charles Kerr
636cbc19ac refactor: simplify some BaseWindow JS getters (#46542)
* refactor: return a std::array<int 2> from BaseWindow::GetMaximumSize()

* refactor: return a std::array<int 2> from BaseWindow::GetMinimumSize()

* refactor: return a std::array<int 2> from BaseWindow::GetPosition()

* refactor: return a std::array<int 2> from BaseWindow::GetSize()

* refactor: return a std::array<int 2> from BaseWindow::GetContentSize()

* refactor: extract helper method ToArray(const gfx::Size)

* refactor: #include correctness
2025-04-08 10:58:12 -05:00
Shelley Vohr
1a6de10da8 fix: assert.ok in the renderer process (#46528)
fix: assert.ok in the renderer process
2025-04-08 07:09:54 -05:00
Charles Kerr
b1731407bc refactor: make TrackableObjectBase::weak_map_id_ const (#46524)
refactor: make TrackableObjectBase::weak_map_id_ const

simplify declaration and initialization
2025-04-07 20:49:05 -05:00
Charles Kerr
4bb7a4ceb0 refactor: make api::View methods const, private (#46545)
* refactor: make api::View::GetBounds() const

* refactor: make api::View::OnViewBoundsChanged() private

refactor: make api::View::OnViewIsDeleting() private

refactor: make api::View::OnChildViewRemoved() private

* refactor: make ChildPair private
2025-04-07 16:23:36 -05:00
Shelley Vohr
e22b83abf2 build: update codespaces config (#46533) 2025-04-07 16:29:33 -04:00
Niklas Wenzel
bbc9d1cdc1 build: emphasize the need for a testcase in our issue template (#46447) 2025-04-07 10:50:59 -07:00
Charles Kerr
85dce12be3 refactor: migrate to View::AddChildView(std::unique_ptr<ui::View*>) (#46474)
* refactor: use AddChildView(std::unique_ptr<View>) in OpaqueFrameView::CreateButton()

Xref: https://issues.chromium.org/issues/40485510

* refactor: use AddChildView(std::unique_ptr<View>) in MenuBar::RebuildChildren()

* refactor: use AddChildView(std::unique_ptr<View>) for ClientFrameViewLinux labels

* refactor: use AddChildView(std::unique_ptr<View>) for ClientFrameViewLinux buttons

* refactor: use AddChildView(std::unique_ptr<View>) in AutofillPopupView

* refactor: use AddChildViewRaw() to flag the edge cases that we still need to fix

* chore: use west coast const for consistency
2025-04-07 09:20:46 -05:00
Charles Kerr
a6875c732c docs: note that titleBarOverlay.symbolColor is supported on Linux (#46492)
docs: note that titleBarOverlay.symbolColor is supported on Linux

this is supported via OpaqueFrameView
2025-04-07 11:10:54 +02:00
Charles Kerr
c0fdf09f28 perf: on Windows, make Archive::HeaderIntegrity() faster (#46509)
* perf: do not clone the map each time we call Archive::HeaderIntegrity()

* perf: use absl::flat_hash_map for the integrity cache

* perf: do not clone the JSON payload string

* perf: preallocate capacity for the integrity cache

* perf: use move variant of insert_or_assign()

* refactor: simplify integrity cache building

remove unnecessary std::optional<>

* refactor: use base::FindOrNull()

* refactor: remove unused #includes

* refactor: make variable types explicit

* fix: make res_size unsigned

* refactor: put GetIntegrityConfigCache() in an unnamed namespace

refator: put LoadIntegrityConfig() in an unnamed namespace

* fix: oops, missing rel_path_utf8 key

* fix: oops, fix Wunreachable-code-return
2025-04-07 11:10:29 +02:00
Charles Kerr
41d8f90d68 refactor: use base::flat_set in WebContents::DidUpdateFaviconUrl() (#46475)
* refactor: add gin::Converter<std::span>::ToV8()

* feat: add ToV8(const base::flat_set<T>&)

* perf: use a flat_set in WebContents::TitleWasSet()

* refactor: add gin::Converter<std::array>::ToV8()
2025-04-07 10:16:02 +02:00
Charles Kerr
3c5c9c8e19 perf: avoid redundant virtual method call in NativeWindowViews::SetEnabledInternal() (#46508)
perf: avoid redundant virtual method call in NativeWindowViews::SetEnabledInternal()

Why waste time make lot call when few call do trick?
2025-04-06 19:02:04 -07:00
Hailey
ac18decc56 revert: allow NSMenuItems to be disabled (#46502)
Revert "fix: allow NSMenuItems to be disabled (#46307)"

This reverts commit ac616ef41d.
2025-04-06 20:42:05 -05:00
Charles Kerr
052da50aeb refactor: remove unused electron::api::App::FileIconCallback (#46490)
refactor: remove electron::api::App::FileIconCallback

last use removed in 2018 by 3f15f516
2025-04-05 00:39:17 -05:00
Charles Kerr
4e33d1690d refactor: instantiate navigation_entries local variable on the stack (#46453)
* refactor: instantiate navigation_entries on the stack instead of the heap

* refactor: reserve the full size of navigation_entries

* refactor: use emplace_back to simplify the code a little
2025-04-04 16:55:27 -05:00
Shelley Vohr
c2ae4afb8f fix: destroy parent port backend when JS env exits (#46437)
* fix: destroy parent port backend when JS env exits

* fix: close parent port before destroying

---------

Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-04-04 11:02:54 -05:00
Felix Rieseberg
e81e3acd2d docs: Add C++/Win32 tutorial (#46160)
* docs: Add C++/Win32 tutorial

* Update docs/tutorial/native-code-and-electron-cpp-win32.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/tutorial/native-code-and-electron-cpp-win32.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/tutorial/native-code-and-electron-cpp-win32.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/tutorial/native-code-and-electron-cpp-win32.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/tutorial/native-code-and-electron-cpp-win32.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* docs: make linter happy

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-04-04 08:00:45 -05:00
electron-roller[bot]
9c019b6147 chore: bump chromium to 136.0.7095.0 (main) (#46118)
* chore: bump chromium in DEPS to 136.0.7076.0

* chore: bump chromium in DEPS to 136.0.7077.0

* 6368856: Migrate absl variant.h and utility.h in content (part 2/2) | https://chromium-review.googlesource.com/c/chromium/src/+/6368856

* 6356528: Clean up LegacyRenderWidgetHostHWND code | https://chromium-review.googlesource.com/c/chromium/src/+/6356528

* chore: export patches

* 6339113: [Viewport Segments] Add CDP commands to override Viewport Segments without overriding other device properties. | https://chromium-review.googlesource.com/c/chromium/src/+/6339113

* 6352169: [DevTools][MultiInstance] Support new tab in another window on Android | https://chromium-review.googlesource.com/c/chromium/src/+/6352169

* 6368856: Migrate absl variant.h and utility.h in content (part 2/2) | https://chromium-review.googlesource.com/c/chromium/src/+/6368856

* 6360858:Clickiness: Wire response from URLLoader to DB, add e2e tests| https://chromium-review.googlesource.com/c/chromium/src/+/6360858

* chore: bump chromium in DEPS to 136.0.7079.0

* chore: export patches

* chore: bump chromium in DEPS to 136.0.7081.0

* chore: export patches

* chore: bump chromium in DEPS to 136.0.7083.0

* 6361987: Remove double-declaration with gfx::NativeView and gfx::NativeWindow | https://chromium-review.googlesource.com/c/chromium/src/+/6361987

* chore: export patches

* chore: bump chromium in DEPS to 136.0.7087.0

* chore: export patches

* fix: include node patch for missing AtomicsWaitEvent
https://chromium-review.googlesource.com/c/chromium/src/+/6385540

* build: add depot_tools python to path

* fix: cppgc init and unregistering v8 isolate

https://chromium-review.googlesource.com/c/v8/v8/+/6333562

CppGc is now initialized earlier so Node can skip reinitializing it.

Additionally, gin::IsolateHandle was attempting to destruct an already destructed
v8::Isolate upon electron::JavaScriptEnvironment destruction. By removing the call
to NodePlatform::UnregisterIsolate, this fixes the crash on app shutdown.

* fix: unregister isolate after destruction

See code comment.

* chore: bump chromium in DEPS to 136.0.7095.0

* chore: sync patches

* fix: add script_parsing::ContentScriptType parameter
https://chromium-review.googlesource.com/c/chromium/src/+/6298395

* fix: migrate content::BrowserAccessibilityState methods
https://chromium-review.googlesource.com/c/chromium/src/+/6401437
https://chromium-review.googlesource.com/c/chromium/src/+/6383275

* feat: enableHappyEyeballs option for host resolver
https://chromium-review.googlesource.com/c/chromium/src/+/6332599

* fix: add new cookie exclusion reason
https://chromium-review.googlesource.com/c/chromium/src/+/6343479

* fix: add new url loader method
https://chromium-review.googlesource.com/c/chromium/src/+/6337340

* fix: add new cppgc header file for electron_node headers
https://chromium-review.googlesource.com/c/v8/v8/+/6348644

* fix: disable CREL on Linux ARM64
https://chromium-review.googlesource.com/q/I3a62f02f564f07be63173b0773b4ecaffbe939b9

* fixup! fix: add new cppgc header file for electron_node headers https://chromium-review.googlesource.com/c/v8/v8/+/6348644

* chore: update corner smoothing patch

* fixup! chore: update corner smoothing patch

* chore: disable NAN weak tests

These two tests are incompatible with a V8 change that disallows running JS code from a weak finalizer callback.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/4733273

* test: fix task starvation in node test

A V8 change makes these contexts get collected in a task that is posted
and run asynchronously. The tests were synchronously GC'ing in an
infinite loop, preventing the task loop from running the task that would
GC these contexts.

This change should be upstreamed in some way.

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/4733273

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
2025-04-03 19:02:49 -05:00
Charles Kerr
0a5da83a1b perf: avoid redundant map lookup in HidChooserContext::DeviceChanged() (#46451)
perf: avoid redundant map lookup in HidChooserContext::DeviceChanged()
2025-04-03 17:51:37 -05:00
Fedor Indutny
7601af5200 fix: don't copy 'package.json's out of ASAR file (#46390)
New Node.js module resolution system reads `package.json` from imported
modules by reading from the file natively in C++ without calling into
`fs.readFileSync`. The ASAR FS wrapper code had copied files out into a
temporary folder as a workaround, but it is inefficient and does not
cover all module resolution mechanisms in Node.js.

In this change we expose `overrideReadFileSync` method on the `modules`
binding in Node.js, and use this override to call into ASAR-supporting
`fs.readFileSync`.
2025-04-03 13:39:53 -07:00
yangllu
e46b0c8ddc fix: gin_helper::Promise in GPUInfoManager must be destroyed before destroying Node/V8 (#46434)
* fix: gin_helper::Promise in GPUInfoManager must be destroyed before destroying Node/V8

* fix: use CleanedUpAtExit to control the lifetime of GPUInfoManager
2025-04-03 10:12:12 -07:00
Samuel Attard
0e3246e20d fix: ensure maximize is emitted when reduce motion is enabled on macOS (#46459)
* fix: ensure maximize is emitted when reduce motion is enabled on macOS

* Revert "build: reenable graphics effects for macOS tests (#46454)"

This reverts commit 682ea345ac.
2025-04-03 11:14:16 -05:00
Charles Kerr
0ff98810ba fix: NativeWindowViews::GetRestoredState() can return wrong state when maximized (#46450)
fix: NativeWindowViews::GetRestoredState() returning wrong state

Introduced by the af58931 Chromium 131.0.6744.0 roll, specifically
https://github.com/electron/electron/pull/43948/commits/9840662#diff-f9d7ef7

98406626
2025-04-03 08:55:04 -05:00
Shelley Vohr
f48680a983 fix: zlib pointer alignment (#46435)
fix: fix zlib pointer alignment
2025-04-03 09:35:38 -04:00
Niklas Wenzel
682ea345ac build: reenable graphics effects for macOS tests (#46454) 2025-04-02 21:33:12 -05:00
Charles Kerr
a21c805ece perf: avoid redundant call to virtual methods GetProcess() and GetID() (#46409) 2025-04-02 11:57:09 -05:00
Charles Kerr
6f24dbaab4 perf: prefer absl::flat_hash_set over std::set when sorted order is not needed (#46410)
* perf: use an absl::flat_hash_set for UsbChooserContext::ephemeral_devices_

* perf: use an absl::flat_hash_set for GlobalMenuBarRegistrarX11::live_windows_

* perf: use an absl::flat_hash_set for NativeWindowViews::forwarding_windows_

* perf: use an absl::flat_hash_set for OffScreenRenderWidgetHostView::guest_host_views_

perf: use an absl::flat_hash_set for OffScreenRenderWidgetHostView::proxy_views_

* perf: use an absl::flat_hash_set for NativeWindow::injected_frames_

* perf: use an absl::flat_hash_set for NativeWindow::background_throttling_sources_
2025-04-02 11:03:36 -05:00
Charles Kerr
36e233797c perf: cache the return value of IsX11() (#46391)
* perf: cache the return value of IsX11()

* fix: mark as nodiscard for those who call, but mark as maybe_unused for Windows
2025-04-01 15:28:01 -05:00
Shelley Vohr
c02e5bc72c build: make it clearer when cookie auth runs (#46406) 2025-04-01 10:44:51 -07:00
Charles Kerr
5499c800a7 perf: avoid redundant map lookup in UsbChooserContext::OnDeviceRemoved() (#46387) 2025-04-01 12:39:34 -05:00
Charles Kerr
0492f0f745 perf: have ErrorThrower lazily lookup the current isolate (#46388)
perf: have ErrorThrower lazy-lookup the current isolate

ErrorThrower's default constructor is marked as "should rarely if ever
be used" because it's expensive to call.

Unfortunately, nearly every instance of ErrorThrower comes as an argument
in gin_helper's JS-->C++ function marshalling where a thrower is
default-constructed and then populated in gin_helper::GetNextArgument()
with an assignment operator to a temporary ErrorThrower constructed
with the gin::Arguments' isolate.

tldr: most of the time we use the slow constructor first, then throw
that work away unused by overwriting with a fast-constructed one.

This refactor avoids that cost by deferring the expensive work to
`ErrorThrower::isolate()`, where it happens only as a fallback iff
isolate_ hasn't been set.
2025-04-01 12:25:27 -05:00
Charles Kerr
ac1ffb1bff fix: leaked gfx::Canvas in AutofillPopupView::OnPaint() (#46384)
* perf: avoid redundant call to popup_bounds_in_view()

* refactor: use a std::optional<> for paint_canvas local

* fix: fix leaked gfx::Canvas in AutofillPopupView::OnPaint()

* refactor: remove redundant get() call when testing smart pointer for nonempty

* refactor: remove unnecessary draw_canvas variable

* refactor: rename bitmap to offscreen_bitmap for symmetry

* refactor: avoid another redundant call to popup_bounds_in_view()
2025-04-01 11:22:26 -05:00
Charles Kerr
5a6f1ede6a feat!: remove support for ProtocolResponse.session null value (#46264)
BREAKING CHANGE

This was deprecated in f7ba0d3b & is now being removed for Electron 37.
2025-04-01 08:52:12 -05:00
zoy
0e687d3082 fix: rounded corners disappear momentarily on window close (#46382)
fix: Explicitly set rounded corners in borderless mode on Windows 11

Signed-off-by: zoy <zoy-l@outlook.com>
2025-04-01 15:43:54 +02:00
Calvin
08da2b0b07 chore: move build files to build/ dir (#46368) 2025-04-01 13:42:14 +02:00
Shelley Vohr
9c4720766d fix: UtilityProcess.fork crash before app ready (#46380)
fix: UtilityProcess.fork crash before app ready
2025-04-01 13:42:03 +02:00
Shelley Vohr
5da75c4a97 feat: support system-context-menu on Linux (#45848)
feat: support system-context-menu on Linux
2025-04-01 11:00:39 +02:00
Charles Kerr
77833eddfb perf: avoid unnecessary vector copy in GetMimeTypeToExtensionIdMap() (#46373)
* perf: avoid making an unnecessary copy of the vector

MimeTypesHandler::GetMIMETypeAllowlist() returns a const&, so we can
iterate that directly instead of making a temporary copy of it.

* perf: move the call to ExtensionRegistry::Get() outside of the loop

Also, keep the previous behavior of not calling it at all if there
aren't any whitelisted extensions.

* perf: avoid redundant map lookup

* refactor: const correctness

* refactor: cleanup
2025-03-31 21:52:49 -05:00
Calvin
1730062c8f fix: flicker and ghosting in transparent windows on macOS (#46353)
* fix: transparent flicker on MAS

* Gate condition on `IsTranslucent` instead
2025-03-31 18:12:35 -05:00
Calvin
09135443a0 feat: Corner Smoothing CSS rule (Reland) (#46278)
* feat: Corner Smoothing CSS rule (Reland)

Reland of #45185

* Fix patch conflicts

* fixup! Fix patch conflicts

* Update expected image

The dashed border is subtly different. The new version is correct and the old one was incorrect.
2025-03-31 11:22:23 -05:00
Charles Kerr
fcd836e34f refactor: remove field unused weak_factory_ (#46363)
refactor: remove unused weak_factory_

Appears to have been added in e3f61b46 but never used
2025-03-31 10:39:21 +02:00
Charles Kerr
28fd7c5a17 perf: improve temporaries in WebWorkerObserver::WorkerScriptReadyForEvaluation() (#46347)
refactor: small refactor to WebWorkerObserver::WorkerScriptReadyForEvaluation()

- replace a std::vector<std::string> local with a compile-time array
  of std::string_view
- remove .c_str() pessimization when making v8 Strings from string_views
2025-03-30 23:21:39 -05:00
Charles Kerr
ae6930030a perf: prefer absl::flat_hash_set over std::unordered_set (#46348)
* perf: use absl::flat_hash_set in SpellCheckClient::SpellCheckText()

* perf: use absl::flat_hash_set in MessagePort::DisentanglePorts()
2025-03-30 23:21:18 -05:00
Charles Kerr
2fa4fb0da9 refactor: use v8::String::Empty() when creating empty strings (#46349)
refactor: use v8::String::Empty() when creating empty strings
2025-03-30 21:14:18 -05:00
Charles Kerr
bf93427cbb perf: avoid double map lookup in HidChooserContext::DeviceRemoved() (#46343) 2025-03-28 21:34:24 -05:00
Charles Kerr
72fc65d2c5 perf: avoid 3x call to GetID() in RegisterPendingSiteInstance() (#46339)
perf: avoid 3x call to GetID() in RegisterPendingSiteInstance()
2025-03-28 21:33:45 -05:00
Charles Kerr
2baa4a3514 perf: avoid a double-map lookup in NotificationPresenter::RemoveNotification() (#46338)
perf: avoid a double-map lokup in NotificationPresenter::RemoveNotification()
2025-03-28 21:33:11 -05:00
Samuel Attard
49aba471dc feat: add support for associating a Menu with a WebFrameMain (#45138)
* feat: add support for associating a Menu with a WebFrameMain

This allows certain OS level features to activate such as Writing Tools, Autofill.. and Services.

There appears to be a bug in macOS where the responder chain isn't traversed if the menu is not popped up using an event, as such we spoof a fake mouse event at the write coordinates in the right window and use that to open the menu.

* build: fix build on non-mac

* build: oops missed a header

* fix: safely handle optional T* by checking nullptr too

* build: fix gn check and build errors

* docs: suggested changes

* feat: default `frame` to `window.webContents.mainFrame` when possible

* fix: avoid deref nullptr view

* Revert "feat: default `frame` to `window.webContents.mainFrame` when possible"

This reverts commit 2e88836819.

* fix: lint

* Remove redundant scoped objects

This code, including the comments, matches almost exactly the behavior of this argument to the function.

* Add ScopedPumpMessagesInPrivateModes patch

* More null pointer safety

---------

Co-authored-by: clavin <clavin@electronjs.org>
2025-03-28 11:50:07 -07:00
Charles Kerr
46b108e9a4 perf: avoid redundant map lookups in GetStorageMask() (#46315)
* perf: avoid a redundant map lookuop in GetStorageMask()

* perf: avoid a redundant map lookup in GetDataTypeMask()
2025-03-28 00:25:25 -05:00
Hailey
ac616ef41d fix: allow NSMenuItems to be disabled (#46307)
* fix: disable NSMenu autoenable feature to allow disabling of NSMenuItems

* style: fix linter issues and update comments

* chore: remove unneeded comment
2025-03-27 17:43:46 -07:00
Charles Kerr
e09712f0e1 perf: avoid a triple-redundant map lookup in ViewsDelegate::GetAppbarAutohideEdges() (#46306)
perf: avoid a triple-redundant map lookup in ViewsDelegate::GetAppbarAutohideEdges()
2025-03-27 14:32:27 -05:00
Charles Kerr
35c90fd807 perf: avoid double map lookup in WebFrameMain::UpdateRenderFrameHost() (#46293)
perf: avoid double map lookup in WebFrameMain::UpdateRenderFrameHost()
2025-03-27 14:32:01 -05:00
Shelley Vohr
756423e81e build: validate Chromium cookie authentication (#46274) 2025-03-27 14:29:01 -05:00
Shelley Vohr
dc61a6ab80 fix: possible crash in shell.readShortcutLink (#46294)
fix: possible crash in shell.readShortcutLink
2025-03-27 14:27:32 -05:00
Shelley Vohr
a0c859fc4f build: roll build-images SHAs (#46291) 2025-03-27 10:39:02 +01:00
Shelley Vohr
17e38230d5 fix: crash when drag-dropping some files (#46253)
* fix: crash when drag-dropping some files

* fix: extra destination context scope
2025-03-26 17:17:23 -05:00
Charles Kerr
3ae285b614 perf: avoid std::map temporaries in WebContents::DevToolsRequestFileSystems() (#46268)
* perf: move the GetDevToolsWebContents() call outside of the loop

* perf: remove std::map temporary in WebContents::DevToolsRequestFileSystems()

* refactor: remove unused GetAddedFileSystemPaths()

* perf: remove std::vector temporary in WebContents::DevToolsRequestFileSystems()
2025-03-26 16:26:56 -05:00
Shelley Vohr
3212f60d69 fix: set userAgent on navigationHistory.restore() (#46260)
fix: set userAgent on navigationHistory restore
2025-03-26 10:59:19 -05:00
Charles Kerr
a5076a663b perf: avoid redundant map lookup in WebContents::DevToolsIndexPath() (#46254)
perf: avoid double map lookup in WebContents::DevToolsIndexPath()
2025-03-26 10:30:02 -05:00
Shelley Vohr
d2c2261c58 fix: hard crash on invalid command line switches (#46004)
* fix: hard crash on invalid command line switch

* Update docs/api/command-line.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

* chore: feedback from review

* docs: Add breaking change note

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-03-26 08:14:03 -05:00
Charles Kerr
8412d78310 perf: avoid redundant map lookup in AddComponentResourceEntries() (#46255)
* perf: avoid double map lookup in ElectronComponentExtensionResourceManager::AddComponentResourceEntries()

* perf: move the path key when calling try_emplace()
2025-03-26 08:12:16 -05:00
Charles Kerr
48a38c0289 fix: build failure when printing is disabled (#46283)
fix: ftbfs when printing is disabled
2025-03-26 10:04:39 +01:00
Charles Kerr
6e44662f15 perf: avoid redundant map lookup in WebFrameMain constructor (#46238)
perf: avoid double map lookup in WebFrameMain constructor
2025-03-25 16:53:24 -05:00
Charles Kerr
c8d3184a95 refactor: migrate hashing code to new upstream crypto::hash API (#46237)
* refactor: migrate AsarFileValidator to crypto::hash

This change migrates AsarFileValidator's uses of crypto::secure_hash
to the new crypto::hash API, which has more memory safety and less
heap allocations.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6287609

* refactor: migrate ValidateIntegrityOrDie to crypto::hash

This change migrates ValidateIntegrityOrDie's use of crypto::SHA256Hash
to the new crypto::hash API, which has more memory safety and less heap
allocations.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6287609
2025-03-25 15:01:17 -05:00
dependabot[bot]
bb0ddcad27 build(deps): bump actions/setup-node from 4.2.0 to 4.3.0 (#46092)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.2.0 to 4.3.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](1d0ff469b7...cdca7365b2)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-03-25 13:29:22 -05:00
John Kleinschmidt
4eda76de36 build: fixup windows source cache for release (#46236)
* build: fixup windows source cache for release

* build: fixup ffmpeg gn gen

* build: add build-tools depot_tools to PATH

There are some cases where it is still expected that depot_tools be in the path

* put back regular gn gen for ffmpeg

* build: add retry to moving source cache

This resolves the error: `Move-Item : The process cannot access the file because it is being used by another process.`
2025-03-25 14:24:58 -04:00
Charles Kerr
ced8fdbce8 perf: avoid std::map temporaries in IsDevToolsFileSystemAdded() (#46230)
* refactor: extract-method GetAddedFileSystems()

* refactor: use GetAddedFileSystems() in GetAddedFileSystemPaths()

* refactor: use GetAddedFileSystems() in IsDevToolsFileSystemAdded()
2025-03-25 11:42:58 -05:00
Charles Kerr
f7ba0d3b4b docs: deprecate setting ProtocolResponse.session to null (#46131)
* docs: deprecate setting ProtocolResponse.session to null

* docs: mark null ProtocolResponse.session as deprecated in struct docs

* Update docs/breaking-changes.md

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2025-03-25 10:04:21 -05:00
Charles Kerr
4f4e23a3b3 perf: avoid redundant map lookups in GlobalShortcut (#46229)
* perf: avoid redundant map lookup in GlobalShortcut::OnKeyPressed()

* perf: avoid redundant map lookup in GlobalShortcut::ExecuteCommand()
2025-03-25 09:46:03 -05:00
Shelley Vohr
1d6cb348b4 fix: webContents.printToPDF() with cross-process subframes (#46218)
fix: webContents.printToPDF() with cross-process subframes
2025-03-25 08:16:47 -05:00
dependabot[bot]
8e856dfdb8 build(deps): bump github/codeql-action from 3.28.11 to 3.28.13 (#46240)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.11 to 3.28.13.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](6bb031afdd...1b549b9259)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-03-25 12:21:23 +01:00
John Beutner
cf82c3215f perf: don't wait for thumbnails if they were not requested on macOS (#46138)
When using the SCK thumbnail capturer, the first refresh has the list of
sources, and the second refresh has the thumbnails. If thumbnails are
not needed, only wait for the first refresh.
2025-03-25 12:20:38 +01:00
Robo
307d4f94c7 fix: oob string read when parsing node_options (#46210)
* fix: oob string read when parsing node_options

* chore: re-enable test

* fix: missing linux server env for tests
2025-03-25 19:33:10 +09:00
dependabot[bot]
cfada0347e build(deps): bump actions/download-artifact from 4.1.9 to 4.2.1 (#46239) 2025-03-25 08:47:33 +01:00
dependabot[bot]
7cb921369b build(deps): bump actions/upload-artifact from 4.6.1 to 4.6.2 (#46241) 2025-03-25 08:46:18 +01:00
Robo
a86e44b176 fix: NODE_OPTIONS parsing for child processes on macOS (#46209)
* fix: NODE_OPTIONS parsing for child processes on macOS

* chore: temporarily disable test

* chore: apply review feedback

* chore: fix build
2025-03-25 13:01:37 +09:00
Calvin
abaef13c0b fix: Revert "feat: Corner Smoothing CSS rule" (#46231)
Revert "feat: Corner Smoothing CSS rule (#45185)"

This reverts commit b75e802280.
2025-03-24 20:36:49 +01:00
John Beutner
cfd64b5f89 fix: handle OnDelegatedSourceListDismissed asynchronously (#46112)
This fixes a crash with the PipeWire capturer caused by a Chromium
change introduced in
https://chromium-review.googlesource.com/c/chromium/src/+/5783826.

DesktopMediaListBase now calls Refresh(true) after dispatching
DesktopMediaListObserver::OnDelegatedSourceListDismissed, so it's
important not to call DesktopCapturer::HandleFailure (which deallocates
the DesktopMediaList) synchronously from OnDelegatedSourceListDismissed.
2025-03-24 20:09:11 +01:00
John Kleinschmidt
cbcd779610 build: fixup release builds (#46228) 2025-03-24 14:34:57 -04:00
Calvin
b75e802280 feat: Corner Smoothing CSS rule (#45185)
* feat: Corner Smoothing

* Patch Blink to add CSS rule and Painting

* Add `system-ui` keyword

* Add `cornerSmoothingCSS` web preference

* Add tests

* Documentation

* fixup! Documentation

* fix: initialize smoothness value

* Use a 1.0 scale factor in tests

* Fix tests for CI

* Fix tests

* fixup! Merge branch 'main' into clavin/corner-smoothing

* Add code docs

* Document `system-ui` keyword values

* Address review comments

* fixup! Address review comments

* Address review comments

* Update patch to address upstream changes

The patch went from 694 lines to 505 lines, which is a 27.2% smaller!

* fixup! Update patch to address upstream changes
2025-03-24 11:46:12 -04:00
Shelley Vohr
9ec14b91e7 feat: add BrowserWindow.isSnapped() (#46079)
* feat: add BrowserWindow.isSnapped() on Windows

* docs: mark _Readonly_
2025-03-24 12:09:14 +01:00
Shelley Vohr
47cf4e7bfd fix: Wayland resizing border (#46155)
* fix: Wayland resizing border

Closes https://github.com/electron/electron/issues/44543
Refs CL:5180720

Fixes an issue where the resizing border didn't work as expected on Wayland windows.

* fix: border insets when fullscreen
2025-03-24 12:08:24 +01:00
Charles Kerr
b8150f33db refactor: remove unused weak_factory_ in electron_management_api_delegate.cc (#46200)
refactor: remove unused weak_factory_

Appears to have been added in 3745b76da but never used
2025-03-24 12:07:49 +01:00
Charles Kerr
02a4bd5942 refactor: remove unused method ProxyingWebSocket::web_request_api() (#46201)
Appears to have been added in c608d6d7 but never used
2025-03-24 10:09:24 +01:00
Charles Kerr
7ed4f0ca27 perf: use absl::flat_hash_map instead of std::unordered_map (#46202)
* perf: make ElectronUsbDelegate::controller_map_ an absl::flat_hash_map

* perf: make ElectronSerialDelegate::controller_map_ an absl::flat_hash_map

* perf: make ElectronHidDelegate::controller_map_ an absl::flat_hash_map

* perf: make FrameTreeNodeIdMap an absl::flat_hash_map

* perf: make AutofillDriverFactory::driver_map_ an absl::flat_hash_map

* perf: make asar::Archive::external_files_ an absl::flat_hash_map

* perf: make VersionIdMap an absl::flat_hash_map

* perf: make ObjectCache::proxy_map_ an absl::flat_hash_map

* docs: add TODO to investigate absl map in KeyWeakMap
2025-03-24 10:09:14 +01:00
Shelley Vohr
964090d086 fix: ensure TraverseParent bails on resource path exit (#46100)
* fix: ensure TraverseParent bails on resource path exit

* Address review changes
2025-03-24 10:06:59 +01:00
Erik Moura
e9082ea57a docs: fix capitalization for InputEvent.modifiers (#46130) 2025-03-23 16:38:15 -05:00
Charles Kerr
5623c96dd7 refactor: remove unused field ServiceWorkerMain::weak_factory_ (#46171)
refactor: remove unused field ServiceWorkerMain::weak_factory_

Added in a467d06, appears to have never been used
2025-03-23 10:14:45 +01:00
Charles Kerr
3fd35abe98 refactor: remove unused method ElectronBrowserContext::GetWeakPtr() (#46170)
* refactor: use forward declaration of MediaDeviceIDSalt in electron_browser_context.h

* refactor: remove unused #include from browser_context.h

* refactor: remove unused ElectronBrowserContext::GetWeakPtr()

last use removed in Aug 2020 by bac2f46
2025-03-22 10:15:15 -05:00
Charles Kerr
a81e11d9de refactor: use = default to define trivial destructors (#46165)
refactor: use '= default' to define trivial destructors
2025-03-21 16:15:34 -05:00
John Kleinschmidt
db47267be4 build: Use windows src cache (#45881)
build: use source cache on windows
2025-03-21 14:45:08 -04:00
Charles Kerr
6723bfbe32 refactor: reduce coupling in electron::api::Protocol (#46122)
* refactor: decouple api::Protocol from ElectronBrowserContext

now they do not know about each other

* refactor: make electron::api::ProtocolError private

* refactor: remove unused isolate arg in Protocol constructor

* refactor: use =default for trivial destructor
2025-03-21 07:33:25 -05:00
Shelley Vohr
603057b198 fix: remove File.path from types (#46005) 2025-03-21 08:40:49 +01:00
Shelley Vohr
9ccc63d682 fix: add missing cpp_heap to Node.js worker CreateParams (#46104) 2025-03-21 08:40:28 +01:00
LZL
4d7161f36e feat: add ffmpeg.dll to delay load configuration (#46151)
feat: set ffmpeg.dll as a delay-loaded DLL

Updated the /DELAYLOAD linker config in BUILD.gn to set ffmpeg.dll
as a delay-loaded DLL. This reduces startup overhead and prevents unnecessary
loading when ffmpeg-related functionality is not used (e.g., the browser process
was unnecessarily loading it).
2025-03-21 16:24:34 +09:00
Shelley Vohr
32141eacfb refactor: use upstream Widget::IsVisibleOnAllWorkspaces() (#45887)
* refactor: use upstream Widget::IsVisibleOnAllWorkspaces()

* chore: add to breaking changes
2025-03-20 23:43:47 -05:00
Charles Kerr
1b5db9989e refactor: make URLPipeLoader private (#46113)
Move the URLPipeLoader class into an anonymous namespace in
electron_url_loader_factory.cc.
2025-03-20 15:47:47 -05:00
Charles Kerr
46967ca9c9 refactor: Add ElectronBrowserContext::BrowserContexts() (#46089)
* refactor: add ElectronBrowserContext::BrowserContexts()

* refactor: use ElectronBrowserContext::BrowserContexts() in ElectronBrowserMainParts::PostMainMessageLoopRun()

* refactor: use ElectronBrowserContext::BrowserContexts() in ElectronExtensionsBrowserClient::IsValidContext()

* refactor: use ElectronBrowserContext::BrowserContexts() in ElectronExtensionsBrowserClient::BroadcastEventToRenderers()

* refactor: move PartitionKey, BrowserContextMap private

* refactor: add ElectronBrowserContext::IsValidContext()

decouple ElectronExtensionsBrowserClient from the internals of ElectronBrowserContext
2025-03-20 11:17:26 -05:00
Charles Kerr
273baf4ec2 refactor: use base::NumberToString() (#46141)
base::NumberToString() is slightly more efficient than
absl::StrFormat("%u").
2025-03-20 10:13:28 +01:00
Charles Kerr
c4800d9934 refactor: remove ToV8(isolate, const char*) (#46108) 2025-03-20 10:04:50 +01:00
Shelley Vohr
86cc9f626f fix: APNS token ids are lowercase ASCII (#46101) 2025-03-20 07:57:50 +01:00
Shelley Vohr
09a3bcf0f0 fix: webContents.print() crash on Linux (#46087) 2025-03-20 06:41:00 +01:00
Shelley Vohr
bf64967b68 build: combine pipewire patches (#46129) 2025-03-19 23:26:06 -05:00
Niklas Wenzel
bf1d377e08 docs: use optional chaining for app.dock (#46119)
docs: use optional chaining for app.dock
2025-03-19 18:34:03 -05:00
Shelley Vohr
d424c3aee7 test: disable parallel/test-worker-resource-limits (#46105)
test: disable parallel/test-worker-resource-limits
2025-03-19 22:03:26 +01:00
Niklas Wenzel
e4d660af86 docs: fix code example in breaking-changes.md (#46093) 2025-03-19 11:20:22 +01:00
Shelley Vohr
2efd75e2ca build: fail for out of date patches on forks (#46080) 2025-03-19 10:05:51 +01:00
electron-roller[bot]
b13f05e2dc chore: bump chromium to 136.0.7067.0 (main) (#46018)
* chore: bump chromium in DEPS to 136.0.7066.0

* chore: bump chromium in DEPS to 136.0.7067.0

* 6325710: [LNA] Add Local Network Access permission type

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6325710

* 6342514: Create frame mojo endpoints in renderer during window.open()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6342514

* 6344040: Create widget mojo endpoints in renderer process for window.open()

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6344040

* chore: update patches

* 6349218: Move ExtensionService::install_directory() to ExtensionRegistrar

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6349218

* 6349395: Move ExtensionService::extensions_enabled() to ExtensionRegistrar

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6349395

* 6331510: Migrate views::Background class to ui::ColorVariant | https://chromium-review.googlesource.com/c/chromium/src/+/6331510

* build: reorder set-cookie step https://github.com/electron/electron/pull/46091

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: alice <alice@makenotion.com>
2025-03-18 19:20:54 -04:00
Shelley Vohr
dcbab692c0 test: fix app.dock for corrected type (#46110)
test: fix app.dock for corrected type
2025-03-18 17:44:39 -04:00
Niklas Wenzel
71f3ff6bf2 docs: fix types of app.dock (#46073) 2025-03-18 13:14:08 +01:00
Alice Zhao
ff0a14a7c6 build: move set chromium cookie before build tools step (#46091)
build: move set cookie before build tools
2025-03-18 10:07:05 +01:00
Charles Kerr
4bf99c9bea refactor: add ElectronBrowserContext::GetDefaultBrowserContext() (#46065)
* refactor: add ElectronBrowserContext::DestroyAllContexts()

Simpler semantics than previous implementation; also hides the
"default context must be destroyed last" implementation detail.

* refactor: add ElectronBrowserContext::GetDefaultBrowserContext()

clearer semantics than everyone calling From("", false)
2025-03-17 08:43:23 -05:00
Charles Kerr
9513486bf3 refactor: use GetDefaultStoragePartition() instead of GetStoragePartition(nullptr) (#46064)
refactor: use GetDefaultStoragePartition()

Use GetDefaultStorageParition() instead of GetStoragePartition(nullptr)

- It improves code uniformity, since we use get-default everywhere else
- It's more readable
- It's marginally faster, since GetStoragePartition() has more steps

Added in 49b0a1bf4a
2025-03-17 08:39:55 -05:00
Charles Kerr
bea7d618f1 fix: warning in file picker UI (#46067) 2025-03-16 20:49:15 -05:00
Charles Kerr
4ad20ccb39 chore: e patches all (#46068) 2025-03-16 14:04:01 -05:00
Charles Kerr
73a017577e perf: avoid redundant map lookup in ElectronBrowserContext::From() (#46044)
perf: avoid redundant map lookup in ElectronBrowserContext::FromPath()
2025-03-15 09:51:20 -05:00
Shelley Vohr
2d8a547692 build: fix compound bash conditional in patchup (#46047) 2025-03-15 09:57:59 +01:00
Charles Kerr
5f0603ed28 fix: ElectronBrowserContext raw_ptr bug + remove dead code (#46030)
refactor: remove unused ElectronBrowserContext::extension_system()

Last use removed on Jul 21, 2020 by 2fb14f5 in PR #24575

This fixes a raw_ptr warning by letting us remove the raw_ptr field
`ElectronBrowserContext::extension_system_`.
2025-03-14 23:35:10 -05:00
Sam Maddock
afca4e271e feat: ServiceWorkerMain.scriptURL (#45863)
feat: serviceWorker.scriptURL
2025-03-14 21:00:13 -04:00
Charles Kerr
30d2fadb28 refactor: replace base::StringPrintf() calls with absl::StrFormat() (#46024)
The former is now a pass-through for the latter and is slated for removal

Xref: https://issues.chromium.org/issues/40241565

https://chromium-review.googlesource.com/c/chromium/src/+/4907781
2025-03-14 17:14:32 -05:00
Charles Kerr
3271b82094 refactor: remove unused system header includes (#46015)
* chore: remove unused #include <string>

* chore: remove unused #include <optional>

* chore: remove unused #include <vector>

* chore: remove unused #include <string_view>

* chore: remove unused #include <memory>

* chore: remove unused #include <utility>

* chore: remove unused #include <tuple>

* chore: remove unused #include <unordered_set>

* chore: remove unused #include <functional>

* chore: iwyu <set>

* chore: iwyu <map>
2025-03-14 10:59:15 -05:00
Shelley Vohr
c0e180758b fix: don't crash Utility Processes on unhandled rejections (#45921)
* fix: don't crash on unhandled rejections

* Update docs/breaking-changes.md

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2025-03-14 09:09:02 -05:00
Shelley Vohr
5817d27429 fix: take Snapped status into account when showing a window (#46006) 2025-03-14 09:07:27 -05:00
Michaela Laurencin
4812b4e6c2 fix: prevent title change for within page navigation (#45981)
* fix: prevent title change for on page navigation

* add back and forward testing

* update Chromium comment

* remove errant script tag
2025-03-14 12:10:23 +01:00
Shelley Vohr
7c0b7b417b fix: emit context-menu event in Windows draggable regions (#45851)
fix: emit context-menu event in Windows draggable regions
2025-03-14 10:29:29 +01:00
Charles Kerr
785fe5f3b6 refactor: make a variadic gin_helper::internal::InvokeFactory() (#45988)
refactor: make a variadic gin_helper::internal::InvokeFactory()
2025-03-13 17:24:49 -05:00
Shelley Vohr
502a6b0166 build: roll sysroots again (#46016) 2025-03-13 16:28:53 -05:00
Shelley Vohr
4a28e60e89 fix: package import existence verification (#45997) 2025-03-13 14:51:43 -05:00
Shelley Vohr
a90d50e13f fix: don't crash Web Workers on unhandled rejections (#45992) 2025-03-13 13:09:23 -05:00
electron-roller[bot]
962d8b325a chore: bump chromium to 136.0.7064.0 (main) (#45985)
* chore: bump chromium in DEPS to 136.0.7063.0

* chore: bump chromium in DEPS to 136.0.7064.0

* 6169919: Instantiate Linux (or CrOS) system fonts using Fontations

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6169919

* 6341209: Remove file-wide unsafe buffer suppression from content/ [1 of N].

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6341209

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-03-13 12:02:06 -05:00
Charles Kerr
c813bc2a92 refactor: use private inheritance from mojo::MessageReceiver (#45973)
* refactor: make UtilityProcessWrapper inherit privately from mojo::MessageReceiver

* refactor: make ParentPort inherit privately from mojo::MessageReceiver

* refactor: make MessagePort inherit privately from mojo::MessageReceiver
2025-03-12 19:06:41 +01:00
Shelley Vohr
5ce41bac8d fix: system-context-menu should only fire in draggable regions (#45893)
fix: system-context-menu should only fire in draggable regions
2025-03-12 13:47:58 +01:00
David Sanders
6bc7bde229 ci: don't fail branch created workflow if previous board not found (#45986) 2025-03-12 09:27:40 +01:00
electron-roller[bot]
2de8fd7d93 chore: bump chromium to 136.0.7062.0 (main) (#45957)
* chore: bump chromium in DEPS to 136.0.7059.0

* chore: bump chromium in DEPS to 136.0.7060.0

* chore: bump chromium in DEPS to 136.0.7062.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-03-11 17:44:08 -04:00
Shelley Vohr
dcd319cfbe build: roll sysroots to pick up glibc fix (#45974) 2025-03-11 17:31:48 -04:00
Shelley Vohr
cd56b96544 refactor: remove usage of V8's {Attach|Detach}CppHeap() (#45922)
* refactor: remove usage of V8's {Attach|Detach}CppHeap()

* chore: remove revert patch
2025-03-11 18:54:33 +01:00
Charles Kerr
22262c14f1 test: fix timing issue in utilityProcess test fixtures (#45964)
* fix: potential timing issue in utilityProcess test

* fix: potential timing issue in utilityProcess esm test
2025-03-11 17:41:42 +01:00
dependabot[bot]
6e056709be build(deps): bump github/codeql-action from 3.28.10 to 3.28.11 (#45970)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.10 to 3.28.11.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b56ba49b26...6bb031afdd)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-03-11 10:44:00 -05:00
dependabot[bot]
2f63b20acf build(deps): bump dsanders11/project-actions from 1.5.2 to 1.7.0 (#45969)
Bumps [dsanders11/project-actions](https://github.com/dsanders11/project-actions) from 1.5.2 to 1.7.0.
- [Release notes](https://github.com/dsanders11/project-actions/releases)
- [Changelog](https://github.com/dsanders11/project-actions/blob/main/.releaserc.json)
- [Commits](7fc3c5441a...2134fe7cc7)

---
updated-dependencies:
- dependency-name: dsanders11/project-actions
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-03-11 10:43:46 -05:00
Felix Rieseberg
eb126eecb0 docs: Add 'Native Code and Electron' (#45882)
* docs: Add 'Native Code and Electron'

* docs: Add node-gyp requirements

* Update docs/tutorial/native-code-and-electron.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Cross-platform clean command

* Mention napi-rs

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Fix lint, fix more comments

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-03-10 13:45:33 -07:00
Shelley Vohr
4e1a915f1a build: remove patches merged upstream (#45963) 2025-03-10 20:00:28 +01:00
Charles Kerr
f2b09ff0bd fix: remove redundant MediaCaptureDevicesDispatcher::GetInstance() call (#45929)
fix: remove redundant MediaCaptureDevicesDispatcher::GetInstance() call

This appears to be a copy-paste error introduced in 465dee2c
2025-03-10 09:44:24 -05:00
electron-roller[bot]
b0c11371e0 chore: bump chromium to 136.0.7058.1 (main) (#45928)
* chore: bump chromium in DEPS to 136.0.7056.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

no manual changes; patch applied with fuzz

* chore: update fix_adapt_exclusive_access_for_electron_needs.patch

patch applied manually due to context shear

6319958: [FS] Replace GURL with url::Origin for Excluisve Access Bubble | https://chromium-review.googlesource.com/c/chromium/src/+/6319958

* chore: update feat_allow_usage_of_sccontentsharingpicker_on_supported_platforms.patch

no manual changes; patch applied with fuzz

6311876: Expose captured surface resolution for MacOS | https://chromium-review.googlesource.com/c/chromium/src/+/6311876

* chore: e patches all

* 6319958: [FS] Replace GURL with url::Origin for Excluisve Access Bubble | https://chromium-review.googlesource.com/c/chromium/src/+/6319958

* 6326673: views: Delete the single-parameter Widget::InitParams constructor. | https://chromium-review.googlesource.com/c/chromium/src/+/6326673

* https://chromium-review.googlesource.com/c/chromium/src/+/6331102

* 6331102: [A11yPerformance] Rename AXMode::kScreenReader to kExtendedProperties | https://chromium-review.googlesource.com/c/chromium/src/+/6331102

Sync with shell/browser/ui/webui/accessibility_ui.cc to
upstream chrome/browser/accessibility/accessibility_ui.cc
changes in 4af8657

* chore: bump Chromium 136.0.7058.1 (#45933)

chore: bump chromium in DEPS to 136.0.7058.1

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-03-10 00:30:34 -05:00
Samuel Attard
9b2e7db469 chore: cherry-pick 9dacf5694dfd from chromium (#45936) 2025-03-09 16:26:06 -07:00
Samuel Attard
f04c06a0db chore: cherry-pick 521faebc8a7c from chromium (#45941) 2025-03-09 16:23:04 -07:00
Charles Kerr
8ac061ebe7 fix: race condition in utilityProcess tests (#45926) 2025-03-09 17:37:35 -05:00
Milan Burda
b30f31e1f6 refactor: eliminate duplicate code in spec/api-process-spec.ts (#45927) 2025-03-09 17:37:14 -05:00
Charles Kerr
288ef37b1d perf: prefer base::SplitStringPiece() over base::SplitString() (#45924)
* perf: use base::SplitStringPiece() in SetNodeOptions()

* perf: use base::SplitStringPiece() in StringToAccelerator()

* refactor: StringToAccelerator() now takes a std::string_view
2025-03-09 17:36:13 -05:00
electron-roller[bot]
20414f66ca chore!: bump chromium to 136.0.7054.0 (main) (#45923)
* chore: bump chromium in DEPS to 136.0.7054.0

* chore: update allow_in-process_windows_to_have_different_web_prefs.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5906158

patch applied manually due to context shear

* chore: e patches all

* refactor!: Session.clearStorageData(syncable)

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6309405

Remove syncable type from opts.quota in Session.clearStorageData(opts)
because it that category has been removed upstream.

BREAKING CHANGE: Removed ses.clearDataStorage({ quota: 'syncable' })

* docs: deprecate Session.clearDataStorage({ quota })

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-03-07 17:49:21 -06:00
electron-roller[bot]
458b14b8ed chore: bump chromium to 136.0.7053.1 (main) (#45906)
* chore: bump chromium in DEPS to 136.0.7052.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

https://chromium-review.googlesource.com/c/chromium/src/+/6318359

patch applied manually due to context shear

* chore: update preconnect_manager.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6318420

patch applied manually due to context shear

* chore: e patches all

* chore: bump chromium to 136.0.7053.1

* chore: update fix_remove_profiles_from_spellcheck_service.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6326575

patch applied manually due to context shear

* chore: e patches all

* chore: revert removal of v8 API used by Node.js

* devtools: Remove DevToolsUIBindings::SendJsonRequest() | https://chromium-review.googlesource.com/c/chromium/src/+/6326236

* 6244461: Merge //content/common/user_agent.cc into //components/embedder_support:user_agent | https://chromium-review.googlesource.com/c/chromium/src/+/6244461

* 6313744: Migrate views::Background factory methods to ColorVariant | https://chromium-review.googlesource.com/c/chromium/src/+/6313744

* 6314545: Remove multiple argument support from base::ToString() | https://chromium-review.googlesource.com/c/chromium/src/+/6314545

* 6317362: [Extensions] Inline MessagingDelegate::CreateReceiverForTab() | https://chromium-review.googlesource.com/c/chromium/src/+/6317362

* 6308998: Add SettingAccess structured metrics event for DevTools | https://chromium-review.googlesource.com/c/chromium/src/+/6308998

* 6295214: Remove redundant state field in per-extension preferences | https://chromium-review.googlesource.com/c/chromium/src/+/6295214

NB: this change is copied from the upstream change to extensions/shell/browser/shell_extension_loader.cc

* fix: ui/ linter error

This is showing up in an eslint build step in Electron:

> /__w/electron/electron/src/out/Default/gen/ui/webui/resources/cr_elements/preprocessed/cr_menu_selector/cr_menu_selector.ts
>   77:23  error  This assertion is unnecessary since the receiver accepts the original type of the expression  @typescript-eslint/no-unnecessary-type-assertion
>
> ✖ 1 problem (1 error, 0 warnings)
>   1 error and 0 warnings potentially fixable with the `--fix` option.

However, removing the assertion causes a typescript build failure:

> gen/ui/webui/resources/cr_elements/preprocessed/cr_menu_selector/cr_menu_selector.ts:77:23 - error TS2345: Argument of type 'HTMLElement | null' is not assignable to parameter of type 'HTMLElement'.
>   Type 'null' is not assignable to type 'HTMLElement'.
>
> 77         items.indexOf(this.querySelector<HTMLElement>(':focus'));
>                          ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

So I think the two different steps may be picking up typescript definitions.

This patch should be removed after the issue is tracked down
and fixed in a followup task.

* fix: -Wnonnull warning

Fixes this warning:

> 2025-03-07T01:05:01.8637705Z ../../third_party/electron_node/src/debug_utils.cc(257,12): error: null passed to a callee that requires a non-null argument [-Werror,-Wnonnull]
> 2025-03-07T01:05:01.8638267Z   257 |     return nullptr;
> 2025-03-07T01:05:01.8638481Z       |            ^~~~~~~
> 2025-03-07T01:05:01.8638700Z 1 error generated.

Not sure why this warning was never triggered before; `git blame`
indicates this code hasn't changed in ages:

> c40a8273ef2 (Michaël Zasso    2024-05-10 09:50:20 +0200 255) #endif  // DEBUG
> 8e2d33f1562 (Anna Henningsen  2018-06-07 16:54:29 +0200 256)     }
> 247b5130595 (Refael Ackermann 2018-10-22 15:07:00 -0400 257)     return nullptr;
> 247b5130595 (Refael Ackermann 2018-10-22 15:07:00 -0400 258)   }

Presumably this is failing in this Chromium roll due to a
clang version bump.

We should remove this patch after upstreaming it.

* docs: add upstream pr link for Node patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2025-03-07 11:35:59 -06:00
Robo
530ccfe350 fix: resolve font list in default prefernce values (#45905)
* fix: resolve font list in default prefernce values

* chore: fix unsafe buffer usage

* docs: add code comment
2025-03-07 18:22:03 +09:00
Robo
041ada1586 build: match upstream with unsafe buffer paths (#45853)
* build: match upstream with unsafe buffer paths

* Don't assume STL iterators are pointers

Refs https://issues.chromium.org/issues/328308661

* chore: spanify process_singleton_win.cc
2025-03-06 16:04:18 -05:00
yangllu
d987bee007 fix: javascript heap OOM is not raised (#45895)
fix: javascript heap oom is not raised in node::OOMErrorHandler

node::OOMErrorHandler terminates the process directly without raising an
oom exception. To fix it, set an oom handler into node from electron.
2025-03-06 17:34:19 +01:00
Erick Zhao
431a791a99 chore: emphasize documentation style guide (#45639)
docs: emphasize documentation style guide
2025-03-06 17:17:06 +01:00
dependabot[bot]
9441cf4627 build(deps): bump dsanders11/project-actions from 1.5.1 to 1.5.2 (#45901)
Bumps [dsanders11/project-actions](https://github.com/dsanders11/project-actions) from 1.5.1 to 1.5.2.
- [Release notes](https://github.com/dsanders11/project-actions/releases)
- [Changelog](https://github.com/dsanders11/project-actions/blob/main/.releaserc.json)
- [Commits](9c80cd31f5...7fc3c5441a)

---
updated-dependencies:
- dependency-name: dsanders11/project-actions
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-03-06 16:38:31 +01:00
Charles Kerr
bb1c3dff21 chore: bump chromium to 135.0.7049.7 (main) (#45900)
chore: bump chromium in DEPS to 135.0.7049.7
2025-03-05 16:36:52 -05:00
electron-roller[bot]
49a27cba6b chore: bump chromium to 135.0.7049.5 (main) (#45898)
chore: bump chromium in DEPS to 135.0.7049.5

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-03-05 09:47:38 -06:00
Shelley Vohr
99c943df23 fix: setContentProtection(true) after hide on Windows (#45868)
fix: content protection after hide on Windows

https://chromium-review.googlesource.com/c/chromium/src/+/5789117
2025-03-04 16:39:59 -05:00
Sam Maddock
8c11764800 feat: WebContents.focusedFrame (#45667)
feat: webContents.focusedFrame
2025-03-04 11:38:58 -05:00
electron-roller[bot]
54136042c6 chore: bump chromium to 135.0.7049.0 (main) (#45885)
* chore: bump chromium in DEPS to 135.0.7049.0

* 6312439: Revert "Preconnect to the Glic FRE when the button is hovered."

https://chromium-review.googlesource.com/c/chromium/src/+/6312439

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-03-04 11:20:25 -05:00
dependabot[bot]
28ed8a821a build(deps): bump actions/download-artifact from 4.1.8 to 4.1.9 (#45883)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 4.1.8 to 4.1.9.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](fa0a91b85d...cc20338598)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-03-04 12:44:46 +01:00
Niklas Wenzel
ec9b589402 ci: preserve blocked/* labels on collaborator comments (#45877)
ci: keep `blocked/*` labels on collaborator comments
2025-03-04 10:49:14 +01:00
marekharanczyk
2a7133b7a6 fix: correct electron gin embedder indices (#45389)
fix: correct gin embedder indices.

Move electron extra embedders to the end of the enum so they do not
interfere with chromium embedders indices.
Also use kEmbedderBlinkTag directly in its index calculation without
adding extra indices from other tags.
2025-03-03 17:03:54 -05:00
electron-roller[bot]
64158114aa chore: bump chromium to 135.0.7047.0 (main) (#45873)
chore: bump chromium in DEPS to 135.0.7047.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-03-03 19:15:23 +01:00
electron-roller[bot]
e8631b2f3a chore: bump chromium to 135.0.7047.0 (main) (#45859)
* chore: bump chromium in DEPS to 135.0.7043.0

* chore: bump chromium in DEPS to 135.0.7045.0

* 6305947: Preconnect to the Glic FRE when the button is hovered.

https://chromium-review.googlesource.com/c/chromium/src/+/6305947

* 6207093: Remove line_bounds from ImeCompositionRangeChanged

https://chromium-review.googlesource.com/c/chromium/src/+/6207093

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-03-03 14:26:52 +01:00
Sam Maddock
21ad7cdda5 test: service worker contextBridge leak (#45852)
* test: contextBridge prototype leak in service workers

* test: deep prototype checks
2025-03-01 09:56:03 +01:00
electron-roller[bot]
add374ef6a chore: bump chromium to 135.0.7041.2 (main) (#45850)
* chore: bump chromium in DEPS to 135.0.7041.2

* [Extensions] Remove ExtensionsBrowserClient::GetUserAgent()

https://chromium-review.googlesource.com/c/chromium/src/+/6306854

* chore: update patches

* [api] Remove deprecated FunctionCallbackInfo::Holder()

https://chromium-review.googlesource.com/c/v8/v8/+/6309166

* [test] Add createExternalizableTwoByteString to extension

https://chromium-review.googlesource.com/c/v8/v8/+/6304942

* fixup [test] Add createExternalizableTwoByteString to extension

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-02-28 17:29:23 -05:00
David Sanders
eac270bea7 build: bump NMV to 135 (#45789) 2025-02-28 09:53:02 -05:00
co63oc
36ec9d7236 docs: fix spelling errors in code comments (#45842)
chore: Fix typos
2025-02-28 12:24:00 +01:00
Michaela Laurencin
3041fd66cd docs: update timelines for E36 (#45785)
Update electron-timelines.md
2025-02-28 11:24:40 +01:00
Charles Kerr
b504f65ace docs: update breaking-changes.md for 35.0.0 (#45822)
* docs: update breaking-changes.md for 35.0.0

* fixup! docs: update breaking-changes.md for 35.0.0

docs: make lint happy
2025-02-27 22:01:26 -06:00
electron-roller[bot]
5cb87b7110 chore: bump chromium to 135.0.7040.0 (main) (#45846)
chore: bump chromium in DEPS to 135.0.7040.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-02-27 21:59:50 -06:00
Charles Kerr
d19cac6772 docs: fix PrinterInfo info in breaking-changes.md (#45843)
> ### Removed:`isDefault` and `status` properties on `PrinterInfo`
> These properties have been removed from the PrinterInfo Object
> because they have been removed from upstream Chromium.

These properties won't be removed until Electron 36, but
breaking-changes.md lists them as being removed in 35.
This PR corrects the error.
2025-02-27 17:49:58 -06:00
Shelley Vohr
eac1a7ff68 fix: context-menu event emitted in draggable regions (#45813)
* fix: context-menu event emitted in draggable regions

* fix: only trigger on mouse release
2025-02-27 14:44:46 -05:00
electron-roller[bot]
00089a951b chore: bump chromium to 135.0.7039.0 (main) (#45836)
* chore: bump chromium in DEPS to 135.0.7039.0

* chore: update patches

* extensions: Refactor ExtensionService GrantPermissionsAndEnableExtension

https://chromium-review.googlesource.com/c/chromium/src/+/6302374

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-02-27 13:20:42 -05:00
reito
b8d0f18ff8 docs: add docs about shared texture mode osr (#45670)
* docs: add docs about shared texture mode osr

* docs: add docs about shared texture mode osr

* docs: fix dot

* 更新 web-contents.md

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>

---------

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>
2025-02-27 11:10:58 -05:00
co63oc
96c2022483 chore: Fix typos (#45825) 2025-02-27 14:31:21 +01:00
Dietrich Ayala
ff05d4a96c docs: dialog.md - typo fix s/wndow/window/ (#45831)
Update dialog.md - typo fix
2025-02-27 10:32:42 +01:00
Charles Kerr
989918a59c refactor: simplify Invoker::IsOK() (#45803)
* refactor: simplify Invoker::IsOK()

* refactor: might as well make it [[nodiscard]] as well
2025-02-26 18:50:57 -06:00
electron-roller[bot]
6c4b5d81dd chore: bump chromium to 135.0.7037.0 (main) (#45811)
* chore: bump chromium in DEPS to 135.0.7036.0

* chore: bump chromium in DEPS to 135.0.7037.0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2025-02-26 17:30:11 +01:00
Charles Kerr
7d045dcddb refactor: remove unused gin_helper::WrappableBase::GetWrapper(v8::Isolate*) (#45793)
refactor: remove unused EventEmitter::GetWrapper(v8::Isolate*)
2025-02-25 19:50:09 -06:00
Charles Kerr
199f6d64db perf: avoid redundant method calls in EventEmitter (#45786)
* refactor: move EventEmitter::EmitWithEvent() into EventEmitter::Emit()

* perf: remove redundant calls to isolate() in EventEmitter::Emit()

* perf: remove redundant calls to GetWrapper() in EventEmitter::EmitEvent()

* perf: remove redundant calls to isolate() in EventEmitter::EmitWithoutEvent()

* perf: remove redundant calls to GetWrapper() in EventEmitter::EmitWithoutEvent()

* refactor: remove unused method EventEmitter::isolate()

* refactor: remove unused method EventEmitter::GetWrapper(v8::Isolate*)

* refactor: remove unused method EventEmitter::GetWrapper()

refactor: make the EventEmitter::Base typedef private

* refactor: remove unused typedef EventEmitter::Base

See "Workarounds" section in
https://isocpp.org/wiki/faq/templates#nondependent-name-lookup-members

* refactor: remove redundant gin_helper:: namespace use
2025-02-25 19:20:33 -06:00
dependabot[bot]
b82e4585cf build(deps): bump github/codeql-action from 3.28.9 to 3.28.10 (#45792)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.9 to 3.28.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](9e8d0789d4...b56ba49b26)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-02-25 15:25:24 -05:00
electron-roller[bot]
9303a3fae9 chore: bump chromium to 135.0.7035.0 (main) (#45764)
* chore: bump chromium in DEPS to 135.0.7028.0

* chore: bump chromium in DEPS to 135.0.7029.0

* chore: bump chromium in DEPS to 135.0.7031.0

* chore: bump chromium in DEPS to 135.0.7033.0

* Split //component/embedder_support:browser_util into multiple targets

https://chromium-review.googlesource.com/c/chromium/src/+/6246155

* chore: update patches

* build: update filenames.libcxx.gni

* 6275531: Enable Float16Array

https://chromium-review.googlesource.com/c/chromium/src/+/6275531

* chore: bump chromium in DEPS to 135.0.7035.0

* chore: update patches

* Move Service Process Host files to a separate folder

https://chromium-review.googlesource.com/c/chromium/src/+/6089368

* Remove NOTREACHED()s after return statements

https://chromium-review.googlesource.com/c/chromium/src/+/6297811

* Move ServiceProcessTracker and UtilityProcessClient into separate files

https://chromium-review.googlesource.com/c/chromium/src/+/6088677

* chore: update filenames.libcxx.gni

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-02-25 15:16:15 -05:00
Keeley Hammond
9b6ba1ced1 fix: re-enable MacWebContentsOcclusion feature flag (#45775) 2025-02-25 09:28:09 -08:00
dependabot[bot]
7870ade07a build(deps): bump ossf/scorecard-action from 2.4.0 to 2.4.1 (#45791)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.4.0 to 2.4.1.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](62b2cac7ed...f49aabe0b5)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-02-25 08:13:06 +01:00
dependabot[bot]
9699422cd6 build(deps): bump actions/upload-artifact from 4.6.0 to 4.6.1 (#45790)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.6.0 to 4.6.1.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](65c4c4a1dd...4cec3d8aa0)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-02-25 08:13:01 +01:00
Charles Kerr
3ee2ec8e4f build: re-enable unsafe buffer checks (#45770) 2025-02-24 20:06:30 -06:00
Charles Kerr
0de1e8e610 refactor: remove unused v8::Isolate* arg from GlobalShortcut constructor (#45773)
refactor: remove unused isolate arg from GlobalShortcut constructor

has not been used since f1a0d5e811 (#22755)
2025-02-24 19:38:20 -06:00
Shelley Vohr
01554f39a8 revert: drag and drop icons on Windows (#45779)
This reverts commit 698cce6707.
2025-02-24 11:35:29 -06:00
Charles Kerr
69eb076bca refactor: do not use AdaptCallbackForRepeating() in electron_api_url_loader.cc (#45771)
refactor: do not use AdaptCallbackForRepeating in electron_api_url_loader.cc
2025-02-24 11:09:01 -05:00
reito
f3259be73c feat: remove osr framerate limit when use shared texture (#45669)
feat: remove framerate limit, if use shared texture osr.
2025-02-24 10:21:46 -05:00
David Sanders
698cce6707 fix: drag and drop icons on Windows (#45767) 2025-02-24 09:54:08 +01:00
Nilay Arya
3eab549369 docs: added upstream doc links for node, chromium, and v8 in default_app (#45392) 2025-02-22 10:15:36 -06:00
Shelley Vohr
3e51ee516e fix: rework and improve legacyMainResolve patch (#45754)
fix: rework and improve legacyMainResolve patch
2025-02-22 10:06:04 -06:00
Sam Maddock
e3f61b465d refactor: move extension APIs to session.extensions (#45597)
refactor: move extensions to session.extensions
2025-02-21 17:36:51 -06:00
Erick Zhao
a63f6143ea docs: clarify navigationhistory offsets (#45616)
* docs: clarify navigationhistory offsets

* "relative offset"
2025-02-21 17:35:17 -06:00
Charles Kerr
2a383e9ddd refactor: use C++20's contains() method (#45742)
* chore: use std::map<>::contains() instead of count() or find()

* chore: use std::map<>::contains() instead of base::Contains()
2025-02-21 17:33:43 -06:00
electron-roller[bot]
612da3ec47 chore: bump chromium to 135.0.7027.0 (main) (#45677)
* chore: bump chromium in DEPS to 135.0.7021.0

* chore: bump chromium in DEPS to 135.0.7023.0

* chore: update patches

* chore: gen-libc++-filenames.js

* [Extensions] Add a BUILD.gn file for the chrome.system.display API.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6227347

* chore: bump chromium in DEPS to 135.0.7025.0

* fixup! [Extensions] Add a BUILD.gn file for the chrome.system.display API.

* [DevTools] Add support for automatic workspace folders.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6275926

* Add UseCounter for potential PNA 2.0 breakage

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6259197

* Remove references to NavigationEntry/Controller in Zoom code.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6258070

* chore: update patches

* Allow DevTools to record UmaHistogramMediumTimes

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6183713

* chore: update patches

* [gpu] Remove unnecessary media_buildflags include

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6286526

* chore: bump chromium in DEPS to 135.0.7027.0

* chore: update patches

* Remove type alias

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6280957

* [Refactor] Make ExtensionRegistrar a browser keyed service.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6285230

* Remove unused functions

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6278736

* chore: IWYU

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-02-21 14:46:51 -08:00
Keeley Hammond
6248c2436a fix: re-enable synchronous spellcheck on Windows (#45712)
* fix: re-enable synchronous spellcheck on Windows

* revert: fix: empty suggestions with windows platform checker

---------

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-02-21 14:45:46 -08:00
Charles Kerr
8d58999135 refactor: use base's map utills in WebFrameMain (#45741)
refactor: use base::FindPtrOrNull() in WebFrameMain::FromFrameTreeNodeId()

refactor: use base::FindPtrOrNull() in WebFrameMain::FromFrameToken()
2025-02-21 15:28:00 -06:00
Shelley Vohr
324fc0f62a fix: crash on getUserMedia with invalid chromeMediaSourceId (#45733)
* fix: crash on getUserMedia with invalid chromeMediaSourceId

* test: add a test
2025-02-21 10:17:52 -06:00
Charles Kerr
f62668e2e3 refactor: use base::as_byte_span() in EncodeToken(). (#45723)
This matches the change in upstream's serial_chooser_context.cc.

https://chromium-review.googlesource.com/c/chromium/src/+/5247305
2025-02-20 20:20:16 -05:00
Charles Kerr
a15fa87558 refactor: use base::as_bytes() in WriteAsciiChunk() (#45724)
refactor: use base::as_bytes() in WriteAsciiChunk()

this avoids a reinterpret_cast and a static_cast
2025-02-20 20:19:48 -05:00
Charles Kerr
ceaa0e26c7 refactor: use base::as_string_view() (#45722)
Use `base::as_string_view()` as a safer alternative to `reinterpret_cast`
in a couple of places.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5472408
2025-02-20 18:19:36 -06:00
Shelley Vohr
4867b5dc75 refactor: bluetooth in serial chooser when exclusively wireless serial ports are expected (#45671)
* refactor: bluetooth in serial chooser when exclusively wireless serial ports are expected

https://chromium-review.googlesource.com/c/chromium/src/+/5737296

* chore: review feedback
2025-02-20 16:44:35 -06:00
Shelley Vohr
340fdaf511 feat: allow setting roundedCorners on Windows (#45594)
* feat: allow setting roundedCorners on Windows

* Update docs/api/structures/base-window-options.md

Co-authored-by: Will Anderson <will@itsananderson.com>

---------

Co-authored-by: Will Anderson <will@itsananderson.com>
2025-02-20 15:39:12 -05:00
Sam Maddock
5ea885c87f build: skip chromium git cookie on forks (#45735) 2025-02-20 14:38:20 -05:00
Shelley Vohr
d8baceb08c fix: crash loading about:blank in subframes (#45694)
fix: crash loading about:blank in subframes
2025-02-20 12:07:15 -05:00
Charles Kerr
d6f4982522 fix: possible timing issue in utility-process spec (#45690)
This fixture has been calling process.exit() immediately after writing
to stdout and stderr, which the Node.js docs say is risky behavior:

> Calling process.exit() will force the process to exit as quickly as
> possible even if there are still asynchronous operations pending that
> have not yet completed fully, including I/O operations to
> process.stdout and process.stderr.

This fixture's been around for years without problems (AFAIK).
The writes are very small ('hello\n' and 'world') and finish quickly.
But recently I've been testing on a very slow CI machine. There, I see
this spec flaking when it expects stderr to be 'world' but it gets ''.

This PR changes the fixture to wait for stdout & stderr to flush
before calling process.exit().
2025-02-19 23:28:04 -06:00
Sam Maddock
9d558cec5e fix: action.openPopup function missing (#45697) 2025-02-19 18:05:02 -05:00
Shelley Vohr
159e1a42b3 refactor: track downloads by guid (#45675) 2025-02-19 16:49:34 -06:00
Sam Maddock
b50066f420 fix: extension web workers net request failing (#45698) 2025-02-19 13:08:28 -05:00
Milan Burda
22b7403cd1 chore: remove deprecated systemPreferences.isAeroGlassEnabled() (#45563) 2025-02-18 18:59:00 -06:00
Charles Kerr
670e0ca076 chore: disable 'should lock the keyboard' test on macOS (#45681) 2025-02-18 18:00:01 -06:00
Sam Maddock
ee67bc7dcb fix: dangling speculative frames (#45609)
* fix: dangling speculative frames

* harden lifecycle state checks

* feedback

* add const
2025-02-18 17:52:05 -05:00
John Kleinschmidt
ecd7eb36ac build: remove appveyor bake (#45073) 2025-02-18 12:04:47 -08:00
electron-roller[bot]
47572286f3 chore: bump chromium to 135.0.7015.0 (main) (#45500)
* https://chromium-review.googlesource.com/c/chromium/src/+/6230977

* chore: bump chromium to 135.0.7012.0

* chore: update accelerator.patch

Support parsing Ctrl+Alt shortcuts | https://chromium-review.googlesource.com/c/chromium/src/+/6238137

* 6234236: Reapply bindings: Pass CppHeap on Isolate creation | https://chromium-review.googlesource.com/c/chromium/src/+/6234236

* 6234614: [ios blink] Move to use external begin frame source | https://chromium-review.googlesource.com/c/chromium/src/+/6234614

* chore: update chromium/feat_add_streaming-protocol_registry_to_multibuffer_data_source.patch

no manual changes; patch applied with fuzz

* chore: update chromium/build_libc_as_static_library.patch

no manual changes; patch applied with fuzz

* chore: remove chromium/cherry-pick-dd8e2822e507.patch

landed upstream

* 6188884: Grit: Remove output_all_resource_defines from list of valid attributes. | https://chromium-review.googlesource.com/c/chromium/src/+/6188884

* 6226981: [views-ax] Remove View::GetAccessibleNodeData() method | https://chromium-review.googlesource.com/c/chromum/src/+/6226981

* 6214895: [views-ax] Deprecate View::NotifyAccessibilityEvent | https://chromium-review.googlesource.com/c/chromium/src/+/6214895

* 6196494: Remove ImageView::SetImage() with ImageSkia param | https://chromium-review.googlesource.com/c/chromium/src/+/6196494

* 6236267: [cleanup] Remove unused PrinterBasicInfo fields | https://chromium-review.googlesource.com/c/chromium/src/+/6236267

* refactor: remove status, isDefault properties from PrinterInfo

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6236267

* chore: lint

* fixup: added mas bypass to new file added in https://chromium-review.googlesource.com/c/chromium/src/+/6208630 see slack for more context

* chore: node script/gen-libc++-filenames.js

* chore: e patches all

* fix: duplicate crdtp symbols

* chore: update patches

* fixup! [Media Features] Remove launched features

---------

Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2025-02-18 11:51:27 -05:00
Sam Maddock
6be1151ffc fix: win.closeFilePreview recreates panel when called twice (#45319)
* fix: close quick look during tests on macOS

* use longer delay 🤷

* fix: sharedPreviewPanel being recreated on close

* test: ensure preview panel gets closed
2025-02-17 17:25:19 -05:00
Sam Maddock
c0422d7cc9 refactor: dispatch IPC messages from Session (#45452)
* refactor: dispatch IPC messages from Session

* refactor: move MessageHost to Session
2025-02-17 16:36:28 -05:00
reito
e9ba5876d1 fix: osr stutter fix backport for electron. (#45572) 2025-02-17 22:13:44 +01:00
Alice Zhao
02be7c1185 feat: add excludeUrls and modify urls in WebRequestFilter for better URL filtering (#44692)
* feat: add excludeUrls to web request filter

* refactor: add deprecated field

* test: update tests

* lint: newline

* docs: improve API doc

* fix: add is filter defined property to match all urls

* refactor: remove includeUrls

* refactor: remove typescript binding

* refactor: all_url

* refactor: remove isDefined methods

* refactor: remove comment

* fix: logic

* docs: add to breaking changes
2025-02-17 12:40:47 -08:00
Shelley Vohr
7dfcec931a build: run source cache clean daily (#45652) 2025-02-17 13:57:22 -05:00
John Kleinschmidt
a329024793 build: make sure chromium cookie is set everywhere (#45631) 2025-02-14 13:19:43 -05:00
Robo
137a552641 fix: support for v8.setHeapSnapshotNearHeapLimit api (#45606)
* fix: support for v8.setHeapSnapshotNearHeapLimit api

* docs: add  support
2025-02-14 10:00:39 -06:00
electron-roller[bot]
a841d6484c chore: bump node to v22.14.0 (main) (#45578)
* chore: bump node in DEPS to v22.14.0

* src: move more crypto impl detail to ncrypto dep

https://github.com/nodejs/node/pull/56421

* test: move crypto related common utilities in common/crypto

https://github.com/nodejs/node/pull/56714

* module: add findPackageJSON util

https://github.com/nodejs/node/pull/55412

* module: mark evaluation rejection in require(esm) as handled

https://github.com/nodejs/node/pull/56122

* chore: fixup patch indices

* deps: move inspector_protocol to deps

https://github.com/nodejs/node/pull/56649

* fixup! src: move more crypto impl detail to ncrypto dep

* fixup! deps: move inspector_protocol to deps

* fixup! src: move more crypto impl detail to ncrypto dep

* crypto: fix checkPrime crash with large buffers

https://github.com/nodejs/node/pull/56559

* tls: fix error stack conversion in cryptoErrorListToException()

https://github.com/nodejs/node/pull/56554

* module: add findPackageJSON util

https://github.com/nodejs/node/pull/55412

Our revert of native legacyMainResolve makes this very difficult to make
work, so disable for now.

* lib: add typescript support to STDIN eval

https://github.com/nodejs/node/pull/56359

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-02-14 11:05:01 +01:00
Shelley Vohr
2af57c4b6a fix: osr crash on window close (#45573) 2025-02-14 11:01:00 +01:00
Shelley Vohr
47dbab3856 fix: pointer lock permission after focus loss and regain (#45574) 2025-02-14 10:22:13 +01:00
Charles Kerr
a1e4550c9e chore: disable flaky content tracing tests on Linux (#45612) 2025-02-14 10:18:42 +01:00
Charles Kerr
2b8706bf44 chore: change node test timeout from 20m to 30m (#45611) 2025-02-13 17:27:35 -06:00
Shelley Vohr
3a3595f2af build: remove PDF edited saved files patch (#45604) 2025-02-13 14:52:31 -05:00
Shay Molcho
9a2ee763d0 docs: added missing period for consistency and readability (#45333)
Added missing period for consistency and readability

Added a missing period in a specific part of the text to maintain consistency across the document. This ensures a uniform writing style, improves readability, and aligns with the formatting used throughout the content.
2025-02-13 10:55:43 +01:00
Keeley Hammond
237429bb85 build: set chromium cookie on depot tools requests (#45581)
* build: set chromium cookie on depot tools requests

* build: correct secrets syntax

* build: handle windows cmd
2025-02-12 17:44:43 +01:00
Will Anderson
50d1c803dd chore: remove var declarations from DEPS that no longer have any effect (#45535)
* chore: Remove checkout_google_benchmark var that no longer has any effect

This variable stopped having any effect in https://chromium-review.googlesource.com/c/chromium/src/+/4322306

It was removed from Chromium entirely in https://chromium-review.googlesource.com/c/chromium/src/+/4339138

* chore: remove checkout_oculus_sdk and checkout_libaom from DEPS
2025-02-12 10:51:11 +01:00
John Kleinschmidt
0d3e34d0be test: disable unexpectedly quit dialog on macOS (#45553)
* test: disable unexpectedly quit dialog on macOS

* test: take screenshot before keyboard lock test

* Revert "test: take screenshot before keyboard lock test"

This reverts commit 3ba5c6984f.
2025-02-11 21:08:38 -05:00
Charles Kerr
aa06b065c0 chore: bump chromium to 134.0.6998.10 (main) (#45564)
* chore: bump chromium to 134.0.6992.0

* chore: add BrowserProcessImpl::CreateGlobalFeaturesForTesting() stub

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6216193

Remove GlobalFeatures from TestingBrowserProcess::Init

* chore: bump chromium to 134.0.6994.0

* 6208630: Mac sandbox: don't use protobuf for policy serialization | https://chromium-review.googlesource.com/c/chromium/src/+/6208630

* [PDF] Remove HasUnsupportedFeature Mojo interface

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6220800

* 6217444: Remove scoped_gdi_object.h type aliases. | https://chromium-review.googlesource.com/c/chromium/src/+/6217444

* chore: bump chromium to 134.0.6998.10

* 6221378: Revert [OBC] Exclude Aliasing Cookies in FilterCookiesWithOptions() | https://chromium-review.googlesource.com/c/chromium/src/+/6221378

* Update ExtensionPrefs::GetDisableReasons to return DisableReasonSet

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6218840

change copied from 6218840 extensions/shell/browser/shell_extension_loader.cc

* 6218402: Typemap ui.gfx.DXGIHandle <=> gfx::DXGIHandle | https://chromium-review.googlesource.com/c/chromium/src/+/6218402

* chore: disable flaky contentTracing test

not new to this roll; it is happening in main as well

* fixup! chore: disable flaky contentTracing test

---------

Co-authored-by: alice <alice@makenotion.com>
2025-02-11 17:26:39 -06:00
Felix Rieseberg
9f47c9a051 feat: Restore webContents navigation history and page state (#45433)
* feat: Working navigationHistory.restore with just title/url

* feat: Restore page state, too

* chore: Docs, lint, tests

* Implement feedback

* More magic

* Make _awaitNextLoad truly private

* Implement API group feedback

* One more round of feedback
2025-02-11 15:09:38 -08:00
Will Anderson
6fdfca6e49 build: make gen-libc++-filenames.js produce the same results on Windows (#45556) 2025-02-11 12:56:05 +01:00
dependabot[bot]
196352bf0b build(deps): bump github/codeql-action from 3.28.8 to 3.28.9 (#45561)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.8 to 3.28.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](dd746615b3...9e8d0789d4)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-02-11 11:39:29 +01:00
Robo
46d316692d fix: asan build on macOS (#45541)
* fix: asan build on macOS

* chore: fix build
2025-02-11 15:04:07 +09:00
Josh Jancourtz
2f288bc7cc docs: fix grammar in preload tutorial summary (#45522) 2025-02-10 16:15:32 -05:00
Calvin
f5025b6246 fix: avoid IPC for renderer webFrame.getZoom... APIs (#45499)
* fix: avoid IPC for renderer `webFrame.getZoom...` APIs

* Remove `DoGetZoomLevel` IPC

* Fix synchronous behavior & nullptr deref

* Use local root
2025-02-10 16:09:11 -05:00
Milan Burda
e055ce7c39 chore: deprecate systemPreferences.isAeroGlassEnabled() (#45434) 2025-02-10 15:17:07 -05:00
John Kleinschmidt
14fe0932f0 test: make sure test window is on top for focus tests (#45435) 2025-02-10 13:40:27 -05:00
dependabot[bot]
3ba85878a5 build(deps): bump github/codeql-action from 3.28.6 to 3.28.8 (#45453)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.6 to 3.28.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](17a820bf2e...dd746615b3)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-02-10 19:40:01 +01:00
Keeley Hammond
70168c8bdc fix: fix mksnapshot gen/v8 path (#45488)
* fix: fix mksnapshot gen/v8 path

* build: use 7z compression

* build: unzip mksnapshot on Windows and update zip

* chore: escape backslashes

* chore: try another attempt

* chore: remove rmdir for now

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2025-02-10 10:21:29 -05:00
Sam Maddock
e4cd162433 docs: fix powerMonitor event types (#45518)
* fix: powerMonitor event types

* fix: thermal-state-change missing Returns
2025-02-10 10:13:11 -05:00
Calvin
4085185e2d docs: transactions-updated event type (#45527)
fix: `transactions-updated` event type
2025-02-10 10:12:17 -05:00
Shelley Vohr
a141f68c83 refactor: use node::tracing::Agent() directly (#45489)
refactor: use node::tracing::Agent()
2025-02-09 21:36:42 +01:00
Shelley Vohr
9199d5c610 fix: window maximizing with Mica (#45456)
* fix: window maximizing with Mica

* Fix rounded corners after restore
2025-02-07 15:00:36 -05:00
michal-pichlinski-openfin
96460becf9 fix: Update widget visibility in NativeWindowMac::ShowInactive (#45427)
When using `views::WebView` on macOS `NativeWidgetMacNSWindowHost`
contains a layer and compositor responsible for drawing web contents.
To trigger drawing `NativeWidgetMacNSWindowHost::OnVisibilityChanged`
needs to be called and `[NSWindow orderFrontRegardless]` does not trigger
`[NSWindow orderWindow:relativeTo:]` which can change
`NativeWidgetMacNSWindowHost` visiblity with stack:
```
views::NativeWidgetMacNSWindowHost::OnVisibilityChanged(bool)
remote_cocoa::NativeWidgetNSWindowBridge::OnVisibilityChanged()
-[ViewsNSWindowDelegate onWindowOrderChanged:]
-[NativeWidgetMacNSWindow orderWindow:relativeTo:]
```
`views::Widget` has method for showing inactive window:
`views::Widget::ShowInactive` which triggers
`NativeWidgetMacNSWindowHost::OnVisibilityChanged` with stack:
```
views::NativeWidgetMacNSWindowHost::OnVisibilityChanged(bool)
remote_cocoa::NativeWidgetNSWindowBridge::SetVisibilityState(remote_cocoa::mojom::WindowVisibilityState)
views::NativeWidgetMacNSWindowHost::SetVisibilityState(remote_cocoa::mojom::WindowVisibilityState)
views::NativeWidgetMac::Show(ui::mojom::WindowShowState, gfx::Rect const&)
views::Widget::ShowInactive() + 168
```
However this call seems to be insufficient to bring window to front,
therefore `[NSWindow orderFrontRegardless]` still needs to be called.
Calling `views::Widget::ShowInactive` ensures that all logic related to
showing Chromium widget will be properly executed, but onfortunately it
does not call `[NSWindow orderWindow:relativeTo:]` which is used to
disabling headless mode by the `ElectronNSWindow`, therefore we need to
trigger it manually through exposed `[ElectronNSWindow disableHeadlessMode]`.

Fixes: #45415
2025-02-07 11:31:08 -08:00
Charles Kerr
d7c6fb8250 refactor: follow upstream's suggestions on when to use EmptyGURL() (#45498)
- Prefer GURL() when we want to return a non-reference empty URL.

- In ServiceWorkerMain::GetStorageKey(), use a reference instead
  of instantiating a new temporary GURL.

From url/gurl.h:

> // Returns a reference to a singleton empty GURL. This object is for
> // callers who return references but don't have anything to return in
> // some cases. If you just want an empty URL for normal use, prefer
> // GURL().
2025-02-07 13:58:31 -05:00
Charles Kerr
3db691804b chore: bump chromium 134.0.6990.0 (#45507)
* chore: update feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6219304

Partially upstreamed by @codebytere

* chore: e patches all
2025-02-07 10:25:46 -06:00
David Sanders
4512b2b5c4 chore: remove remaining references to AppVeyor (#45339) 2025-02-07 12:57:36 +01:00
John Kleinschmidt
7bde100a1a build: make sure there is at least 35GB free for source cache (#45501)
build: make sure there is at least 35GB free for cache
2025-02-07 12:03:38 +01:00
Kavindu Udara
d0110d897d docs: remove width and height params (#45331)
remove width and height params
2025-02-07 11:42:16 +01:00
Charles Kerr
ef34892a76 chore: bump chromium 134.0.6989.0 (#45506)
* chore: bump chromium to 134.0.6989.0

* chore: update patches/chromium/cherry-pick-dd8e2822e507.patch

* chore: e patches all
2025-02-07 10:00:09 +01:00
Charles Kerr
67f5ac5bbc fix: RenderFrameHost nullptr dereference (#45487)
* fix: add nullptr tests before using render_frame_

* refactor: extract-method HasRenderFrame()
2025-02-06 22:02:57 -06:00
Milan Burda
517935cd55 refactor: only pass v8::Context to gin_helper::MicrotasksScope constructor (#45484)
refactor: forward v8::Context to v8::MicrotasksScope constructor
2025-02-07 10:44:19 +09:00
Samuel Attard
326957009a chore: cherry-pick dd8e2822e507 from chromium (#45495) 2025-02-06 14:33:42 -08:00
electron-roller[bot]
213165a467 chore: bump chromium to 134.0.6988.0 (main) (#45334)
* chore: bump chromium in DEPS to 134.0.6976.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6171046
process_info_mac.cc -> process_info_mac.mm

* chore: update build_do_not_depend_on_packed_resource_integrity.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6196857

* chore: update feat_add_support_for_missing_dialog_features_to_shell_dialogs.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6182296
https://chromium-review.googlesource.com/c/chromium/src/+/6183404
https://chromium-review.googlesource.com/c/chromium/src/+/6187853

A lot changed in the upstream implementation. There's a good chance I got
this wrong as threading has changed and moved some variables into globals.

* chore: remove build_remove_vr_directx_helpers_dependency.patch
https://chromium-review.googlesource.com/c/chromium/src/+/6186102
This landed upstream

* chore: e patches all

* chore: update net::CookieInclusionStatus::ExclusionReason enum
https://chromium-review.googlesource.com/c/chromium/src/+/6183252
https://chromium-review.googlesource.com/c/chromium/src/+/6185544

* chore: update content::WebAuthenticationDelegate import
https://chromium-review.googlesource.com/c/chromium/src/+/6189769

* Revert "chore: disable focus handling test due to win32/ia32 regression"

This reverts commit 1a57ba5d59.

* chore: bump chromium in DEPS to 134.0.6978.0

* chore: bump chromium in DEPS to 134.0.6980.0

* chore: bump chromium in DEPS to 134.0.6982.0

* chore: bump chromium in DEPS to 134.0.6984.0

* 6196281: Allow direct embedder IsPdfInternalPluginAllowedOrigin() interaction
https://chromium-review.googlesource.com/c/chromium/src/+/6196281

* 6196283: Delete PdfInternalPluginDelegate
https://chromium-review.googlesource.com/c/chromium/src/+/6196283

* chore: update patches

* chore: bump chromium in DEPS to 134.0.6986.0

* chore: update patches

* 6205762: Support option to use window.showSaveFilePicker() in PDF attachment code
https://chromium-review.googlesource.com/c/chromium/src/+/6205762

See also:
* https://issues.chromium.org/issues/373852607
* 5939153: [PDF] Add PdfUseShowSaveFilePicker feature flag | https://chromium-review.googlesource.com/c/chromium/src/+/5939153
* 6205761: Delete spurious Ink-specific code in pdf_viewer.ts | https://chromium-review.googlesource.com/c/chromium/src/+/6205761

* 6209609: Remove WebVector: Automatic changes
https://chromium-review.googlesource.com/c/chromium/src/+/6209609

* 6205488: UI: make QT5 optional
https://chromium-review.googlesource.com/c/chromium/src/+/6205488

* 6178281: Rename pak files from branding strings
https://chromium-review.googlesource.com/c/chromium/src/+/6178281

* fixup! 6209609: Remove WebVector: Automatic changes https://chromium-review.googlesource.com/c/chromium/src/+/6209609

* 6193249: Switch from safe_browsing::EventResult to enterprise_connectors:EventResult
https://chromium-review.googlesource.com/c/chromium/src/+/6193249

* 6197457: Remove Pause/ResumeReadingBodyFromNet IPCs
https://chromium-review.googlesource.com/c/chromium/src/+/6197457

* 6191230: Record total time spent on a picture in picture window
https://chromium-review.googlesource.com/c/chromium/src/+/6191230

* chore: bump chromium in DEPS to 134.0.6988.0

* chore: update patches

* 6215440: Remove base/ranges/.
https://chromium-review.googlesource.com/c/chromium/src/+/6215440

* Disable unsafe buffers error

Not sure what changed, but we're now seeing unsafe buffer errors in Chromium code, at least when using reclient. Will update this comment if we find out the cause.

* 6187853: SelectFileDialogLinuxPortal: Use dbus_xdg::Request and DbusType
https://chromium-review.googlesource.com/c/chromium/src/+/6187853

* fix `setDisplayMediaRequestHandler` test

Given how this test is written, I would expect this assertion to be false. It seems the oppositue was true before, but that was also acknowledged to be suprising. Seems that the underlying implementation is now fixed and works as expected.

* fixup! 6187853: SelectFileDialogLinuxPortal: Use dbus_xdg::Request and DbusType https://chromium-review.googlesource.com/c/chromium/src/+/6187853

* chore: udpate patches

* Multiple PRS: https://chromium-review.googlesource.com/c/chromium/src/+/6185544 | https://chromium-review.googlesource.com/c/chromium/src/+/6183252

* fix: cast enum class to numeric type

* fix: add 1 to MAX_EXCLUSION_REASON because enum values are zero-based, and we want the total count of reasons.

* Reapply "chore: disable focus handling test due to win32/ia32 regression"

This reverts commit 760b1a519b.

* refactor: use ExclusionReasonBitset::kValueCount for size

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2025-02-06 15:30:54 -05:00
David Sanders
3dad07f338 test: dump Electron process PID to path if environment variable set (#45481) 2025-02-06 09:15:10 -06:00
Anh Le
6adc737a89 docs: use correct headings in tutorial/security.md (#45397) 2025-02-06 11:16:24 +01:00
max54nj
c0282eb9c8 docs: style fixes (#45458)
* docs: fix code field

* docs: add missing space
2025-02-05 15:10:07 -05:00
Maria Alejandra Arias Frontanilla
471b1a873d fix: fix typo in docs why-electron.md (#45437) 2025-02-05 09:26:47 -06:00
Shelley Vohr
aee8ea8b10 fix: WCO not working with some window configurations (#45422) 2025-02-05 12:48:51 +01:00
Shelley Vohr
57cf4fc846 fix: legacyMainResolve respecting permission model (#45421)
fix: legacyMainResolve respecting permission model
2025-02-05 12:48:34 +01:00
Charles Kerr
9fe12cd01b fix: handle exclude aliasing in InclusionStatusToString() (#45454)
* refactor: use MakeFixedFlatMap() in InclusionStatusToString()

* fix: add log message for EXCLUDE_ALIASING

refactor: add static_assert() to ensure our messages stay
in sync with the CookieInclusion reasons in net/cookies/
2025-02-05 12:48:11 +01:00
Shelley Vohr
6486ce8191 build: remove debugger agent timeout patch (#45457) 2025-02-05 12:47:54 +01:00
Robo
bec6ddda70 feat: route deprecated sync clipboard read through permission checks (#45377)
* feat: route deprecated clipboard commands through permission checks

* docs: address review feedback

* fix: enable checks for child windows
2025-02-05 15:13:29 +09:00
Shelley Vohr
e9d5eeb118 build: try removing embedder exception patch (#45429) 2025-02-04 19:39:20 +01:00
Keeley Hammond
c147e4fa81 build: add win toolchain for release builds (#45380)
* build: add win toolchain for release builds

* build: fix installed_software.json script

* chore: run pwsh script within src

* build: fixup uploader arch
2025-02-03 22:06:01 -08:00
Niklas Wenzel
1d27a27813 docs: document deletion of databases directory (#45412) 2025-02-03 16:28:44 -05:00
Niklas Wenzel
d3bead5e0e docs: mention C++20 requirement in breaking changes document (#45413)
* docs: mention C++20 requirement in breaking changes document

* chore: fix linter issue
2025-02-03 13:19:26 -08:00
David Sanders
9f1bb531ba build: always use python3 in script/lib/get-version.js (#45400)
build: always use python3 in script/lib/get-version.js
2025-02-03 16:13:36 -05:00
Shelley Vohr
9971087678 build: remove outdated Node.js serdes patch (#45401)
build: remove outdates Node.js serdes patch
2025-02-03 14:09:02 +01:00
Shelley Vohr
e7fa5c709c fix: incorrect WCO tooltip in RTL (#45405) 2025-02-03 10:50:50 +01:00
Shelley Vohr
7a1d410e0a fix: default path not working on KDE Linux (#45402) 2025-02-03 09:49:48 +01:00
Sam Maddock
e2a7981dd3 feat: view.getVisible() (#44999)
* feat: view.getVisible()

* test: visible apis

* docs: clarify getVisible
2025-01-31 13:27:16 -05:00
Sam Maddock
26da3c5d6e feat: service worker preload scripts for improved extensions support (#44411)
* feat: preload scripts for service workers

* feat: service worker IPC

* test: service worker preload scripts and ipc
2025-01-31 09:32:45 -05:00
Shelley Vohr
bc22ee7897 build: fix slack-github-action for backports (#45388)
build: fix slack-github-action for backports
2025-01-31 10:29:50 +01:00
Shelley Vohr
784201ecee build: try removing Read/WriteBarrier patch (#45393)
build: try removing Read/WriteBarrier patch
2025-01-31 10:29:34 +01:00
Shelley Vohr
6e72cbb5e0 fix: multiple directory selection on Linux (#45373) 2025-01-30 16:34:44 +01:00
Shelley Vohr
233b99a0a8 chore: update chrome.scripting.execute logic (#45369)
chore: update chrome.scripting.execute logic

Refs:
- https://chromium-review.googlesource.com/c/chromium/src/+/6123601
- https://chromium-review.googlesource.com/c/chromium/src/+/6142377
- https://chromium-review.googlesource.com/c/chromium/src/+/6173554
2025-01-30 12:56:44 +01:00
Shelley Vohr
43e328f363 chore: update pdf_viewer_private.idl (#45370)
chore: update pdf_viewer_private.idl

- https://chromium-review.googlesource.com/c/chromium/src/+/6160067
2025-01-30 11:03:27 +01:00
John Kleinschmidt
8543820d98 build: fixup concurrent builds on protected branches (#45355) 2025-01-29 16:47:25 -05:00
electron-roller[bot]
93f4a93e12 chore: bump node to v22.13.1 (main) (#45307)
* chore: bump node in DEPS to v22.13.1

* chore: fixup GN build file

* https://github.com/nodejs/node/pull/55529
* https://github.com/nodejs/node/pull/55798
* https://github.com/nodejs/node/pull/55530

* module: simplify --inspect-brk handling

https://github.com/nodejs/node/pull/55679

* src: fix outdated js2c.cc references

https://github.com/nodejs/node/pull/56133

* crypto: include openssl/rand.h explicitly

https://github.com/nodejs/node/pull/55425

* build: use variable for crypto dep path

https://github.com/nodejs/node/pull/55928

* crypto: fix RSA_PKCS1_PADDING error message

https://github.com/nodejs/node/pull/55629

* build: use variable for simdutf path

https://github.com/nodejs/node/pull/56196

* test,crypto: make crypto tests work with BoringSSL

https://github.com/nodejs/node/pull/55491

* fix: suppress clang -Wdeprecated-declarations in libuv

https://github.com/libuv/libuv/pull/4486

* deps: update libuv to 1.49.1

https://github.com/nodejs/node/pull/55114

* test: make test-node-output-v8-warning more flexible

https://github.com/nodejs/node/pull/55401

* [v22.x] Revert "v8: enable maglev on supported architectures"

https://github.com/nodejs/node/pull/54384

* fix: potential WIN32_LEAN_AND_MEAN redefinition

https://github.com/c-ares/c-ares/pull/869

* deps: update nghttp2 to 1.64.0

https://github.com/nodejs/node/pull/55559

* src: provide workaround for container-overflow

https://github.com/nodejs/node/pull/55591

* build: use variable for simdutf path

https://github.com/nodejs/node/pull/56196

* chore: fixup patch indices

* fixup! module: simplify --inspect-brk handling

* lib: fix fs.readdir recursive async

https://github.com/nodejs/node/pull/56041

* lib: avoid excluding symlinks in recursive fs.readdir with filetypes

https://github.com/nodejs/node/pull/55714/

This doesn't currently play well with ASAR - this should be fixed in a follow up

* test: disable CJS permission test for config.main

This has diverged as a result of our revert of
src,lb: reducing C++ calls of esm legacy main resolve

* fixup! lib: fix fs.readdir recursive async

* deps: update libuv to 1.49.1

https://github.com/nodejs/node/pull/55114

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-01-29 15:41:00 -05:00
Robo
ecd5d0a3a4 fix: crash in gin::wrappable::secondweakcallback (#45368) 2025-01-29 10:20:37 -08:00
Niklas Wenzel
8cf2e46c1f docs: reference security guide in ipcRenderer.on docs (#45325) 2025-01-29 12:50:20 +01:00
dependabot[bot]
50387043d1 build(deps): bump github/codeql-action from 3.28.1 to 3.28.6 (#45351)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.1 to 3.28.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b6a472f63d...17a820bf2e)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-29 07:01:15 +01:00
Keeley Hammond
e715607178 build: use Python311 exe (#45360)
build: yse Python311 exe
2025-01-28 11:59:04 -08:00
Milan Burda
0e388bce3e build: add NSPrefersDisplaySafeAreaCompatibilityMode = false to Info.plist (#45318)
build: add NSPrefersDisplaySafeAreaCompatibilityMode = false to Info.plist
2025-01-28 14:58:48 +01:00
dependabot[bot]
9457a56607 build(deps): bump actions/setup-node from 4.1.0 to 4.2.0 (#45353)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.1.0 to 4.2.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](39370e3970...1d0ff469b7)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-28 14:57:39 +01:00
dependabot[bot]
f9553a35d5 build(deps): bump actions/stale from 9.0.0 to 9.1.0 (#45354)
Bumps [actions/stale](https://github.com/actions/stale) from 9.0.0 to 9.1.0.
- [Release notes](https://github.com/actions/stale/releases)
- [Changelog](https://github.com/actions/stale/blob/main/CHANGELOG.md)
- [Commits](28ca103628...5bef64f19d)

---
updated-dependencies:
- dependency-name: actions/stale
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-28 14:56:34 +01:00
dependabot[bot]
e2ef160beb build(deps): bump actions/checkout from 4.1.6 to 4.2.2 (#45352)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.1.6 to 4.2.2.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.1.6...11bd71901bbe5b1630ceea73d27597364c9af683)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-28 10:48:35 +01:00
David Lönnhager
ae56a03e33 fix: crash parsing CLSID in shell.readShortcutLink() (#45195)
* fix: crash parsing CLSID in shell.readShortcutLink

* fix: ignore clsid if it could not be set
2025-01-27 15:22:56 -05:00
Keeley Hammond
4629e449a9 build: remove generate-sas-token (#45347) 2025-01-27 12:21:53 -08:00
Keeley Hammond
74c6669a8e build: use windows builders for win-publish (#45340) 2025-01-24 14:43:38 -08:00
Niklas Wenzel
5c67cd9150 docs: fix broken code in drag and drop example (#45332) 2025-01-24 13:28:30 -08:00
Niklas Wenzel
f66a0c2acf build: create maintainer issue template and disable blank issues (#45309)
* build: create maintainer task issue template and disable blank issues

* Implement review feedback by @dsanders11

* Rename issue template file
2025-01-24 13:28:05 -08:00
Sam Maddock
a467d0684e feat: ServiceWorkerMain (#45232)
* feat: ServiceWorkerMain

* refactor: disconnect remote

* handle version_info_ nullptr case

* initiate finish request when possible and enumerate errors

* explicit name for test method

* oops

* fix: wait for redundant version to stop before destroying

* docs: clarify when undefined is returned

* chore: remove extra semicolons
2025-01-24 08:33:44 -05:00
electron-roller[bot]
75eac86506 chore: bump chromium to 134.0.6968.0 (main) (#45172)
* chore: bump chromium in DEPS to 134.0.6948.0

* chore: update can_create_window.patch

https://chromium-review.googlesource.com/c/chromium/src/+/6151982

no patch code changes, but had to manually apply due to upstream context shear

* chore: update proxy_config_monitor.patch

no manual changes; patch applied with fuzz 2

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6126219

* chore: update build_add_electron_tracing_category.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6149256

* chore: update adjust_accessibility_ui_for_electron.patch

https://chromium-review.googlesource.com/c/chromium/src/+/6105650

no patch code changes, but had to manually apply due to upstream context shear

* chore: e patches all

* chore: use fully-qualified path for all.gn

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6154997

* chore: do not use a variable when assigning rtc_use_h264

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6154997

* Move GlobalShortcutListenerLinux to //ui/base

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6097375

* [MPArch Guest View] Make WebPreferences queried per frame tree root

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6096390

* [Status Icons] Allow vector resources

https://chromium-review.googlesource.com/c/chromium/src/+/6139403

* [Extensions] Move MatchOriginAsFallbackBehavior to Mojom

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6141793

* Remove StrongAlias::Hasher

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6132291

* Rename text-change and select-change methods and related stuff

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6148816

* [Code Health] Remove stale feature EnableWebUsbOnExtensionServiceWorker

https://chromium-review.googlesource.com/c/chromium/src/+/6115161

* [Extensions Cleanup] Move creation of tab-based ports to factory method

https://chromium-review.googlesource.com/c/chromium/src/+/6143725

* refactor: add StatusIconGtk::SetIcon()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6139403

copied from chrome/browser/status_icons/status_icon.cc

* refactor: add TrayIconLinux::GetIcon()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6139403

* chore: update feat_allow_usage_of_sccontentsharingpicker_on_supported_platforms.patch

remove unused filter_ field

* chore: bump chromium in DEPS to 134.0.6950.0

* chore: bump chromium in DEPS to 134.0.6952.0

* chore: bump chromium in DEPS to 134.0.6954.0

* chore: bump chromium in DEPS to 134.0.6956.0

* chore: update Chromium patches

* 6165749: Check scanout support in RenderableGpuMemoryBufferPool | https://chromium-review.googlesource.com/c/chromium/src/+/6165749

* 6106730: [Win] Use DXGI swapchains and DCOMP visuals in software mode | https://chromium-review.googlesource.com/c/chromium/src/+/6106730

* chore: update patches

* chore: bump chromium in DEPS to 134.0.6958.0

* chore: bump chromium in DEPS to 134.0.6960.0

* chore: update chromium patches

* 6168371: Remove extensions GlobalShortcutListener wrapper | https://chromium-review.googlesource.com/c/chromium/src/+/6168371

* chore: update patches

* 6161637: WebUI: Leverage build_webui() in chrome://translate-internals | https://chromium-review.googlesource.com/c/chromium/src/+/6161637

* chore: bump chromium in DEPS to 134.0.6962.0

* 6177329: Remove policy.used_policy_certificates pref on ChromeOS | https://chromium-review.googlesource.com/c/chromium/src/+/6177329

* 6180524: Simplify logic in components/os_crypt/sync/BUILD.gn | https://chromium-review.googlesource.com/c/chromium/src/+/6180524

* 6144831: Enforce --disallow-v8-feature-flag-overrides in the renderer | https://chromium-review.googlesource.com/c/chromium/src/+/6144831

* chore: update patches

* chore: bump chromium in DEPS to 134.0.6964.0

* 6181010: Ensure busy cursor does not show via LaunchWithoutSandbox | https://chromium-review.googlesource.com/c/chromium/src/+/6181010

* chore: update patches

* chore: bump chromium in DEPS to 134.0.6966.0

* 6180598: [api] Remove Reallocate | https://chromium-review.googlesource.com/c/v8/v8/+/6180598

* 6170781: [Refactor] Move UninstallExtension to ExtensionRegistrar. | https://chromium-review.googlesource.com/c/chromium/src/+/6170781

* chore: update filenames.libcxx.gni

* 6168207: cdm: Remove widevine_cdm_version.h | https://chromium-review.googlesource.com/c/chromium/src/+/6168207

* chore: bump chromium in DEPS to 134.0.6968.0

* 6030552: [macOS] Allow using vibrancy with NativeWidgetNSWindowBridge | https://chromium-review.googlesource.com/c/chromium/src/+/6030552

* fix: use explicit copy to replace realloc impl

https://chromium-review.googlesource.com/c/v8/v8/+/6180598
https://issues.chromium.org/issues/331326406

As per recommendation, "File an issue with Node to explicitly copy,because they copy under the hood anyway"

* fixup! 6106730: [Win] Use DXGI swapchains and DCOMP visuals in software mode | https://chromium-review.googlesource.com/c/chromium/src/+/6106730

* fix: undefine win32 StrCat
https://chromium-review.googlesource.com/c/chromium/src/+/6172292

* fix: //device/vr:directx_helpers breaking the build
https://chromium-review.googlesource.com/c/chromium/src/+/6064548

Upstreamed in https://chromium-review.googlesource.com/c/chromium/src/+/6186102

* fix: avoid calling ui::Layer::SetFillsBoundsOpaquely
https://chromium-review.googlesource.com/c/chromium/src/+/6175787

The layer opacity is determined by the background color's alpha value

* fix: build with proprietary_codecs

The explicit setting of rtc_use_h264 is no longer needed since
https://webrtc-review.googlesource.com/c/src/+/62380

* fix: increase empty trace file size threshold

https://chromium-review.googlesource.com/c/chromium/src/+/6176642
Traces now contain a net-constants property to allow them to be converted to a net log.
These contain ~1240 new properties with formatted JSON data.

* fix: node tests missing resource management globals
https://chromium-review.googlesource.com/c/chromium/src/+/6174695

* fixup! fix: use explicit copy to replace realloc impl

* chore: disable focus handling test due to win32/ia32 regression

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: VerteDinde <vertedinde@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
Co-authored-by: Samuel Maddock <samuelmaddock@electronjs.org>
2025-01-23 23:07:43 -05:00
Sam Maddock
996477152d feat: contextBridge.executeInMainWorld (#45229) 2025-01-23 21:12:46 -05:00
Sam Maddock
e09577b123 feat: redesign preload APIs (#45230)
* feat: redesign preload APIs

* docs: remove service-worker mentions for now

* fix lint

* remove service-worker ipc code

* add filename

* fix: web preferences preload not included

* fix: missing common init

* fix: preload bundle script error
2025-01-23 21:12:23 -05:00
Felix Rieseberg
26d228ccfe docs: Add note about directly exposing Electron APIs in preload (#45241)
* docs: Add note about directly exposing Electron APIs in preload

* Implement feedback
2025-01-23 13:59:00 -08:00
Keeley Hammond
aafb1ba72c build: migrate Windows release builds to GHA (#45137)
* build: migrate release builds to GHA

* build: alter CI jobs release script
2025-01-23 14:10:24 -05:00
Charles Kerr
db7ef90159 chore: better logging if Node initialization fails (#45286)
feat: better logging if Node initialization fails
2025-01-23 08:55:28 -06:00
electron-roller[bot]
863faea542 chore: bump node to v22.11.0 (main) (#44530)
* chore: bump node in DEPS to v22.11.0

* src: move evp stuff to ncrypto

https://github.com/nodejs/node/pull/54911

* crypto: add Date fields for validTo and validFrom

https://github.com/nodejs/node/pull/54159

* module: fix discrepancy between .ts and .js

https://github.com/nodejs/node/pull/54461

* esm: do not interpret "main" as a URL

https://github.com/nodejs/node/pull/55003

* src: modernize likely/unlikely hints

https://github.com/nodejs/node/pull/55155

* chore: update patch indices

* crypto: add validFromDate and validToDate fields to X509Certificate

https://github.com/nodejs/node/pull/54159

* chore: fixup perfetto patch

* fix: clang warning in simdjson

* src: add receiver to fast api callback methods

https://github.com/nodejs/node/pull/54408

* chore: fixup revert patch

* fixup! esm: do not interpret "main" as a URL

* fixup! crypto: add Date fields for validTo and validFrom

* fix: move ArrayBuffer test patch

* src: fixup Error.stackTraceLimit during snapshot building

https://github.com/nodejs/node/pull/55121

* fix: bad rebase

* chore: fixup amaro

* chore: address feedback from review

* src: revert filesystem::path changes

https://github.com/nodejs/node/pull/55015

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2025-01-22 12:16:26 -05:00
Shelley Vohr
5aabb6bec5 fix: potential crash in chrome.tabs.update() (#45276)
fix: potential crash in chrome.tabs.update()
2025-01-22 10:02:29 -06:00
dependabot[bot]
5e05dff949 build(deps): bump actions/upload-artifact from 4.5.0 to 4.6.0 (#45274)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.5.0 to 4.6.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](6f51ac03b9...65c4c4a1dd)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-22 12:29:23 +01:00
Maksim Sisov
3ea623364b feat: support global shortcuts via GlobalShortcutsPortal feature with ozone/wayland (#45171)
* fix: backport patch to fix systemd unit activation in Chromium

This backports a patch from Chromium, which fixes systemd unit
activation. That is, a globalShortcuts feature that Chromium has
needs to create a systemd unit and rename it properly. Portal's
global shortcuts uses that name afterwards to map the app with
the shortcuts bound. However, there might be a race between
Chromium binding shortcuts and renaming the unit.

This is a first step to add Portal's globalShortcuts to
Electron.

* feat: Support global shortcuts via GlobalShortcutsPortal feature

Chromium has a new feature called GlobalShortcutsPortal. It
allows clients to use Portal's globalShortcuts to register and
listen to shortcuts.

This patches adds necessary bits, which allows Electron to
use that feature.

In order to make it work, one has to add
--enable-features=GlobalShortcutsPortal

Test: tested manually with a sample app.

* docs: add GlobalShortcutsPortal feature to globalShortcuts docs

Electron supports Portal's globalShortcuts API now via Chromium, and Electron
apps can use that in a Wayland session. Update the docs with the required
feature flag that must be passed to be able to use that implementation.
2025-01-22 11:59:48 +01:00
Erick Zhao
cf67dc8898 docs: add DocCardList component for index doc (#45275) 2025-01-22 10:27:30 +01:00
David Sanders
d7b568a1c0 ci: fix issue workflow failures (#45294) 2025-01-22 09:40:10 +01:00
Charles Kerr
fe9031eb23 refactor: in StopTracing(), use string literals instead of optional<string> (#45270)
refactor: simplify StopTracing() a little by using a string_view instead of an optional<string>

We have compile-time string literals that we're passing to a method
that takes a string_view argument, so we don't need all this extra
optional<string> scaffolding
2025-01-21 17:41:52 -06:00
Charles Kerr
f5eba67f0d refactor: simplify ParseUserScript() (#45269)
refactor: simplify ParseUserScript()

local variable user_script no longer needed after #43205
2025-01-21 15:21:56 -05:00
Charles Kerr
e1762e6e44 fix: consume the file permission callback when used (#45267)
fixes 0e5fe3f regression
2025-01-21 11:59:38 -06:00
Shelley Vohr
9d32b6ddfc fix: webContents.print() with OOP printing (#45266)
* fix: webContents.print() with OOP printing

* Update patches/chromium/printing.patch

Co-authored-by: Robo <hop2deep@gmail.com>

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2025-01-21 11:39:21 -05:00
David Sanders
7a413ff2ad ci: don't fail issue triage workflows if issue not found on project (#45252) 2025-01-21 16:06:24 +01:00
Shelley Vohr
0090d171fd chore: align clipboard blink::web_pref::WebPreferences with upstream (#45277)
chore: align clipboard blink::web_pref::WebPreferences with upstream
2025-01-21 06:50:36 -08:00
dependabot[bot]
980b68e9cc build(deps): bump github/codeql-action from 3.28.0 to 3.28.1 (#45272)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.28.0 to 3.28.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](48ab28a6f5...b6a472f63d)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-21 15:12:42 +01:00
dependabot[bot]
44a630e634 build(deps): bump mikefarah/yq from 4.44.6 to 4.45.1 (#45271)
Bumps [mikefarah/yq](https://github.com/mikefarah/yq) from 4.44.6 to 4.45.1.
- [Release notes](https://github.com/mikefarah/yq/releases)
- [Changelog](https://github.com/mikefarah/yq/blob/master/release_notes.txt)
- [Commits](4839dbbf80...8bf425b4d1)

---
updated-dependencies:
- dependency-name: mikefarah/yq
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-21 15:12:29 +01:00
Shelley Vohr
81d12fa452 build: fix clang-format duplicate message (#45235) 2025-01-20 11:05:40 +01:00
Shelley Vohr
83666ddc36 fix: page scaling in silent mode printing (#45218) 2025-01-20 11:05:15 +01:00
Shelley Vohr
fa5de40f86 fix: two possible FSA crashes (#45233)
* 5786874: Change Observer: Fix crash when navigating to new page

https://chromium-review.googlesource.com/c/chromium/src/+/5786874

* 5794141: Change Observer: Fix Get*PermissionGrant crash

https://chromium-review.googlesource.com/c/chromium/src/+/5794141
2025-01-20 10:23:57 +01:00
Shelley Vohr
7d05fb2a1b fix: broken OOP window.print() on macOS/Linux (#45214)
fix: broken OOP printing on macOS/Linux
2025-01-20 10:23:44 +01:00
Sam Maddock
51a249f380 chore: skip flaky contentTracing test (#45240) 2025-01-20 09:57:10 +01:00
Sam Maddock
90754e5fd2 test: quit Finder (#45239) 2025-01-20 09:54:26 +01:00
Shelley Vohr
0e5fe3fa60 fix: getAsFileSystemHandle failure when drag-dropping two directories (#45234)
fix: drag-dropping two directories
2025-01-20 09:54:12 +01:00
michal-pichlinski-openfin
6953f5505f refactor: remove InspectableWebContentsViewMac in favor of the Views version (#44628)
* refactor: remove InspectableWebContentsViewMac in favor of the Views version

* cherry-pick: refactor: remove InspectableWebContentsViewMac in favor of the Views version (#41326)

commit e67ab9a93d

Confilcts not resolved, except removal of the files removed
by the original commit.

* resolved conflicts and build issues after cherry-pick

* cherry-picked: fix: add method allowing to disable headless mode in native widget

https://github.com/electron/electron/pull/42996
fixing
https://github.com/electron/electron/issues/42995

* fix: displaying select popup in window created as fullscreen window

`constrainFrameRect:toScreen:` is not being call for windows created
with `fullscreen: true` therefore `headless` mode was not being removed
and `RenderWidgetHostNSViewBridge::DisplayPopupMenu` ignored displaying
popup.

Issue could be fixed by placing additional removal of `headless` mode
in the `toggleFullScreen:`, but `orderWindow:relativeTo:` is called
both for a regular and a fullscreen window, therefore there will be
a single place fixing both cases.

Because `electron::NativeWindowMac` lifetime may be shorter than
`ElectronNSWindow` on which macOS may execute `orderWindow:relativeTo:`
we need to clear `shell_` when `NativeWindow` is being closed.

Fixes #43010.

* fix: Content visibility when using `vibrancy`

We need to put `NSVisualEffectView` before `ViewsCompositorSuperview`
otherwise when using `vibrancy` in `BrowserWindow` `NSVisualEffectView`
will hide content displayed by the compositor.

Fixes #43003
Fixes #42336

In fact main issues reported in these tickets were not present after
cherry-picking original refactor switching to `views::WebView`, so
text could be selected and click event was properly generated. However
both issues testcases were using `vibrancy` and actual content was
invisible, because it was covered by the `NSVisualEffectView`.

* fix: EXCEPTION_ACCESS_VIOLATION crash on BrowserWindow.destroy()

Restored postponed deletion of the `NativeWindow`.

Restoration caused `DCHECK(new_parent_ui_layer->GetCompositor());` failure
in `BrowserCompositorMac::SetParentUiLayer` after the spec test:
`chrome extensions chrome.webRequest does not take precedence over Electron webRequest - http`
with stack:
```
7   Electron Framework 0x000000011fe07830 content::BrowserCompositorMac::SetParentUiLayer(ui::Layer*) + 628
8   Electron Framework 0x000000011fe0c154 content::RenderWidgetHostViewMac::SetParentUiLayer(ui::Layer*) + 220
9   Electron Framework 0x000000011fe226a8 content::WebContentsViewMac::CreateViewForWidget(content::RenderWidgetHost*) + 600
10  Electron Framework 0x000000011fd37e4c content::WebContentsImpl::CreateRenderWidgetHostViewForRenderManager(content::RenderViewHost*) + 164
11  Electron Framework 0x000000011fb32278 content::RenderFrameHostManager::CreateSpeculativeRenderFrame(content::SiteInstanceImpl*, bool, scoped_refptr<content::BrowsingContextState> const&) + 816
12  Electron Framework 0x000000011fb2ab8c content::RenderFrameHostManager::CreateSpeculativeRenderFrameHost(content::SiteInstanceImpl*, content::SiteInstanceImpl*, bool) + 1308
13  Electron Framework 0x000000011fb28598 content::RenderFrameHostManager::GetFrameHostForNavigation(content::NavigationRequest*, content::BrowsingContextGroupSwap*, std::__Cr::basic_string<char, std::__Cr::char_traits<char>, std::__Cr::allocator<char>>*) + 1796
14  Electron Framework 0x000000011fa78660 content::NavigationRequest::SelectFrameHostForOnRequestFailedInternal(bool, bool, std::__Cr::optional<std::__Cr::basic_string<char, std::__Cr::char_traits<char>, std::__Cr::allocator<char>>> const&) + 280
15  Electron Framework 0x000000011fa6a994 content::NavigationRequest::OnRequestFailedInternal(network::URLLoaderCompletionStatus const&, bool, std::__Cr::optional<std::__Cr::basic_string<char, std::__Cr::char_traits<char>, std::__Cr::allocator<char>>> const&, bo
+ 1008
16  Electron Framework 0x000000011fa7772c content::NavigationRequest::OnRequestFailed(network::URLLoaderCompletionStatus const&) + 72
17  Electron Framework 0x000000011f8554ac content::NavigationURLLoaderImpl::NotifyRequestFailed(network::URLLoaderCompletionStatus const&) + 248
```
This was probably the reason of removing `NativeWindow` immediately
in order to cleanup `views_host_` in `WebContentsViewMac` to prevent
using layer without compositor in `WebContentsViewMac::CreateViewForWidget`.

`[ElectronNSWindowDelegate windowWillClose:]` is deleting window host
and the compositor used by the `NativeWindow` therefore detach `NativeWindow`
contents from parent. This will clear `views_host_` and prevent failing
mentioned `DCHECK`.

Fixes #42975

* chore: Applied review suggestions

* refactor: directly cleanup shell

---------

Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2025-01-17 10:21:10 -05:00
Felix Rieseberg
45f90cd5dd docs: Why Electron? (#45191)
* docs: Why Electron?

* Apply suggestions from code review

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/why-electron.md

---------

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2025-01-15 18:32:56 -05:00
Anny Yang
8294f44c74 docs: remove quickstart (#45194) 2025-01-15 14:42:53 -08:00
Calvin
6f7999ad0d fix: session.clearData avoidClosingConnections default to false (#45187) 2025-01-15 11:38:50 -05:00
Keeley Hammond
d829ee3145 build: bump NMV to 133 (#45145) 2025-01-15 11:36:34 -05:00
Keeley Hammond
88b4e1a9b7 build: bump actions/cache past deprecated version (#45192) 2025-01-15 11:33:46 +01:00
dependabot[bot]
7c784a1758 build(deps): bump actions/setup-node from 4.0.4 to 4.1.0 (#45049)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.0.4 to 4.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](https://github.com/actions/setup-node/compare/v4.0.4...39370e3970a6d050c480ffad4ff0ed4d3fdee5af)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-15 11:06:10 +01:00
wujinli
5680c628b6 fix: only remove the 'v' prefix from the git tag name (#45132)
In the old version of get-version.js, it replaces the leading 'v',
i.e. |output.stdout.toString().trim().replace(/^v/g, '')|. However,
in the new version of get-git-version.py, it directly replaces all
'v'. Obviously, it does not conform to the original semantics.
Although it will not affect the existing electron version calculation,
it may affect other developers' customized git-tag-version, such as
v0.0.0-dev.xxx, which will lose the 'v' of dev.
2025-01-13 22:36:03 -05:00
Calvin
e57b69f106 docs: correct breaking changes versions (#45173) 2025-01-13 14:15:24 -08:00
Michaela Laurencin
19ee4464c2 docs: update timelines for E35 (#45167) 2025-01-10 16:21:08 -08:00
electron-roller[bot]
7d05b78479 chore: bump chromium to 133.0.6920.0 (main) (#45055)
* chore: bump chromium in DEPS to 133.0.6902.0

* chore: bump chromium in DEPS to 133.0.6903.0

* chore: update patches

* Update PdfViewer Save File Picker to use showSaveFilePicker.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6074308

* Code Health: Clean up stale MacWebContentsOcclusion

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6078344

* Change RenderProcessHost::GetID to RenderProcessHost::GetDeprecatedID

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6065543

* [WebRTC] Make WebRTC IP Handling policy a mojo enum

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6063620

* chore: gen filenames.libcxx.gni

* Remove allow_unsafe_buffers pragma in //printing

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6092280

* refactor: to use ChildProcessId where possible

Refs https://issues.chromium.org/issues/379869738

* [Win] Update TabletMode detection code

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6003486

* chore: bump chromium in DEPS to 133.0.6905.0

* chore: update patches

* Reland "Move global shortcut listener to //ui/base"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6099035

* [shared storage] Implement the batch `with_lock` option for response header

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6072742

* chore: bump chromium in DEPS to 133.0.6907.0

* chore: bump chromium in DEPS to 133.0.6909.0

* chore: bump chromium in DEPS to 133.0.6911.0

* chore: bump chromium in DEPS to 133.0.6912.0

* chore: update patches

* WebUI: Reveal hidden deps to ui/webui/resources.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6096291

* chore: bump chromium in DEPS to 133.0.6913.0

* chore: bump chromium in DEPS to 133.0.6915.0

* Code Health: Clean up stale base::Feature "AccessibilityTreeForViews"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6104174

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* fix: remove fastapitypedarray usage

* chore: update patches

* chore: script/gen-libc++-filenames.js

* Code Health: Clean up stale base::Feature "WinRetrieveSuggestionsOnlyOnDemand"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/6109477

* fix: empty suggestions with windows platform checker

Amends the fix from https://github.com/electron/electron/pull/29690
since the feature flag is no longer available. We follow the
same pattern as //chrome/browser/renderer_context_menu/spelling_menu_observer.cc
to generate the suggestion list on demand when context menu action
is invoked.

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* fixup! fix: empty suggestions with windows platform checker

* fixup! fix: empty suggestions with windows platform checker

* revert: 6078344: Code Health: Clean up stale MacWebContentsOcclusion | https://chromium-review.googlesource.com/c/chromium/src/+/6078344

* Revert "revert: 6078344: Code Health: Clean up stale MacWebContentsOcclusion | https://chromium-review.googlesource.com/c/chromium/src/+/6078344"

This reverts commit 9cacda452e.

* chore: bump to 133.0.6920.0, update patches

* Revert "6078344: Code Health: Clean up stale MacWebContentsOcclusion"

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/6078344

* fixup! Update PdfViewer Save File Picker to use showSaveFilePicker.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2025-01-10 10:52:34 -06:00
Charles Kerr
062d14e553 perf: cache whether or not ELECTRON_DEBUG_NOTIFICATIONS env var is set (#45143)
* perf: cache whether or not ELECTRON_DEBUG_NOTIFICATIONS env var is set

* chore: remove unused #include
2025-01-08 20:46:17 -06:00
Charles Kerr
59ed1db9a2 refactor: remove redundant CreateExtensionsClient() (#45135) 2025-01-08 10:36:08 -06:00
dependabot[bot]
da8288106b build(deps): bump github/codeql-action from 3.27.9 to 3.28.0 (#45090)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.27.9 to 3.28.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](df409f7d92...48ab28a6f5)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-06 15:11:28 -05:00
dependabot[bot]
679eb3c266 build(deps): bump actions/upload-artifact from 4.4.3 to 4.5.0 (#45089)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.4.3 to 4.5.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](b4b15b8c7c...6f51ac03b9)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2025-01-06 15:11:06 -05:00
David Sanders
c2d0a28fa2 ci: enable debugging mode when building electron_dist_zip (#45108) 2025-01-06 14:41:48 -05:00
John Kleinschmidt
2745771a22 test: reenable disabled GHA windows tests (#45062)
* test: renable GHA on Windows disabled tests

* test: close edge after shell.openExternal

* test: close edge sync after shell.openExternal
2024-12-20 14:49:55 -05:00
dependabot[bot]
1ecb2a2998 build(deps): bump actions/checkout from 4.1.6 to 4.2.2 (#45048)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.1.6 to 4.2.2.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](https://github.com/actions/checkout/compare/v4.1.6...11bd71901bbe5b1630ceea73d27597364c9af683)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-12-19 17:22:01 -05:00
electron-roller[bot]
e0f72dc332 chore: bump chromium to 133.0.6887.0 (main) (#44986)
* chore: bump chromium in DEPS to 133.0.6887.0

* chore: update render_widget_host_view_base.patch

trivial manual intervention needed due to header context shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5952851

* chore: update osr_shared_texture_remove_keyed_mutex_on_win_dxgi.patch

trivial manual intervention needed due to header context shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6068570

* chore: e patches all

* Remove ClipboardFormatType::GetType()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6075792

* Remove raw byte range methods from network::ResourceRequestBody

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6038757

* fix: update patches/chromium/fix_crash_loading_non-standard_schemes_in_iframes.patch:wq

Refs https://issues.chromium.org/issues/40092527

* fix: windows gn check

* chore: update patches/chromium/render_widget_host_view_base.patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2024-12-18 15:45:19 +09:00
George Xu
caf24ef417 fix: add patch to fix desktopCapturer.getSources not returning electron windows on Windows (#45000)
* fix: add patch to fix desktopCapturer.getSources not returning electron window on Windows

* add chromium link

* Update patches/chromium/fix_desktop_capturer_show_own_window.patch

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

* fix on electron side

* set flag to true

* wrong capturer

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2024-12-17 15:20:44 -08:00
dependabot[bot]
ff13bcd08d build(deps): bump github/codeql-action from 3.27.6 to 3.27.9 (#45047)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.27.6 to 3.27.9.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](aa57810251...df409f7d92)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-12-17 10:09:56 +01:00
Quinn
dc74092a09 fix: better prompt not supported message in window-setup.ts (#45017)
Update window-setup.ts

The message should simply read "is not supported" or, alternatively, "is not, and will not, be supported", but not "is and will not be supported".
2024-12-16 15:38:25 -05:00
Kavindu Udara
f89813401d docs: remove extra " (#45029)
remove extra "
2024-12-16 13:20:17 -05:00
Sam Maddock
3aa0014d23 fix: chrome.i18n unavailable in extension service workers (#45031)
https://chromium-review.googlesource.com/c/chromium/src/+/3362491
2024-12-16 09:46:20 -05:00
John Kleinschmidt
69479b2fb7 build: update build tools to correct sha (#45018)
chore: update build tools to correct sha
2024-12-13 17:26:25 -08:00
Jesper Ek
e2e71502b1 fix: custom spell-checker stuck in infinite loop (#45001)
`ReadUnicodeCharacter` updates index to the last character read, and not after it. We need to manually increment it to move to the next character.

It also doesn't validate that the index is valid, so we need to check that index is within bounds.

Refs: #44336
2024-12-13 11:47:29 -05:00
Samuel Attard
be1a3dce83 build: use github actions for windows (#44136)
* build: test windows runner

* build: try build windows on windows?

* build: take win/cross changes

* build: use bash as default shell always

* build: configure git for windows build tools

* build: bash as default

* build: configure windows correctly

* build: use sha1sum

* build: force windows cipd init and python3 existence

* just pain

* build: restore cache on windows

* build: use build-tools gclient

* build: sync gclient vars to build windows job

* build: output depshash for debugging

* build: past sam was a silly goose

* build: depshash logging

* build: force lf endings for lock and DEPS

* build: platform strings are hard

* build: checkout on windows host

* sup

* no check

* idk

* sigh

* ...

* no double checkout

* build: yolo some stuff

* build: run gn-check for windows on linux hosts for speed

* use container...

* cry ?

* build: e d

* e d

* no log

* fix toolchain on windows cross check

* build: use powershell to add mksnapshot_args

* build: enable x86 and arm64 windows builds too

* clean up

* maybe not needed

* build: keep action around for post step

* build: configure git global on win

* build: ia32 zip manifest

* build: no patch depot_tools for tests

* build: get arm64 windows closer to working

* build: windows tar is ass

* 32 bit on 32 bit

* maybe bash

* build: set up nodejs

* correct windows sharding

* fix some spec runner stuff

* fix windows tests

* overwrite -Force

* sigh

* screen res

* wat

* logs

* ... more logs

* line endings will be the death of me

* remove 1080p force thing

* vsctools + logging

* disable some fullscreen tests on GHA

* no progress

* run all CI

* install visual studio on arm64

* windows hax for non windows

* maybe arm sdk

* clean up depshash logic

* build: use single check per platform

* ensure clean args

* fix loop

* remove debug

* update default build image sha for dispatch

* plzzzz

* one more try

* arm64 vctools

* sad

* build: fix non-dispatch windows gn check

* chore: debug datadog-ci location

* chore: update build-tools for newer toolchain

* chore: set path for datadog-ci

* try this

* chore: fixup gn check

* fixup gn-check some more

* fixup windows gn check

* chore: fixup windows gn check

* test: use cmd for Windows testing

* fixup use cmd for testing on Windows

* fixup windows GN check

* fixup npm config arch for x86

* Can we set test files via powershell

* fixup to set test files via powershell

* fixup set test files via powershell

* Don't check cross instance cache disk space on Windows

* Use separate step to set env variables for testing

* fixup Use separate step to set env variables for testing

* fixup Use separate step to set env variables for testing

* fixup Use separate step to set env variables for testing (AGAIN)

* use powershell if in powershell

* fixup use powershell if in powershell

* chore: remove no longer needed changes to depot_tools

xref: https://chromium-review.googlesource.com/c/chromium/tools/depot_tools/+/5669094
and https://chromium-review.googlesource.com/c/chromium/src/+/5844046

* chore: try using 7zip on Windows to extract tarball

* Revert "chore: try using 7zip on Windows to extract tarball"

This reverts commit c7432b6a37.

* test: debug failing tests on GHA windows

* fix: ftbfs when including simdjson in Node.js

(cherry picked from commit 48e44c40d6)

* chore: try to track down Windows testing hang

* use correct timeout

* try this

* see if this helps

* try to figure out why node is running

* shard tests to try to narrow down WOA lockup

* try to narrow down problem test

* Narrow down blocking test more

* do we need a combo to repro

* see if this cleans up the tests

* fixup navigator.usb test

* remove logging from problematic tests

* Revert "shard tests to try to narrow down WOA lockup"

This reverts commit a180658376.

* remove logging

* debug keyboard test

* add timeout for Windows since arm64 sometimes hangs

* see if this helps

* put back original timeout

* try to use screenCapture to get screenshots of what is going on on WOA

* try using electron screencapture to debug WOA hang

* chore: turn off privacy experience

* run screenshot on both shards

* fixup screencap

* try to narrow down hanging spec

* chore: cleanup servers left open

* cleanup tests

* Revert "try to narrow down hanging spec"

This reverts commit a0f959f538.

* cleanup test debugging

* fixup extensions spec

* cleanup unneeded items

* run wtf with 2 shards instead of 6

* Revert "run wtf with 2 shards instead of 6"

This reverts commit ca2d282129.

* debug windows version on woa

* dump more info

* Get detailed CPU info

* revert debugging

* use same args as AppVeyor WOA for GHA WOA

* fixup use same args as AppVeyor WOA for GHA WOA

* fixup use same args as AppVeyor WOA for GHA WOA

* try to track down which tests trigger hang

* one or more of these combinations should hang

* break up web contents spec to find hang

* further break down api-web-contents to find hang

* test: ensure all webContents are closed

* test: fix require is not defined error

* see if api-web-contents spec is now good

* test: ensure all webContents are closed

* Revert "try to track down which tests trigger hang"

This reverts commit 07298d6ffe.

* chore: use alternate location for windows toolchain

* Reapply "try to track down which tests trigger hang"

This reverts commit 0321f76d01.

* try to narrow down problem test

* fix TEST_SHARD env var

* no, really fix TEST_SHARD env var

* see if this fixes it

* test: cleanup any remaining windows and webcontents

* see if new cleanup helps

* dont destroy webcontents for now

* fixup dont destroy webcontents for now

* Only cleanup right before process.exit

* see if this fixes the hang

* actually destroy webcontents

* Revert "Reapply "try to track down which tests trigger hang""

This reverts commit cdee7de049.

* see if this helps

* Revert "see if this helps"

This reverts commit 9a15a69cf7.

* Is it all about the web contents?

* it is all about the webcontents

but which one?

* Narrow down problem webcontents test

* try to speed up git install on WOA

* disable problematic test on WOA

* remove debugging

* remove debugging from choco installs

* Revert "disable problematic test on WOA"

This reverts commit e060fb0839.

* Revert "remove debugging"

This reverts commit f18dd8b1a5.

* run against all the tests in the failing shard

* don't run visibility tests first

* remove debugging

* 3 is a magic number

* Revert "3 is a magic number"

This reverts commit 36b91ccf9f.

* match what Appveyor runs exactly

* Revert "match what Appveyor runs exactly"

This reverts commit 7260dd4322.

* chore: sort files alphabetically

* find out what spec is leaving stuff open

* chore: Checkout PR HEAD commit

 instead of merge commit

* try using app.exit instead of process.exit

* test: cleanup BrowserWindows and webContents

* Revert "chore: sort files alphabetically"

This reverts commit d9e217ffb1.

* chore: use win32 to match process.platform

Needed for build-tools to download from PRs

* chore: cache yarn dir

* fixup cache yarn

* fixup use win32 to match process.platform

* fixup use win32 to match process.platform

* fixup cache yarn

* Add debugging for WOA hang

* Add debugging for failing keyboard lock test

* Revert "Add debugging for WOA hang"

This reverts commit 8df03d568d.

* try using process.kill

* add more debugging to keyboard.lock test

* Revert "Add debugging for failing keyboard lock test"

* remove debugging

* test: disable keyboard.lock on Windows

* test: disable fullscreen tests on Windows

* test: only force test suite exit on WOA

* fixup test: only force test suite exit on WOA

* cleanup tests

* extract yarn caching/install to action

* try using bash to run windows tests

* remove left over debugging

* standardize on 'win' for Windows builds

* use 'x86' for arch for manifest files

* fixup try using bash to run windows tests

* fixup use 'x86' for arch for manifest files

* standardize on 'win' for Windows builds

* fixup use 'x86' for arch for manifest files

* fixup try using bash to run windows tests

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-12-12 11:51:24 -05:00
Alice Zhao
a5b4339884 fix: add missing index arg in navigationHistory.canGoToOffset (#44989)
fix: add missing arg
2024-12-12 10:56:27 -05:00
Sam Maddock
6961e9458a chore: update vm module warning (#44985)
* chore: update vm module warning

* Update lib/renderer/init.ts

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2024-12-11 17:22:50 -05:00
electron-appveyor-updater[bot]
2191e9b8e1 build: update appveyor image to latest version (#44992)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-12-11 13:27:21 -05:00
Sam Maddock
2c698d3f75 fix: context-menu emitted twice (#44978)
* fix: context-menu emitted twice

* refactor: simplify disabling draggable regions

* cleanup
2024-12-11 11:42:48 -05:00
electron-roller[bot]
cf5a4640f5 chore: bump chromium to 133.0.6878.0 (main) (#44831)
* chore: bump chromium in DEPS to 133.0.6858.0

* chore: bump chromium in DEPS to 133.0.6860.0

* chore: update patches

v8/revert_fastapi_remove_dynamic_overload_resolution.patch had some additions due to https://chromium-review.googlesource.com/c/v8/v8/+/6023139

* 6044060: Reland "Moves shared GN templates into //build/config/apple."
https://chromium-review.googlesource.com/c/chromium/src/+/6044060

* Revert "6023139: [fastapi] Add support for attribute setters"
https://chromium-review.googlesource.com/c/v8/v8/+/6023139

* Update printing.patch

The removed include is present in the original source file now, just slightly before where it was being added.

6015430: Reduce platform-like buildflags in sandbox code
Refs: https://chromium-review.googlesource.com/c/chromium/src/+/6015430

* 6039836: Migrate Command::IsMediaKey to be a member of ui::Accelerator
https://chromium-review.googlesource.com/c/chromium/src/+/6039836

* 6038659: [CodeHealth] Clean up the feature ZstdContentEncoding
https://chromium-review.googlesource.com/c/chromium/src/+/6038659

* chore: bump chromium in DEPS to 133.0.6862.0

* chore: update patches

* 72747: crypto: switch to C++
https://boringssl-review.googlesource.com/c/boringssl/+/72747

* fixup! 72747: crypto: switch to C++ https://boringssl-review.googlesource.com/c/boringssl/+/72747

* chore: gen libc++ filenames

* 6042601: [shared storage] Implement with_lock option for methods from response headers
https://chromium-review.googlesource.com/c/chromium/src/+/6042601

* chore: bump chromium in DEPS to 133.0.6864.0

* chore: bump chromium in DEPS to 133.0.6866.0

* chore: bump chromium in DEPS to 133.0.6868.0

* chore: bump chromium in DEPS to 133.0.6870.0

* chore: bump chromium in DEPS to 133.0.6872.0

* chore: bump chromium in DEPS to 133.0.6874.0

* chore: bump chromium in DEPS to 133.0.6876.0

* 6039992: Fix false activation logic for context menu. | https://chromium-review.googlesource.com/c/chromium/src/+/6039992

* chore: update patches

* chore: update patches

* chore: bump chromium in DEPS to 133.0.6878.0

* chore: update patches

* [Build] Organize //components/dbus into a single component

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6055280

* Merge //components/dbus/* into a single //components/dbus, which
  matches how most components are organized. This avoids having
  many small shared libraries which incurs unnecessary overhead.
* Limit visibility of //components/dbus/* to //components/dbus

* fixup! Update _LIBCPP_ABI_VERSION to always have a default value while keeping unstable false due to changes in llvm https://github.com/llvm/llvm-project/pull/112094

* 6040416: Let s know which widget the input came on. | https://chromium-review.googlesource.com/c/chromium/src/+/6040416

* 6056267: [MPArch guest view] Fix authentication for MPArch guests | https://chromium-review.googlesource.com/c/chromium/src/+/6056267

* make_span() is deprecated: https://issues.chromium.org/issues/341907909

* fixup: https://issues.chromium.org/issues/341907909

* chore: delete extra bracket from removing make_span commit

* fixup: 6059305: Make WTF::UTF8ConversionMode a scoped enum | https://chromium-review.googlesource.com/c/chromium/src/+/6059305

* 6051058: CookieInclusionStatus: Remove ctors which bypass invariants | https://chromium-review.googlesource.com/c/chromium/src/+/6051058

* 6038981: Remove most remaining CHECK(false)s | https://chromium-review.googlesource.com/c/chromium/src/+/6038981

* build: use third_party/simdutf in Node.js

* chore: node ./script/gen-libc++-filenames.js

* chore: fix strict-cast conversion error in subspan()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6044946

* chore: fix strict-cast conversion error in base::as_bytes()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6044946

* chore: fix strict-cast conversion error in span.split_at()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/6044946

* chore: use shorthand target name

* chore: better docs in build_add_public_config_simdutf_config.patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-12-10 13:16:07 -06:00
dependabot[bot]
3bd5f14cee build(deps): bump github/codeql-action from 3.27.5 to 3.27.6 (#44981)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.27.5 to 3.27.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f09c1c0a94...aa57810251)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-12-10 11:52:27 +01:00
dependabot[bot]
7462d449e0 build(deps): bump mikefarah/yq from 4.44.5 to 4.44.6 (#44980)
Bumps [mikefarah/yq](https://github.com/mikefarah/yq) from 4.44.5 to 4.44.6.
- [Release notes](https://github.com/mikefarah/yq/releases)
- [Changelog](https://github.com/mikefarah/yq/blob/master/release_notes.txt)
- [Commits](bc5b54cb1d...4839dbbf80)

---
updated-dependencies:
- dependency-name: mikefarah/yq
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-12-10 11:51:25 +01:00
Calvin
82ea3faae5 docs: update security scoped bookmarks info (#44968) 2024-12-09 10:44:43 -08:00
Charles Kerr
578c1e5dae fix: build failure when PDF viewer is disabled (#44960)
* fix: unused variable warning when the PDF viewer is disabled

* fix: unused function error  when PDF viewer is disabled

error: unused function ParseManifest [-Werror,-Wunused-function]
2024-12-06 17:54:04 +09:00
Shelley Vohr
208dc568d8 fix: context-menu event with BaseWindows (#44940)
fix: context-menu event with BaseWindows
2024-12-04 13:35:28 -08:00
Felix Rieseberg
687a59b43b feat: Add shared dictionary management APIs (#44750)
* Add bare-bones GetSharedDictionaryUsageInfo

* Add GetSharedDictionaryInfo()

* Improve API, use isolation keys

* Add documentation

* Update docs/api/session.md

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

* Update shell/browser/api/electron_api_session.cc

Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>

* Add tests

* Implement feedback <3

* Improve tests

* chore: lint

* docs: add note about clearing cache in ses.clearData

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
Co-authored-by: Samuel Attard <samuel.r.attard@gmail.com>
Co-authored-by: alice <alice@makenotion.com>
2024-12-04 12:25:11 -05:00
Charles Kerr
158a87d494 fix: modernize-use-equals-default warnings (#44935)
fix: use '= default' to define a trivial destructor [modernize-use-equals-default]
2024-12-03 16:25:48 -06:00
Shelley Vohr
229c2a8f50 chore: make version parsing more tolerant (#44918)
* chore: make version parsing more tolerant

* Update .github/workflows/issue-opened.yml

Co-authored-by: Niklas Wenzel <dev@nikwen.de>

---------

Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2024-12-03 17:03:43 -05:00
Niklas Wenzel
5324c0e6c3 docs: fix grammar in app.relaunch docs (#44920) 2024-12-03 09:56:09 -08:00
Sam Maddock
2222920429 feat: WebFrameMain.collectJavaScriptCallStack() (#44204)
* feat: WebFrameMain.unresponsiveDocumentJSCallStack

* Revert "feat: WebFrameMain.unresponsiveDocumentJSCallStack"

This reverts commit e0612bc1a00a5282cba5df97da3c9c90e96ef244.

* feat: frame.collectJavaScriptCallStack()

* feat: frame.collectJavaScriptCallStack()

* Update web-frame-main.md
2024-12-03 13:32:24 +09:00
Charles Kerr
6d4c271268 chore: remove unused registry arg from GetPrivilegeRequiredByUrl() (#44908)
this has never been used; introduced by 91071570
2024-12-02 14:02:47 -05:00
Niklas Wenzel
c6b4bde7b5 docs: clarify what session.clearData() with data type 'cache' deletes (#44852)
* docs: clarify what session.clearData() with data type 'cache' deletes

* docs: include `shadercache`, too

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>

---------

Co-authored-by: John Kleinschmidt <kleinschmidtorama@gmail.com>
2024-12-02 13:50:35 -05:00
Niklas Wenzel
bba9ee1cb8 docs: clarify session.clearData() can delete more types than listed (#44851)
docs: warn that session.clearData() might delete more than expected
2024-12-02 13:29:25 -05:00
Charles Kerr
a7fa6e89b5 chore: remove unused arg from BaseWindow::GetBackgroundColor() (#44906)
chore: remove unused gin_helper::Arguments* arg from BaseWindow::GetBackgroundColor()

looks like this was added in db79734b but never used
2024-12-02 11:39:10 -05:00
Charles Kerr
06612cf5d4 chore: remove unused isolate argument from Cookies constructor (#44907)
* chore: remove unused isolate argument from Cookies constructor

unused since the ginify cookies refactor in Mar 2020, commit 22202255

* fix: constructor only takes one arg now, so mark it explicit
2024-12-02 11:34:21 -05:00
electron-appveyor-updater[bot]
49b294628c build: update appveyor image to latest version (#44840)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-12-02 11:14:41 -05:00
Charles Kerr
493e3c4537 fix: don't use deprecated ui::MouseEvent constructor (#44868)
* refactor: do not use deprecated gfx::Point constructor for MouseEvent

Deprecated in https://chromium-review.googlesource.com/c/1444251

* refactor: use WebInputEvent::GetTypeAsUiEventType() instead of rolling our own

Added in https://chromium-review.googlesource.com/c/chromium/src/+/2180291
2024-12-02 11:13:38 -05:00
Charles Kerr
b2ce5296af fix: remove unused id argument from TranslateToStock() (#44900)
unused since fb537d91fc
2024-12-01 16:34:48 -06:00
illusory-dream
4e40b49d1a docs: fix a syntax issue in document breaking changes (#44841)
fix: syntax issue in docs
2024-11-30 21:44:33 -08:00
Niklas Wenzel
d8149aa376 docs: specify default value for respondToAuthRequestsFromMainProcess (#44855)
docs: specify default value for respondToAuthRequestsFromMainProcess
2024-11-30 21:33:33 -08:00
Charles Kerr
033a0abb59 refactor: reduce scope of relauncher's internal constants (#44860)
* refactor: make kRelauncherArgSeparator private to relauncher.cc

* refactor: make kRelauncherTypeArg private to relauncher.cc

* refactor: remove unused type relauncher::CharType

* refactor: move private constants into standalone private namespace

* refactor: move kWaitEventName into the only function that uses it
2024-11-30 06:54:40 -06:00
Shelley Vohr
8f00cc9c0e build: remove context-aware patch (#44862) 2024-11-29 11:45:33 -06:00
Charles Kerr
f7e823ac80 refactor: return-braced-init-list pt 2 of 2 (#44870)
* refactor: more return-braced-init-list, this time for v8 and gin objects

* refactor: more return-braced-init-list, this time for v8, gin, std, and base objects
2024-11-29 11:44:33 -06:00
Charles Kerr
4a695d07c6 fix: misc-use-internal-linkage warnings (#44843)
* refactor: misc-use-internal-linkage warnings in context bridge

move impl functions into anonymous namespace so that they're not visible
to other compilation units:

- ExposeAPIInWorld()
- IsCalledFromMainWorld()
- OverrideGlobalPropertyFromIsolatedWorld()
- OverrideGlobalValueFromIsolatedWorld()
- TraceKeyPath()

* refactor: misc-use-internal-linkage warnings in skia util

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- struct ScaleFactorPair
- kScaleFactorPairs[]
- GetScaleFactorFromPath()
- AddImageSkiaRepFromPath()

* refactor: misc-use-internal-linkage warnings in printing util

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- GetFullPagePlugin()

* refactor: misc-use-internal-linkage warnings in blijnk converter

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- GetKeyLocationCode()
- ModifiersToArray()

* refactor: misc-use-internal-linkage warnings in extrension system

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- ParseManifest()

* refactor: misc-use-internal-linkage warnings in skia util

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- GetFrameTokenMap()
- GetFrameTreeNodeIdMap()

* refactor: misc-use-internal-linkage warnings in electron_api_utility_process.cc

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- GetAllUtilityProcessWrappers()

* refactor: misc-use-internal-linkage warnings in electron_api_menu

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- InvokeBoolMethod()

* refactor: misc-use-internal-linkage warnings in platform util

move impl details into anonymous namespace so that they're not visible
to other compilation units:

- struct TrashItemResult
- TrashItemOnBlockingThread()
2024-11-27 10:40:39 -06:00
Charles Kerr
4aa1855e39 refactor: use base::Extend in AddAdditionalSchemes() (#44839) 2024-11-27 07:55:54 -06:00
Charles Kerr
f595443a22 refactor: fix modernize-return-braced-init-list warnings (#44838)
* refactor: avoid repeating the return type from the declaration; use a braced initializer list instead [modernize-return-braced-init-list]

* refactor: avoid repeating the return type from the declaration; use a braced initializer list instead [modernize-return-braced-init-list]

NB: using the braced-initializer list uncovered an error here:
the float returned by std::floor() can't be implicitly cast to
an int. This is solved by using base::ClampFloor<int>() instead.
std::floor()
2024-11-27 09:41:46 +09:00
dependabot[bot]
9f1e23c405 build(deps): bump github/codeql-action from 3.27.4 to 3.27.5 (#44837)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.27.4 to 3.27.5.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](ea9e4e3799...f09c1c0a94)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-26 11:26:35 +01:00
Charles Kerr
93f49d1189 fix: modernize-use-using clang-tidy warnings (#44806) 2024-11-25 10:50:33 -05:00
Charles Kerr
3c941c7e8f fix: modernize-avoid-c-arrays (#44813)
use string_view for constants used in methods that take string_view args
2024-11-25 10:49:58 -05:00
Charles Kerr
024fee4e44 fix: modernize-use-nodiscard clang-tidy warnings (#44808) 2024-11-25 10:48:28 -05:00
electron-roller[bot]
7e7010dacf chore: bump chromium to 133.0.6852.0 (main) (#44748)
* chore: bump chromium in DEPS to 133.0.6847.0

* chore: bump chromium in DEPS to 133.0.6848.0

* chore: update patches

* implement extensions::GlobalShortcutListener::ExecuteCommand stub

https://chromium-review.googlesource.com/c/chromium/src/+/5871484

* fix: ismediakey patch, oops

* fix: another missing bracket

* chore: bump chromium in DEPS to 133.0.6850.0

* chore: update patches

* SharedStorageOperationPtr -> SharedStorageModifierMethodPtr

https://chromium-review.googlesource.com/c/chromium/src/+/5990970

* build GlobalShortcutListenerLinux

https://chromium-review.googlesource.com/c/chromium/src/+/5871484

* chore: bump chromium in DEPS to 133.0.6851.0

* fix: include full type for network::mojom::SharedStorageModifierMethod

* chore: update patches

* chore: bump chromium in DEPS to 133.0.6852.0

* chore: update patches

* build: remove duplicated icudtl.dat and snapshot_blob.bin

https://chromium-review.googlesource.com/c/chromium/src/+/5999387

* fix: include static methods in node tests involving call stacks

https://chromium-review.googlesource.com/c/v8/v8/+/5907815

* revert: moved code in picture-in-picture.patch

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2024-11-25 10:45:47 -05:00
Ajay Kemparaj
fbe01cdc16 docs: correct stable release dates for v34.0.0 (#44807)
* docs: correct stable release dates for v34.0.0

* docs: correct stable release dates for v34.0.0
2024-11-25 10:43:56 -05:00
Niklas Wenzel
b8b2e12c9c docs: fix wording in auto-updater.md (#44787)
* docs: fix wording in auto-updater.md

* docs: update wording

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2024-11-24 13:00:42 -08:00
Charles Kerr
94a65df270 refactor: remove unnecessary constructor code (#44816) 2024-11-24 08:55:46 -06:00
Charles Kerr
24df5f96d7 fix: remove unused local variables (#44815)
* chore: remove unused local non-trivial variable relaunch_executable

became unused in June 2016 in 0d066de5

* chore: only declare program_name local variable if used

We declared it everywhere but only used it on Windows

* chore: remove unused local non-trivial variable path from UnregisterXWindow

it became unused in 2020 by 72a08926
2024-11-23 17:34:51 -06:00
David Sanders
4a3513377c docs: update new GitHub issue link (#44791) 2024-11-22 11:48:59 -08:00
Savely Krasovsky
c5ea177b3d feat: add query-session-end and improve session-end events on Windows (#44598)
* feat: add query-session-end event for Windows

* fix: remove debug line

* feat: notify with reason on session-end

* docs: add comments and return params

* docs: add same docs to the BrowserWindow

* fix: add shutdown reason if lParam == 0

* docs: remove 'force' word

* docs: revert multithreading.md change

* docs: add reasons documentation, reason variable renamed to reasons

* docs: improve 'shutdown' reason wording

* docs: reword with 'can be'

* fix: pass reasons by reference

* fix: use newer approach which expose reasons value directly on Event object

* docs: add escaping

* style: linter fixes

* fix: project now should compile

* fix: EmitWithoutEvent method added, EmitWithEvent moved to private again

* docs: typo fix

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>

* docs: dedicated WindowSessionEndEvent type created

* docs: better wording for session-end event description

Co-authored-by: Will Anderson <will@itsananderson.com>

---------

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>
Co-authored-by: Will Anderson <will@itsananderson.com>
2024-11-22 11:47:36 -08:00
Shelley Vohr
0285592d61 fix: crash calling shell.readShortcutLink (#44784)
fix: crash calling shell.readShortcutLink
2024-11-22 09:37:17 -05:00
Shelley Vohr
86e4529d26 fix: ensure context-menu emitted for draggable regions (#44761)
* fix: ensure context-menu emitted for draggable regions

* chore: address suggestions from review
2024-11-22 12:33:38 +01:00
Charles Kerr
4fd1b5b186 fix: big endian bug in V8 serialization (#44776) 2024-11-22 12:04:53 +01:00
BILL SHEN
1d55eb9a45 build: remove duplicate line in gn file (#44786)
style: remove duplicate line in gn file
2024-11-22 12:03:49 +01:00
Charles Kerr
0005ae9557 docs: sync 34.0.0 release date to Chromium 132 release date (#44766) 2024-11-21 10:51:19 -06:00
Charles Kerr
86962ba2c3 fix: clang-tidy performance-inefficient-vector-operation warnings (#44743)
* fix: performance-inefficient-vector-operation warning in Clipboard::WriteFilesForTesting()

* fix: performance-inefficient-vector-operation warning in GetUploadedReports()
2024-11-20 18:11:00 -06:00
Charles Kerr
6789431f74 fix: performance-no-automatic-move clang-tidy warnings (#44742)
* fix: performance-no-automatic-move in GetLogFileName()

remove `const` from log_filename.

Warning fixed by this commit:

../../electron/shell/common/logging.cc:40:12: warning: constness of 'log_filename' prevents automatic move [performance-no-automatic-move]

* fix: performance-no-automatic-move in GetBundleResourcePath()

remove `const` from request_relative_path.

Warning fixed by this commit:

electron/shell/browser/extensions/electron_extensions_browser_client.cc:187:10: warning: constness of 'request_relative_path' prevents automatic move [performance-no-automatic-move]
2024-11-20 18:10:30 -06:00
nilaoda
0ea64850af fix: windows save dialog extension bug (#44296)
* fix: windows save dialog extension bug

* refactor: simplify firstSpec extraction

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* refactor: split when necessary

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>
2024-11-20 17:27:49 -05:00
Den Delimarsky
769b045c8b docs: removes redundant phrasing in the code signing documentation (#44716)
Update code-signing.md
2024-11-20 16:41:01 -05:00
Charles Kerr
85e2622b68 refactor: use gdk_display_beep() on Linux (#44734)
* refactor: use gdk_display_beep() to beep on Linux

* chore: make a stub declaration for gdk_display_beep()

* chore: remove unused file electron_gtk.sigs

* chore: remove unused #includes to make gn check happy
2024-11-20 16:24:59 -05:00
electron-appveyor-updater[bot]
15c3064780 build: update appveyor image to latest version (#44751)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-11-20 16:18:01 -05:00
Shelley Vohr
f95e1d8ea0 chore: fix textured window conditional on macOS (#44728) 2024-11-20 10:34:46 -06:00
Shelley Vohr
eba0edf81e build: allow unbundling of Node.js dependencies (#44754) 2024-11-20 11:34:37 -05:00
Sam Maddock
8223ebc111 test: run script to help target discovery and reduce flakes (#44741) 2024-11-20 08:55:09 -06:00
Shelley Vohr
54d53bfa51 fix: tooltips in WCO caption buttons (#44721)
fix: tooltips in WCO capton buttons
2024-11-20 12:45:08 +01:00
dependabot[bot]
8ed48e2295 build(deps): bump mikefarah/yq from 4.44.3 to 4.44.5 (#44714)
Bumps [mikefarah/yq](https://github.com/mikefarah/yq) from 4.44.3 to 4.44.5.
- [Release notes](https://github.com/mikefarah/yq/releases)
- [Changelog](https://github.com/mikefarah/yq/blob/master/release_notes.txt)
- [Commits](bbdd97482f...bc5b54cb1d)

---
updated-dependencies:
- dependency-name: mikefarah/yq
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-20 10:49:50 +01:00
electron-roller[bot]
43ed763f18 chore: bump chromium to 133.0.6846.0 (main) (#44665)
* chore: bump chromium in DEPS to 133.0.6836.0

* chore: bump chromium in DEPS to 133.0.6838.0

* chore: update patches

* 6006096: [Sync ESB] Integrate Chrome Toast UI

https://chromium-review.googlesource.com/c/chromium/src/+/6006096

* Confine enable_device_bound_sessions buildflag to //net

https://chromium-review.googlesource.com/c/chromium/src/+/6014679

* revert [api] Delete deprecated struct FastApiTypedArray

 https://chromium-review.googlesource.com/c/v8/v8/+/5982984
Also
https://chromium-review.googlesource.com/c/v8/v8/+/5979766/1

* fixup revert [api] Delete deprecated struct FastApiTypedArray

* Migrate remaining NOTREACHED()s in chrome/

https://chromium-review.googlesource.com/c/chromium/src/+/5998172

* [Reland][Extensions] Remove ExtensionHostDelegate::GetJavaScriptDialogManager()

https://chromium-review.googlesource.com/c/chromium/src/+/6020106

* Remove NOTREACHED_IN_MIGRATION()

https://chromium-review.googlesource.com/c/chromium/src/+/6021996

* Remove Lock screen apps [#8] : remove lock screen extension

https://chromium-review.googlesource.com/c/chromium/src/+/6005846

* Reland "Add CrashReporterClient::GetProductInfo(ProductInfo*)"

https://chromium-review.googlesource.com/c/chromium/src/+/6012631

* Ozone/Wayland: remove lacros specific window states

https://chromium-review.googlesource.com/c/chromium/src/+/6011215

* chore: bump chromium in DEPS to 133.0.6840.0

* chore: bump chromium in DEPS to 133.0.6841.0

* chore: bump chromium in DEPS to 133.0.6844.0

* implement virtual WebContents::CanUserEnterFullscreen

* OnSearchifyStateChange -> OnSearchifyStarted

* regen libc++ filenames

* chore: bump chromium in DEPS to 133.0.6846.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Samuel Maddock <smaddock@slack-corp.com>
2024-11-19 19:52:20 -08:00
Charles Kerr
ac61c74ddc fix: bugprone-narrowing-conversions warnings in NativeImage (#44708)
* fix: bugprone-narrowing-conversions warning in NativeImage::memory_usage_

- fix signed / unsigned math by using base/numerics/safe_conversions

- make memory_usage_ an int64_t so it can safely take the size_t
  returned by computeByteSize()

Warning fixed by this commit:

../../electron/shell/common/api/electron_api_native_image.cc:155:26: warning: narrowing conversion from 'size_t' (aka 'unsigned long') to signed type 'int32_t' (aka 'int') is implementation-defined [bugprone-narrowing-conversions]
  155 |       new_memory_usage = image_skia->bitmap()->computeByteSize();

* fix: bugprone-narrowing-conversions warnings in NativeImage::CreateFromBitmap()

`SkImageInfo::MakeN32()` and `SkBitmap::allocN32Pixels()` both take int
width and height args, but we were feeding them unsigned ints.

../../electron/shell/common/api/electron_api_native_image.cc:508:36: warning: narrowing conversion from 'unsigned int' to signed type 'int' is implementation-defined [bugprone-narrowing-conversions]
  508 |   auto info = SkImageInfo::MakeN32(width, height, kPremul_SkAlphaType);
      |                                    ^
../../electron/shell/common/api/electron_api_native_image.cc:508:43: warning: narrowing conversion from 'unsigned int' to signed type 'int' is implementation-defined [bugprone-narrowing-conversions]
  508 |   auto info = SkImageInfo::MakeN32(width, height, kPremul_SkAlphaType);
      |                                           ^
../../electron/shell/common/api/electron_api_native_image.cc:524:25: warning: narrowing conversion from 'unsigned int' to signed type 'int' is implementation-defined [bugprone-narrowing-conversions]
  524 |   bitmap.allocN32Pixels(width, height, false);
      |                         ^
../../electron/shell/common/api/electron_api_native_image.cc:524:32: warning: narrowing conversion from 'unsigned int' to signed type 'int' is implementation-defined [bugprone-narrowing-conversions]
  524 |   bitmap.allocN32Pixels(width, height, false);
      |                                ^
../../electron/shell/common/api/electron_api_native_image.cc:528:48: warning: narrowing conversion from 'double' to 'float' [bugprone-narrowing-conversions]
  528 |       gfx::ImageSkia::CreateFromBitmap(bitmap, scale_factor);
2024-11-19 16:04:18 -06:00
Charles Kerr
1cf5e6d88c fix: cyclical #include dependency between autofill_popup.h and autofill_popup_view.h (#44705)
fix: AutofillPopup warning: use '= default' to define a trivial default constructor [modernize-use-equals-default]

refactor: reduce #indclude scope in autofill_popup.h and autofill_popup_view.h
2024-11-19 13:45:18 -06:00
Robo
48c9149a52 fix: utility process exit code for graceful termination (reland) (#44726)
* chore: reland "fix: utility process exit code for graceful termination"

This reverts commit 1cae73ba09.

* fix: exit code on posix when killed via api

* chore: fix code style
2024-11-20 02:48:15 +09:00
Robo
0d6743e79b fix: destroy url loader wrapper when JS env exits (#44574)
* fix: destroy url loader wrapper when JS env exits

* Revert "fix: destroy url loader wrapper when JS env exits"

This reverts commit 419151a98a16814ea63e9abc197c6ae27f48128c.

* Revert "Revert "fix: destroy url loader wrapper when JS env exits""

This reverts commit 4b401b03c62aca79498660f995825491ae52f179.

* fix: double free of JSChunkedDataPipeGetter

* fix: crash on process exit after stream completes
2024-11-19 11:32:48 -05:00
Shelley Vohr
7a5e9613d2 build: rework header generation in Node.js (#44657)
* build: rework header generation in Node.js

* build: fix patch location error

* fix: set --root-dir correctly
2024-11-19 10:57:38 -05:00
dependabot[bot]
9d1be5f824 build(deps): bump the npm_and_yarn group across 2 directories with 1 update (#44701)
Bumps the npm_and_yarn group with 1 update in the / directory: [cross-spawn](https://github.com/moxystudio/node-cross-spawn).
Bumps the npm_and_yarn group with 1 update in the /spec directory: [cross-spawn](https://github.com/moxystudio/node-cross-spawn).


Updates `cross-spawn` from 7.0.3 to 7.0.6
- [Changelog](https://github.com/moxystudio/node-cross-spawn/blob/master/CHANGELOG.md)
- [Commits](https://github.com/moxystudio/node-cross-spawn/compare/v7.0.3...v7.0.6)

Updates `cross-spawn` from 7.0.3 to 7.0.6
- [Changelog](https://github.com/moxystudio/node-cross-spawn/blob/master/CHANGELOG.md)
- [Commits](https://github.com/moxystudio/node-cross-spawn/compare/v7.0.3...v7.0.6)

---
updated-dependencies:
- dependency-name: cross-spawn
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: cross-spawn
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-19 15:06:42 +01:00
Shelley Vohr
4b3d1caae4 fix: improve single-pixel resize handling on Windows (#44700)
Co-authored-by: Niklas Wenzel <dev@nikwen.de>
2024-11-19 13:24:07 +01:00
dependabot[bot]
2cea2282eb build(deps): bump slackapi/slack-github-action from 1.27.0 to 2.0.0 (#44715)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 1.27.0 to 2.0.0.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](37ebaef184...485a9d42d3)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-type: direct:production
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-19 11:45:56 +01:00
dependabot[bot]
8efc4c7a56 build(deps): bump github/codeql-action from 3.27.1 to 3.27.4 (#44713)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.27.1 to 3.27.4.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4f3212b617...ea9e4e3799)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-19 11:45:09 +01:00
David Sanders
febf305a4f chore: fix unsupported major comment in issue automation (#44706) 2024-11-19 10:52:08 +01:00
Robo
1cae73ba09 chore: Revert "fix: utility process exit code for graceful termination" (#44717)
Revert "fix: utility process exit code for graceful termination (#44698)"

This reverts commit 36e1a0bf00.
2024-11-18 22:13:23 -06:00
Will Anderson
10d967028a docs: Make ipcRenderer and ipcMain listener API docs consistent (#44651)
* docs: Make ipcRenderer and ipcMain listener API docs consistent

* test: add some unit tests for ipcRenderer/ipcMain listener behavior

* fix: Mark on/off methods as primary and addListener/removeListener as aliases

* fix: clear all listeners before running ipcMain removeAllListeners tests
2024-11-18 14:44:30 -08:00
Niklas Wenzel
aa7a5e6ca9 docs: document why to use the loadBrowserProcessSpecificV8Snapshot fuse (#44680)
Fixes #44450
2024-11-18 14:36:41 -08:00
Shelley Vohr
58dc990f7a chore: fix multi-version parsing in issue assignment (#44679)
* chore: fix multi-version parsing

* chore: tweak for review
2024-11-18 21:25:20 +01:00
Robo
36e1a0bf00 fix: utility process exit code for graceful termination (#44698) 2024-11-18 23:57:06 +09:00
Shelley Vohr
d320840a54 build: re-enable container_overflow ASAN check (#44699)
build: re-enable container_overflow ASAN check
2024-11-18 09:22:17 -05:00
Shelley Vohr
dd50afa8c2 fix: utilityProcess pid should be undefined after exit (#44677)
fix: utilityProcess pid should be undefined after exit
2024-11-18 10:06:27 +01:00
electron-appveyor-updater[bot]
15ff999bdc build: update appveyor image to latest version (#44675)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-11-15 14:54:00 -05:00
Shelley Vohr
a15e42e9ff chore: cleanup following internal switch to readPackageJSON (#44644)
chore: cleanup following internal switch to readPackageJSON
2024-11-15 11:36:18 -05:00
Sam Maddock
aca84be970 chore: update extensions features (#44653)
* chore: update extensions features

* restore header
2024-11-15 11:32:43 -05:00
Robo
4fb5aab2ef fix: revert required portal version for file chooser dialogs (#44426)
* feat: add support for configuring xdg portal version at runtime

* doc: update command-line-switches.md

* doc: update command-line-switches.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* doc: required portal version for defaultPath support

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

* doc: update more occurrances

* fix: remove warning from save dialogs

* doc: update command-line-switches.md

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-11-15 09:31:33 -05:00
Shelley Vohr
27fe6cc97f fix: WebContentsView removal should compare directly (#44656)
* fix: WebContentsView removal should compare directly

* fixup view comparision

* chore: use erase_if

* Apply review suggestions

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-11-14 22:11:20 -05:00
electron-roller[bot]
b1957f52e3 chore: bump chromium to 132.0.6834.0 (main) (#44602)
* chore: bump chromium in DEPS to 132.0.6827.0

* chore: bump chromium in DEPS to 132.0.6828.0

* chore: bump chromium in DEPS to 132.0.6830.0

* chore: bump chromium in DEPS to 132.0.6832.0

* chore: bump chromium in DEPS to 132.0.6834.0

* chore: update chromium patches

* 5977022: Apply os setting of overlay scrollbar to web instances | https://chromium-review.googlesource.com/c/chromium/src/+/5977022

* 5991440: Cleanup //ui/compositor from LaCros support code. | https://chromium-review.googlesource.com/c/chromium/src/+/5991440

* chore: update all patches

* 6000058: Add base_subdirs to file_chooser.mojom NativeFileInfo | https://chromium-review.googlesource.com/c/chromium/src/+/6000058

* 6009949: Rename NOTREACHED_NORETURN() uses to NOTREACHED() | https://chromium-review.googlesource.com/c/chromium/src/+/6009949

* 5966419: [freezing] Expose frozen state to extensions (3/3 - add frozen to chrome.tabs.Tab).

https://chromium-review.googlesource.com/c/chromium/src/+/5966419
Also https://chromium-review.googlesource.com/c/chromium/src/+/6006424

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: VerteDinde <vertedinde@electronjs.org>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-11-14 18:18:11 +01:00
Charles Kerr
8a67e77f03 build: fix python warnings "SyntaxWarning: invalid escape sequence '\w'" (#44650)
* fix: SyntaxWarning: invalid escape sequence '\w'

* chore: remove some unused imports

* fix: E711 warning 'Comparison to  should be '
2024-11-14 12:27:20 +01:00
Sam Maddock
41b5d7e312 refactor: unfilter unresponsive events (#44629)
* feat: internal -unresponsive event

* Reland "refactor: JSify BrowserWindow unresponsive handling"

This reverts commit ef7ae78ed4.

* fix: emit unresponsive if close not prevented

---------

Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2024-11-13 17:59:13 -08:00
Keeley Hammond
946ab5f1d7 build: reland bump Node.js to v22.9.0 (#44597)
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-11-13 15:34:30 +01:00
Shelley Vohr
0fd16dc9e2 fix: WCO buttons hidden on Linux in fullscreen (#44621)
Closes https://github.com/electron/electron/issues/44569.

Fixes an issue where the WCO buttons were hidden on Linux in  fullscreen mode
but not on Windows or macOS. The Windows behavior is the expected one, so this
commit makes the Linux behavior consistent.
2024-11-13 15:11:58 +01:00
BILL SHEN
a120d87570 fix: add theme data source for devtools. (#44114)
* fix: add theme data source for devtools.

* chore: add ut.

* chore: remove recording histograms

* fix: add theme data source for devtools.

* chore: separate files

* chore: separate files

* chore: remove pragma once

* chore: fix lint issue.
2024-11-13 13:23:37 +01:00
David Sanders
d380cda14a ci: remove from issue triage on issue transferred (#44631) 2024-11-13 12:05:11 +01:00
Shelley Vohr
80ff7a14c6 test: exercise fuller globalShortcut matrix (#44488)
test: test fuller globalShortcut matrix
2024-11-12 15:31:39 -05:00
Gellert Hegyi
7a79d4c96e feat: add optional animation parameter to BrowserWindow.setVibrancy (#35987)
adds optional animation parameter to BrowserWindow.setVibrancy
2024-11-12 09:03:30 -08:00
dependabot[bot]
a6390b539c build(deps): bump github/codeql-action from 3.27.0 to 3.27.1 (#44611)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.27.0 to 3.27.1.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](662472033e...4f3212b617)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-12 10:29:59 -05:00
John Kleinschmidt
777e547922 fix: segfault when moving WebContentsView between BrowserWindows (#44599)
* fix: segfault when moving WebContentsView between BrowserWindows

* chore: actually enable fix

* fixup segfault when moving WebContentsView between BrowserWindows
2024-11-11 18:44:13 -05:00
dependabot[bot]
c6c430bff1 build(deps): bump dsanders11/project-actions from 1.3.0 to 1.4.0 (#44566)
Bumps [dsanders11/project-actions](https://github.com/dsanders11/project-actions) from 1.3.0 to 1.4.0.
- [Release notes](https://github.com/dsanders11/project-actions/releases)
- [Changelog](https://github.com/dsanders11/project-actions/blob/main/.releaserc.json)
- [Commits](eb760c4889...438b25e007)

---
updated-dependencies:
- dependency-name: dsanders11/project-actions
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-11-11 21:30:31 +01:00
electron-appveyor-updater[bot]
928c0301e7 build: update appveyor image to latest version (#44606)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-11-11 13:56:59 -05:00
electron-roller[bot]
6e3a5daf62 chore: bump chromium to 132.0.6826.0 (main) (#44584)
* chore: bump chromium in DEPS to 132.0.6821.0

* chore: bump chromium in DEPS to 132.0.6822.0

* chore: update patches

* chore: bump chromium in DEPS to 132.0.6824.0

* chore: update patches

* 5998172: Migrate remaining NOTREACHED()s in chrome/ | https://chromium-review.googlesource.com/c/chromium/src/+/5998172

* 5872484: Pass along accelerators for menu items coming from DevTools | https://chromium-review.googlesource.com/c/chromium/src/+/5872484

* chore: update patches

* 5872913: Enable `raw_span` clang plugin [1/2] | https://chromium-review.googlesource.com/c/chromium/src/+/5872913

* fixup! picture-in-picture import

* 5912245: [video pip] Add progress bar to 2024 UI | https://chromium-review.googlesource.com/c/chromium/src/+/5912245

* fixup! 5872913: Enable raw_span clang plugin [1/2] | https://chromium-review.googlesource.com/c/chromium/src/+/5872913

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2024-11-08 16:12:42 -08:00
Keeley Hammond
f9a04012b9 build: revert bump Node.js to v22.9.0 (#44596)
* Revert "chore: bump Node.js to v22.9.0 (#44281)"

This reverts commit c63d0d61e7.

* chore: update patches
2024-11-07 19:20:50 -08:00
John Kleinschmidt
4b57a8fb1a chore: remove revert_mojo_force_blink_headers_to_only_be_included_in_blink.patch (#44589) 2024-11-07 12:30:57 -08:00
Samuel Attard
e3d75b3087 build: also lint mjs files (#44581) 2024-11-06 18:46:09 -05:00
electron-appveyor-updater[bot]
ea7b0a4cc8 build: update appveyor image to latest version (#44570)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-11-06 13:54:39 -05:00
Charles Kerr
2002472b10 chore: remove unused gin::Converter<char[]>::ToV8(isolate, const char*) (#44568)
No longer needed after #44498
2024-11-06 08:49:25 -06:00
electron-roller[bot]
adbd25f699 chore: bump chromium to 132.0.6820.0 (main) (#44544)
* chore: bump chromium in DEPS to 132.0.6817.0

* chore: update chromium patches

* 5979290: Temoporarily disable crel on arm. | https://chromium-review.googlesource.com/c/chromium/src/+/5979290

* 5981701: Include callback.h instead of callback_forward.h | https://chromium-review.googlesource.com/c/chromium/src/+/5981701

* 5964918: [v8 code cache] Add a wpt_internal test demonstrating the code cache 304 problem | https://chromium-review.googlesource.com/c/chromium/src/+/5964918

* 5969697: Add NetworkTrafficAnnotationTag to PreconnectManager | https://chromium-review.googlesource.com/c/chromium/src/+/5969697

* chore: update remaining patches

* chore: bump chromium in DEPS to 132.0.6818.0

* chore: update patches

* 5983492: MPArch GuestView: Have executeScript target correct frame | https://chromium-review.googlesource.com/c/chromium/src/+/5983492

* chore: bump chromium in DEPS to 132.0.6820.0

* chore: update patches

* 5989717: Revert "win: Remove special check for 10.0.22621.2428 Win SDK version" | https://chromium-review.googlesource.com/c/chromium/src/+/5989717

* 5968218: Send PDF Searchifier running state to browser to show UX elements. | https://chromium-review.googlesource.com/c/chromium/src/+/5968218

* build: also update the MSVS_HASH for WOA

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: VerteDinde <vertedinde@electronjs.org>
2024-11-05 16:46:57 -08:00
Charles Kerr
3090e40c09 chore: remove executable flag from docs/api/app.md file permissions (#44548)
chore: set docs/api/app.md file permissions to 644

md files should not be executable
2024-11-05 11:48:23 -05:00
Niklas Wenzel
4f2fb7b1a0 docs: clarify that sessions use cache by default (#44547) 2024-11-05 10:27:19 -06:00
Charles Kerr
9bf067dd5a fix: ftbfs when including simdjson in Node.js (#44567) 2024-11-04 20:28:44 -05:00
John Kleinschmidt
f0d3e42338 test: fixup flaky session tests (#44545)
test: fixup broken tests in 32-x-y (#44389)

* test: fixup broken tests in 32-x-y

* test: fixup additional failing test

(cherry picked from commit c61bb1654e)
2024-11-04 17:26:19 -05:00
Charles Kerr
24dc9ddf5c fix: remove use of banned std::to_string() (#44514)
Use base::NumberToString() instead

Xref: https://chromium.googlesource.com/chromium/src/+/main/styleguide/c++/c++-features.md#std_sto_i_l_ul_ll_ull_f_d_ld_to_string_banned
2024-11-04 16:42:42 -05:00
Charles Kerr
1835c0ab6c docs: capitalize POSIX and Windows correctly (#44546)
* docs: capitalize POSIX correctly

* docs: capitalize Windows correctly
2024-11-04 13:12:23 -08:00
John Kleinschmidt
1c1eb3e19d build: add new status to verify if all the required gha jobs have run (#44432) 2024-11-04 14:35:10 -05:00
Charles Kerr
726d439399 refactor: replace base::StringPrintf() calls with absl::StrFormat() (#44515)
refactor: replace base::StringPrintf() calls with absl::StFormat()

The former is now a pass-through for the latter and is slated for removal

Xref: https://issues.chromium.org/issues/40241565

https://chromium-review.googlesource.com/c/chromium/src/+/4907781
2024-11-04 12:58:16 -06:00
Shelley Vohr
c63d0d61e7 chore: bump Node.js to v22.9.0 (#44281)
* chore: bump Node.js to v22.9.0

* build: drop base64 dep in GN build

https://github.com/nodejs/node/pull/52856

* build,tools: make addons tests work with GN

https://github.com/nodejs/node/pull/50737

* fs: add fast api for InternalModuleStat

https://github.com/nodejs/node/pull/51344

* src: move package_json_reader cache to c++

https://github.com/nodejs/node/pull/50322

* crypto: disable PKCS#1 padding for privateDecrypt

https://github.com/nodejs-private/node-private/pull/525

* src: move more crypto code to ncrypto

https://github.com/nodejs/node/pull/54320

* crypto: ensure valid point on elliptic curve in SubtleCrypto.importKey

https://github.com/nodejs/node/pull/50234

* src: shift more crypto impl details to ncrypto

https://github.com/nodejs/node/pull/54028

* src: switch crypto APIs to use Maybe<void>

https://github.com/nodejs/node/pull/54775

* crypto: remove DEFAULT_ENCODING

https://github.com/nodejs/node/pull/47182

* deps: update libuv to 1.47.0

https://github.com/nodejs/node/pull/50650

* build: fix conflict gyp configs

https://github.com/nodejs/node/pull/53605

* lib,src: drop --experimental-network-imports

https://github.com/nodejs/node/pull/53822

* esm: align sync and async load implementations

https://github.com/nodejs/node/pull/49152

* esm: remove unnecessary toNamespacedPath calls

https://github.com/nodejs/node/pull/53656

* module: detect ESM syntax by trying to recompile as SourceTextModule

https://github.com/nodejs/node/pull/52413

* test: adapt debugger tests to V8 11.4

https://github.com/nodejs/node/pull/49639

* lib: update usage of always on Atomics API

https://github.com/nodejs/node/pull/49639

* test: adapt test-fs-write to V8 internal changes

https://github.com/nodejs/node/pull/49639

* test: adapt to new V8 trusted memory spaces

https://github.com/nodejs/node/pull/50115

* deps: update libuv to 1.47.0

https://github.com/nodejs/node/pull/50650

* src: use non-deprecated v8::Uint8Array::kMaxLength

https://github.com/nodejs/node/pull/50115

* src: update default V8 platform to override functions with location

https://github.com/nodejs/node/pull/51362

* src: add missing TryCatch

https://github.com/nodejs/node/pull/51362

* lib,test: handle new Iterator global

https://github.com/nodejs/node/pull/51362

* src: use non-deprecated version of CreateSyntheticModule

https://github.com/nodejs/node/pull/50115

* src: remove calls to recently deprecated V8 APIs

https://github.com/nodejs/node/pull/52996

* src: use new V8 API to define stream accessor

https://github.com/nodejs/node/pull/53084

* src: do not use deprecated V8 API

https://github.com/nodejs/node/pull/53084

* src: do not use soon-to-be-deprecated V8 API

https://github.com/nodejs/node/pull/53174

* src: migrate to new V8 interceptors API

https://github.com/nodejs/node/pull/52745

* src: use supported API to get stalled TLA messages

https://github.com/nodejs/node/pull/51362

* module: print location of unsettled top-level await in entry points

https://github.com/nodejs/node/pull/51999

* test: make snapshot comparison more flexible

https://github.com/nodejs/node/pull/54375

* test: do not set concurrency on parallelized runs

https://github.com/nodejs/node/pull/52177

* src: move FromNamespacedPath to path.cc

https://github.com/nodejs/node/pull/53540

* test: adapt to new V8 trusted memory spaces

https://github.com/nodejs/node/pull/50115

* build: add option to enable clang-cl on Windows

https://github.com/nodejs/node/pull/52870

* chore: fixup patch indices

* chore: add/remove changed files

* esm: drop support for import assertions

https://github.com/nodejs/node/pull/54890

* build: compile with C++20 support

https://github.com/nodejs/node/pull/52838

* deps: update nghttp2 to 1.62.1

https://github.com/nodejs/node/pull/52966

* src: parse inspector profiles with simdjson

https://github.com/nodejs/node/pull/51783

* build: add GN build files

https://github.com/nodejs/node/pull/47637

* deps,lib,src: add experimental web storage

https://github.com/nodejs/node/pull/52435

* build: add missing BoringSSL dep

* src: rewrite task runner in c++

https://github.com/nodejs/node/pull/52609

* fixup! build: add GN build files

* src: stop using deprecated fields of v8::FastApiCallbackOptions

https://github.com/nodejs/node/pull/54077

* fix: shadow variable

* build: add back incorrectly removed SetAccessor patch

* fixup! fixup! build: add GN build files

* crypto: fix integer comparison in crypto for BoringSSL

* src,lib: reducing C++ calls of esm legacy main resolve

https://github.com/nodejs/node/pull/48325

* src: move more crypto_dh.cc code to ncrypto

https://github.com/nodejs/node/pull/54459

* chore: fixup GN files for previous commit

* src: move more crypto code to ncrypto

https://github.com/nodejs/node/pull/54320

* Fixup Perfetto ifdef guards

* fix: missing electron_natives dep

* fix: node_use_node_platform = false

* fix: include src/node_snapshot_stub.cc in libnode

* 5507047: [import-attributes] Remove support for import assertions

https://chromium-review.googlesource.com/c/v8/v8/+/5507047

* fix: restore v8-sandbox.h in filenames.json

* fix: re-add original-fs generation logic

* fix: ngtcp2 openssl dep

* test: try removing NAPI_VERSION undef

* chore(deps): bump @types/node

* src: move more crypto_dh.cc code to ncrypto

https://github.com/nodejs/node/pull/54459

* esm: remove unnecessary toNamespacedPath calls

https://github.com/nodejs/node/pull/53656

* buffer: fix out of range for toString

https://github.com/nodejs/node/pull/54553

* lib: rewrite AsyncLocalStorage without async_hooks

https://github.com/nodejs/node/pull/48528

* module: print amount of load time of a cjs module

https://github.com/nodejs/node/pull/52213

* test: skip reproducible snapshot test on 32-bit

https://github.com/nodejs/node/pull/53592

* fixup! src: move more crypto_dh.cc code to ncrypto

* test: adjust emittedUntil return type

* chore: remove redundant wpt streams patch

* fixup! chore(deps): bump @types/node

* fix: gn executable name on Windows

* fix: build on Windows

* fix: rename conflicting win32 symbols in //third_party/sqlite

On Windows otherwise we get:

lld-link: error: duplicate symbol: sqlite3_win32_write_debug
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:47987
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_sleep
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48042
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_is_nt
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48113
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_utf8_to_unicode
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48470
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_unicode_to_utf8
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48486
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_mbcs_to_utf8
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48502
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_mbcs_to_utf8_v2
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48518
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_utf8_to_mbcs
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48534
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

lld-link: error: duplicate symbol: sqlite3_win32_utf8_to_mbcs_v2
>>> defined at .\..\..\third_party\electron_node\deps\sqlite\sqlite3.c:48550
>>>            obj/third_party/electron_node/deps/sqlite/sqlite/sqlite3.obj
>>> defined at obj/third_party/sqlite\chromium_sqlite3/sqlite3_shim.obj

* docs: remove unnecessary ts-expect-error after types bump

* src: move package resolver to c++

https://github.com/nodejs/node/pull/50322

* build: set ASAN detect_container_overflow=0

https://github.com/nodejs/node/issues/55584

* chore: fixup rebase

* test: disable failing ASAN test

* win: almost fix race detecting ESRCH in uv_kill

https://github.com/libuv/libuv/pull/4341
2024-11-04 13:41:56 -05:00
Charles Kerr
e3f2ca1425 chore: remove use of banned absl::optional (#44513)
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5805666
2024-11-04 12:37:04 -06:00
Charles Kerr
f5bdbdb1e8 refactor: more inline constexpr string view (#44498)
* chore: remove unused electron::kHidProductIdKey

* refactor: make electron::kHidDeviceNameKey inline constexpr std::string_view

refactor: make electron::kHidGuidKey inline constexpr std::string_view

* refactor: make serial_chooser_context keys inline constexpr std::string_view

* refactor: make native_window keys inline constexpr std::string_view

* refactor: make electron::options keys inline constexpr std::string_view pt 1

* fixup! refactor: make electron::options keys inline constexpr std::string_view pt 1

chore: make kElectronNativeWindowKey a base::cstring_view

ui::Widget::GetNativeWindowProperty requires a const char*

* refactor: make electron::options keys inline constexpr std::string_view pt 2

* refactor: make electron::options keys inline constexpr std::string_view pt 3

* refactor: make electron::options keys inline constexpr std::string_view pt 4

* refactor: make electron::options keys inline constexpr std::string_view pt 5

* refactor: make electron::options keys inline constexpr std::string_view pt 6

* refactor: make electron::options keys inline constexpr std::string_view pt 7

* refactor: make electron::options keys inline constexpr std::string_view pt 8

* chore: remove unused file shell/common/options_switches.cc

* docs: add code comment explaining use of base::cstring_view

* fixup! fixup! refactor: make electron::options keys inline constexpr std::string_view pt 1

* chore: use consistent capitalization of the word 'fullscreen'
2024-11-04 12:27:49 -06:00
electron-roller[bot]
48801be8e9 chore: bump chromium to 132.0.6807.0 (main) (#44360)
* chore: bump chromium in DEPS to 132.0.6791.0

* 5804481: [UI] Migrate remaining clients of `MenuSourceType`

https://chromium-review.googlesource.com/c/chromium/src/+/5804481

* chore: try revert PA CL

* chore: bump chromium in DEPS to 132.0.6793.0

* chore: bump chromium in DEPS to 132.0.6794.0

* 5952404: Clean up //ui/base/resource from Lacros code.

https://chromium-review.googlesource.com/c/chromium/src/+/5952404

* 5920842: Generate combined grd for PEPC strings and use them in the element

https://chromium-review.googlesource.com/c/chromium/src/+/5920842

* 5943708: Enable DynamicSafeAreaInsets for eligible users only

https://chromium-review.googlesource.com/c/chromium/src/+/5943708

* chore: fixup patch indices

* 5937004: Remove components/services/language_detection

https://chromium-review.googlesource.com/c/chromium/src/+/5937004

* 5920322: [UI] Use mojo enum for `MenuSourceType` in ui/views/controls/

https://chromium-review.googlesource.com/c/chromium/src/+/5920322

* chore: bump chromium in DEPS to 132.0.6797.0

* 5947724: [ui] Add missing shortcut text for VKEY_COMMAND on linux

https://chromium-review.googlesource.com/c/chromium/src/+/5947724

* chore: fixup patch indices

* 5948024: [DNT] Fix NavigationController raw_ptr during WebContents destruction

https://chromium-review.googlesource.com/c/chromium/src/+/5948024

* 5945209: Roll libc++ from c8eec3629a9e to e2c39ff9388b (1 revision)

https://chromium-review.googlesource.com/c/chromium/src/+/5945209

* chore: bump chromium in DEPS to 132.0.6799.0

* chore: bump chromium in DEPS to 132.0.6801.0

* chore: bump chromium in DEPS to 132.0.6803.0

* 5942398: Remove some chrome:: namespace from chrome/browser/win/*

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5942398

* 5963016: FSA: Use the profile path for base::DIR_HOME on ChromeOS

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5963016

* chore: fixup patch indices

* chore: bump chromium in DEPS to 132.0.6805.0

* 5924816: [macOS][FSA] Block Access to Application Bundle Path

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5924816

* 5962517: [media] Apply inside blink to renderer/platform/media

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5962517

* 5829616: MPArch based GuestViews basic implementation

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5829616

* 5953710: Expose a rust_static_library instead of raw rs file from rust_bindgen

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5953710

* chore: fixup patch indices

* chore:  disable ELF CREL on Linux Arm

5938657: Reapply "Enable ELF CREL, which reduces the size of ELF relocatable object files." | https://chromium-review.googlesource.com/c/chromium/src/+/5938657

* chore: bump chromium in DEPS to 132.0.6807.0

* 5868889: Shared Storage: Support saved queries in selectURL

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5868889

* Revert "5956408: [fastapi] Promote deprecation of FastApiTypedArray"

Refs: https://chromium-review.googlesource.com/c/v8/v8/+/5956408

* Revert "5962696: [mojo] Force blink headers to only be included in blink"

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5962696

* chore: update patches

* 5973073: [Extensions] Improve warnings parsing (host) permissions in MV3

Refs: https://chromium-review.googlesource.com/c/chromium/src/+/5973073

* chore: update filenames.libcxx.gni

* Apply suggestions from code review

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-11-04 09:10:00 -05:00
Ani Betts
d9a9d5b8fe docs: Update Squirrel Run at Login docs to be modern (#44487)
Update Squirrel Run at Login docs to be modern

The current docs for setting up Run at Login use the legacy way that
Squirrel does shortcuts. This was replaced by an easier method, let's
use that instead
2024-11-02 15:56:02 -05:00
Charles Kerr
7fea537fbf docs: fix apostrophe typo "Electrons" -> "Electron's" (#44516)
s/Electrons/Electron's/
2024-11-02 15:52:22 -05:00
David Sanders
bc6c7bd757 build: remove unused lint package (#44525) 2024-11-02 13:57:15 -05:00
Charles Kerr
9137d96ef4 refactor: remove unused C string ToV8() gin converter (#44500) 2024-11-01 18:11:46 -05:00
Charles Kerr
b985d8eb28 perf: use v8::String::NewFromUtf8Literal in ToV8() gin converter (#44501) 2024-11-01 15:01:09 -05:00
Anny Yang
2081f771e4 docs: add custom titlebar example (#43693)
* docs: add custom titlebar example

* docs: add links and other small edits

* docs: add panel window docs

* docs: remove panel example

* docs: specify expected emphasis style

* docs: responding to feedback

* docs: fix section names in links

* docs: rework baseWindow note

* docs: making window customization its own section

* responding to feedback
2024-11-01 11:04:37 -04:00
Shelley Vohr
15151c6853 fix: EventSource undefined in Renderer/Worker (#44475) 2024-10-31 15:24:44 -04:00
John Kleinschmidt
8be4ae4bab build: handle out of disk space on source cache (#44490)
* build: handle out of disk space on source cache

* build: add cron job to free up source cache disk space
2024-10-31 15:03:28 -04:00
Sam Maddock
31f8e7553b fix: flaky utility and BrowserView tests (#44451)
* fix: flake wait for crash with specific serviceName

* fix: flake when unrelated WebContents exists during BrowserView tests

* fix: wait for crash before forking

* use name
2024-10-30 20:29:01 -05:00
Charles Kerr
7cdf1a01b8 docs: fix win.setContentView() arg type (#44478)
fix: setContentView type
2024-10-30 15:56:10 -04:00
Charles Kerr
a720c8daf6 perf: remove isolate scope from DidProcessTask() (#44439) 2024-10-29 23:25:40 -05:00
Charles Kerr
fb959f8d30 build: enable -Wunsafe-buffer-usage warnings (#44056) 2024-10-29 17:28:34 -05:00
Alice Zhao
de04fc3b90 fix: update shell.openExternal to correctly focus on external window (#44408)
* fix: Use openURL:configuration:completionHandler instead of openUrl

* test: add a test

* fix: add dispatch_async to replace GetUIThreadTaskRunner

* refactor: remove unused import

* fix: update to use BindPostTaskToCurrentDefault

* test: add regression test for window focus

* refactor: update to explicit task runner
2024-10-29 15:10:10 -07:00
Shelley Vohr
7ff7160135 docs: fix win.getContentView() return type (#44430)
docs: fix win.getContentView() return type
2024-10-29 21:41:44 +01:00
Shelley Vohr
9fc94a162b build: fix python util verbose mode logic (#44431)
build: fix verbose mode logic
2024-10-29 11:35:57 -04:00
Devin Binnie
53458da01e docs: Fix powerMonitor docs for type generation of speed-limit-change (#44391)
Fix `powerMonitor` docs for type generation of `speed-limit-change`
2024-10-29 10:16:29 -05:00
Charles Kerr
dffe00b232 fix: -Wunsafe-buffer-usage warnings with argc, argv (#44366)
* refactor: move uv_setup_args() calls to startup

* refactor: call base::CommandLine::Init() before ContentMain()

* feat: add ElectronCommandLine::AsUtf8()

* refactor: call base::CommandLine::Init() before NodeMain()

* refactor: use ElectronCommandLine::AsUtf8() in NodeMain()

* fix: -Wunsafe-buffer-usage warning in ElectronCommandLine::Init()

* chore: add a DCHECK to confirm ElectronCommandLine was initialized before AsUtf8() is called

* chore: const correctness in ElectronCommandLine::Init() args

* chore: add ElectronCommandLine to macOS Electron Helper app

* chore: move argc, argvc setup into electron_library_main on macOS

* chore: revert BUILD.gn changes

* fix: WideToUTF8() call in ElectronCommandLine::AsUtf8()

* build: add uv to the include paths for app/electron_main_linux

* build: add uv to the include paths for app/electron_library_main.mm

* chore: revert unrelated changes

these were intended for another branch
2024-10-29 13:23:08 +01:00
Shelley Vohr
39b24aed92 refactor: move node ofs script to electron (#44425)
* refactor: move node ofs script to electron

* chore: remove empty file
2024-10-29 13:22:26 +01:00
dependabot[bot]
f7ead785cd build(deps): bump actions/setup-node from 4.0.4 to 4.1.0 (#44433)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.0.4 to 4.1.0.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](0a44ba7841...39370e3970)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-29 13:21:09 +01:00
Charles Kerr
b3c2e83243 refactor: prefer inline constexpr string_view for string constants (#44405)
* refactor: BaseWindow::OnExecuteAppCommand() now takes a std::string_view

* refactor: NativeWindow::NotifyWindowExecuteAppCommand() takes a std::string_view

* refactor: AppCommandToString() returns a std::string_view, is now constexpr

* refactor: make kBrowserBackward, kBrowserForward inline constexpr std::string_view

Xref: https://abseil.io/tips/140

https://groups.google.com/a/chromium.org/g/chromium-dev/c/jROTxMo_m2Q/m/HgciN2KsAgAJ

* refactor: use inline constexpr string_view for kDevice*Key constants

Xref: https://abseil.io/tips/140

https://groups.google.com/a/chromium.org/g/chromium-dev/c/jROTxMo_m2Q/m/HgciN2KsAgAJ

* refactor: IsEnvSet now takes a base::cstring_view

* refactor: use inline constexpr cstring_view for kRunAsNode

* refactor: use inline constexpr string_view for kPDF*PluginName

* refactor: use base::FilePath::FromASCII() since "internal-pdf-viewer" is ascii

* chore: remove unused shell/common/electron_constants.cc

* fixup! refactor: IsEnvSet now takes a base::cstring_view
2024-10-29 10:30:12 +01:00
dependabot[bot]
cc3359f126 build(deps): bump actions/checkout from 4.2.1 to 4.2.2 (#44435)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.2.1 to 4.2.2.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](eef61447b9...11bd71901b)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-29 09:59:22 +01:00
Shelley Vohr
46561fc5bc build: improve gen-libc++-filenames output (#44424)
build: improve gen-libc++-filenames output
2024-10-29 09:59:10 +01:00
dependabot[bot]
214c8228ed build(deps): bump github/codeql-action from 3.26.13 to 3.27.0 (#44434)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.13 to 3.27.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f779452ac5...662472033e)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-29 01:05:46 -05:00
Robo
739688214b fix: keep gdk_pixbuf a dynamic dependency (#44423) 2024-10-29 09:44:20 +09:00
Charles Kerr
5d0d15a0b3 perf: prefer NewFromUtf8Literal() over NewFromUtf8() for string literals (#44412)
* perf: prefer NewFromUtf8Literal() over NewFromUtf8() for string literals

the string length is known at compile time and no need to call ToLocalChecked()

* perf: string length is known when calling NewFromUtf8(), so use it

* perf: remove unnecessary calls to c_str()

these just force the code being called to have to recalculate the string length
2024-10-28 14:12:32 +01:00
Sam Maddock
348801b20e fix: crash on netlog connection error (#44406)
* fix: crash on netlog connection error

* refactor: remove default PromiseBase constructor

* Revert "refactor: remove default PromiseBase constructor"

This reverts commit 9292324a0d.

* remove dcheck
2024-10-28 10:24:54 +01:00
John Kleinschmidt
57920e7747 test: deflake flaky tests on linux (#44383) 2024-10-24 20:47:17 -04:00
John Kleinschmidt
a0f51d816e build: update linux container (#44392) 2024-10-24 16:58:36 -04:00
Charles Kerr
83d7040096 fix: -Wunsafe-buffer-usage warning in didRegisterForRemoteNotificationsWithDeviceToken (#44348)
* chore: move as_byte_span() to new shell/common/mac_util.h

this way it can be used by multiple mm files

* fix: -Wunsafe-buffer-usage warnings in UNNotificationResponseToNSDictionary

* refactor: use base::HexEncode() instead of rolling our own

* fixup! chore: move as_byte_span() to new shell/common/mac_util.h

* fixup! chore: move as_byte_span() to new shell/common/mac_util.h

fix: move mac_util to the right place in filenames.gni
2024-10-23 14:18:22 -05:00
John Kleinschmidt
c42fb09fc9 test: fixup flaky tests (#44349)
* test: fixup flaky test

* test: disable flaky protocol speed test on macOS

* test: fixup flaky test in api-browser-window-spec.ts
2024-10-23 15:14:50 -04:00
Shelley Vohr
fd500477ac docs: clarify utilityProcess child.pid value (#44339) 2024-10-22 13:09:33 -04:00
electron-appveyor-updater[bot]
d60d526df6 build: update appveyor image to latest version (#44334)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-10-22 10:40:00 -04:00
Charles Kerr
e3e94d45ee fix: silence -Wunsafe-buffer-usage warning in GetPreferredLanguages() (#44333)
fix: use UNSAFE_BUFFERS macro in GetPreferredLanguages()
2024-10-21 18:20:00 -05:00
Sam Maddock
fff6ea438a fix: software compositing infinite loop (#44318)
Co-authored-by: Keeley Hammond <vertedinde@electronjs.org>
2024-10-21 18:56:03 -04:00
Robo
3e77faf2f7 fix: crash when generating shortcut text for super accelerator (#44341) 2024-10-22 03:26:38 +09:00
John Kleinschmidt
cc9d85d3ca build: fixup reclient use for prod builds (#44340) 2024-10-21 14:07:02 -04:00
electron-roller[bot]
d3d02ef111 chore: bump chromium to 132.0.6789.0 (main) (#44337)
chore: bump chromium in DEPS to 132.0.6789.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2024-10-21 10:48:59 -04:00
electron-roller[bot]
e70f70f5b4 chore: bump chromium to 132.0.6788.0 (main) (#44331)
chore: bump chromium in DEPS to 132.0.6788.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2024-10-20 23:54:06 -05:00
electron-roller[bot]
0d948da4b9 chore: bump chromium to 132.0.6787.0 (main) (#44329)
* chore: bump chromium in DEPS to 132.0.6785.0

* chore: bump chromium in DEPS to 132.0.6787.0

* 5837702: mac fullscreen: always show traffic lights

https://chromium-review.googlesource.com/c/chromium/src/+/5837702

* 5892572: Move SimpleMenuModel out of ui/base

https://chromium-review.googlesource.com/c/chromium/src/+/5892572

* 5938185: Remove lacros code from //ui/base/clipboard

https://chromium-review.googlesource.com/c/chromium/src/+/5938185

* chore: fixup patch indices

* 5939514: Wire up the preference of overlay scrollbars to the ChromeOS settings

https://chromium-review.googlesource.com/c/chromium/src/+/5939514

* chore: fixup patch indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-10-20 19:02:21 -05:00
dependabot[bot]
2cf59b3885 build(deps-dev): bump webpack from 5.94.0 to 5.95.0 (#44309)
Bumps [webpack](https://github.com/webpack/webpack) from 5.94.0 to 5.95.0.
- [Release notes](https://github.com/webpack/webpack/releases)
- [Commits](https://github.com/webpack/webpack/compare/v5.94.0...v5.95.0)

---
updated-dependencies:
- dependency-name: webpack
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-20 10:40:03 +02:00
Sam Maddock
87bd665e41 feat: expose frame & move properties to console-message event object (#43617)
* feat: expose frame on console-message event

refactor: use property names similar to ServiceWorker's console-message event

refactor: don't use deprecated params in tests

doc: console-message breaking change

chore: add deprecation warning

docs: restore deprecated argument descriptions

* move console-message deprecations to v34

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-18 16:07:06 -04:00
John Beutner
35aeab6ecd fix: respect setAlwaysOnTop before showInactive on Linux under X11 (#44078)
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-18 14:29:52 -04:00
electron-roller[bot]
738533dec7 chore: bump chromium to 132.0.6783.0 (main) (#44307)
* chore: bump chromium in DEPS to 132.0.6782.0

* chore: bump chromium in DEPS to 132.0.6783.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-18 12:06:33 -04:00
electron-appveyor-updater[bot]
456aac1f94 build: update appveyor image to latest version (#44311)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-10-18 11:24:24 -04:00
dependabot[bot]
6c6e5c002a build(deps): bump actions/upload-artifact from 4.4.0 to 4.4.3 (#44173)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.4.0 to 4.4.3.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](50769540e7...b4b15b8c7c)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-18 15:39:55 +02:00
electron-roller[bot]
089f233054 chore: bump chromium to 132.0.6781.0 (main) (#44301)
* chore: bump chromium in DEPS to 132.0.6781.0

* chore: update patches

* 5933789: [MappableSI] Remove kill-switch from RenderableGpuMemoryBufferVideoFramePool.

https://chromium-review.googlesource.com/c/chromium/src/+/5933789

* 5938992: Reland: Remove `force_guest_profile` param from context getters.

https://chromium-review.googlesource.com/c/chromium/src/+/5938992

* 5928743: spanification: Add WTF::String::FromUTF8(span<>) overloads

https://chromium-review.googlesource.com/c/chromium/src/+/5928743

* 5898835: Update windows SDK version to 10.0.26100.1742

https://chromium-review.googlesource.com/c/chromium/src/+/5898835

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-17 20:00:59 -04:00
dependabot[bot]
2b0624f2f1 build(deps-dev): bump remark-cli from 10.0.0 to 12.0.1 (#44258)
Bumps [remark-cli](https://github.com/remarkjs/remark) from 10.0.0 to 12.0.1.
- [Release notes](https://github.com/remarkjs/remark/releases)
- [Changelog](https://github.com/remarkjs/remark/blob/main/changelog.md)
- [Commits](https://github.com/remarkjs/remark/compare/10.0.0...remark-cli@12.0.1)

---
updated-dependencies:
- dependency-name: remark-cli
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-17 15:15:48 -04:00
Keeley Hammond
ac09d11ed1 build: fix main printing patch conflict (#44302)
build: update patches
2024-10-17 11:29:04 -04:00
John Kleinschmidt
9280add5b4 chore: fixup reclient read only access on forks (#44280) 2024-10-17 11:17:54 -04:00
Mayur
44c398fedb docs: removed AngularJS Batarang from the Devtool Extension Support (#44261)
docs: update Devtool Extension Support
2024-10-17 10:55:05 -04:00
David Sanders
cbc12d6675 ci: use Node.js 20 in Bake AppVeyor Image workflow (#44290)
* ci: use Node.js 20 in Bake AppVeyor Image workflow

* chore: add bake workflow to CODEOWNERS
2024-10-17 10:35:50 -04:00
electron-roller[bot]
d801bad5d2 chore: bump chromium to 132.0.6779.0 (main) (#44273)
* chore: bump chromium in DEPS to 132.0.6779.0

* chore: update patches

* 5904951: controlledframe: Disable File System Access for <controlledframe>

https://chromium-review.googlesource.com/c/chromium/src/+/5904951

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-16 21:41:31 -04:00
Shelley Vohr
d386664900 build: use new Issue Template types in templates (#44224)
* build: use new Issue Template types in templates

* build: restore existing labels for now
2024-10-16 15:34:35 -04:00
David Sanders
67775d19ec build: remove dead code in prepare release script (#44256) 2024-10-16 15:05:09 -04:00
Shelley Vohr
cbe3cb770a fix: Linux crash after webContents.print() with no parent window (#44246)
fix: Linux crash after print with no parent window
2024-10-16 13:15:21 -04:00
Shelley Vohr
bd4ea5ba72 fix: use proper PDF save approach (#44248) 2024-10-16 11:33:21 -04:00
Robo
af6e2fb257 fix: trace-startup crashing child process on macOS (#44257) 2024-10-16 11:03:00 -04:00
Shelley Vohr
df45474b58 fix: ensure utilityProcess only emits one 'exit' event (#44243)
fix: ensure utilityProcess only emits one exit
2024-10-16 10:47:12 +02:00
Charles Kerr
b5acebf3ba fix: -Wunsafe-buffer-usage warnings in TaskbarHost::SetThumbarButtons() (#44238)
* fix: -Wunsafe-buffer-usage warnings in TaskbarHost::SetThumbarButtons()

* fixup! fix: -Wunsafe-buffer-usage warning in ChunkedDataPipeReadableStream (#44211)
2024-10-15 18:31:44 -05:00
electron-roller[bot]
ef84f13650 chore: bump chromium to 131.0.6778.0 (main) (#44251)
* chore: bump chromium in DEPS to 131.0.6778.0

* 5803393: [UI] Add alias for mojo version of `MenuSourceType`

https://chromium-review.googlesource.com/c/chromium/src/+/5803393

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-15 16:41:14 -04:00
electron-roller[bot]
36b7cf341e chore: bump chromium to 131.0.6776.0 (main) (#44137)
* chore: bump chromium in DEPS to 131.0.6763.0

* chore: bump chromium in DEPS to 131.0.6764.0

* update patches

* chore: bump chromium in DEPS to 131.0.6766.0

* chore: update patches

* Use PathInfo in FileSystemAccess code

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5872329

* Modernize image utilities.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5905226

* [DevTools] move feature flags to the devtools directory

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5913878

* chore: bump chromium in DEPS to 131.0.6768.0

* chore: update patches

* Remove experimental credshelper flags

Refs 4017a6c8b4

* Change gfx::[PNG|JPEG]Codec::Decode to return a SkBitmap

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5917286
Refs https://chromium-review.googlesource.com/c/chromium/src/+/5905621

* chore: script/gen-libc++-filenames.js

* chore: bump chromium in DEPS to 131.0.6770.0

* chore: update patches

* chore: bump chromium in DEPS to 131.0.6772.0

* chore: update patches

* [UI] Add alias for mojo version of `MenuSourceType`

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5803393

* Update Background Color for Task Manager Refresh

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5875259

* chore: bump chromium in DEPS to 131.0.6774.0

* chore: bump chromium in DEPS to 131.0.6776.0

* chore: update patches

* chore: update filenames.libcxx.gni

* esm: remove --no-import-harmony-assertions

https://github.com/nodejs/node/pull/54890

* 5507047: [import-attributes] Remove support for import assertions

 | https://chromium-review.googlesource.com/c/v8/v8/+/5507047

* fixup: Change gfx::[PNG|JPEG]Codec::Decode to return a SkBitmap

* chore: bump chromium in DEPS to 131.0.6778.0

* Revert "chore: bump chromium in DEPS to 131.0.6778.0"

This reverts commit fb9092fc51.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Jeremy Rose <nornagon@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-15 11:51:11 -04:00
Niklas Wenzel
72802c374b docs: add section on resource management to base-window.md (#43610) 2024-10-15 11:49:54 -04:00
David Sanders
d3e368003b ci: use env variable in branch created workflow (#44240) 2024-10-15 11:16:04 -04:00
dependabot[bot]
0064b23440 build(deps): bump github/codeql-action from 3.26.12 to 3.26.13 (#44239)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.12 to 3.26.13.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](c36620d31a...f779452ac5)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-10-15 10:51:34 +02:00
Shelley Vohr
1cab6bde94 build: update devcontainer sha (#44229) 2024-10-15 10:35:43 +02:00
George Xu
9ecb848c67 docs: update timelines for E34 (#44210)
update dates for e34
2024-10-14 10:52:18 -04:00
John Kleinschmidt
48156aee06 test: run visibility-state-spec.ts first (#44206)
Co-authored-by: trop[bot] <37223003+trop[bot]@users.noreply.github.com>
2024-10-14 09:40:22 -04:00
Charles Kerr
566c72cd46 fix: -Wunsafe-buffer-usage warning in ChunkedDataPipeReadableStream (#44211)
* chore: rename v8_value_serializer.cc,h to v8_util.cc,h

* feat: add electron::util::as_byte_span(v8::Local<v8::ArrayBuffer>)

* fix: -Wunsafe-buffer-usage warnings in ChunkedDataPipeReadableStream::ReadInternal()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5619253

* refactor: restore node buffer span util

* refactor: remove redundant span wrapper
2024-10-14 10:46:24 +02:00
Sam Maddock
8b3d70a2a3 feat: add WebFrameMain detached property (#43473)
* feat: add WebFrameMain detached property

fix: throw instead of returning null senderFrame

test: detached frames

fix: ensure IPCs of pending deletion RFHs are dispatched

fix: lookup WFM by FTN ID to dispatch IPCs

feat: add frame.isDestroyed()

return null

fix: return undefined

docs: add null to all frame properties

refactor: option c, return null and emit warning

refactor: add routingId & processId to navigation events

test: null frame property

docs: clarify warning message

better wording

clarify null frame

fix: browserwindow spec

* maybe fix 🤷

* fix: use updated util #43722

* docs: add notice for frame change of behavior

* docs: clarify why frame properties may be null

* lint

* wip

* fix: content::FrameTreeNodeId lookup and converter

* refactor: avoid holey array deoptimization

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-11 18:33:53 -04:00
Charles Kerr
527efc01a4 fix: -Wunsafe-buffer-usage warnings when read()ing and write()ing integers (#44185) 2024-10-11 14:29:00 -05:00
dependabot[bot]
6c1b377192 build(deps): bump actions/checkout from 4.1.7 to 4.2.1 (#44140)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.1.7 to 4.2.1.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](692973e3d9...eef61447b9)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-11 12:28:45 -05:00
dependabot[bot]
13b39e0eeb build(deps): bump github/codeql-action from 3.26.8 to 3.26.12 (#44139)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.8 to 3.26.12.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](294a9d9291...c36620d31a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-11 18:32:17 +02:00
Samuel Attard
7402648ee3 build: update ts defs and docs parser (#43985)
* build: update ts defs and docs parser

* build: update dig
2024-10-11 10:44:18 -04:00
Niklas Wenzel
5400c04e43 docs: clarify interplay between utility process events (#44015) 2024-10-11 10:25:25 -04:00
Robo
dd5b36f557 fix: clang variable configuration in generated node headers (#44189)
* fix: clang variable configuration in generated node headers

* chore: restore value in common.gypi
2024-10-11 10:22:56 -04:00
John Kleinschmidt
8201623d92 test: fix visibility-state-spec.ts flaky test (#44037)
* test: refactor visibility-state-spec

* ci: shard tests

* test: update split-tests for use on Windows

* test: run visibility-state-spec.ts first
2024-10-11 10:00:22 -04:00
John Kleinschmidt
d93285dde1 ci: don't call datadog test logging on forks (#44181) 2024-10-11 12:08:51 +02:00
Charles Kerr
3d2f68a9df refactor: spanify image utils (#44127)
* refactor: electron::util::AddImageSkiaRepFromJPEG() takes a span arg

* refactor: electron::util::AddImageSkiaRepFromPNG() takes a span arg

* refactor: electron::util::AddImageSkiaRepFromBuffer() takes a span arg

* feat: add Node-buffer-to-base-span helper function

* refactor: electron::api::NativeImage::CreateFromPNG() now takes a span param

* refactor: electron::api::NativeImage::CreateFromJPEG() now takes a span param

* refactor: use base::as_byte_span()

* fix: -Wunsafe-buffer-usage warning in NativeImage::CreateFromNamedImage()

Warning fixed by this commit:

../../electron/shell/common/api/electron_api_native_image_mac.mm:131:11: error: function introduces unsafe buffer manipulation [-Werror,-Wunsafe-buffer-usage]
  131 |           {reinterpret_cast<const uint8_t*>((char*)[png_data bytes]),
      |           ^~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
  132 |            [png_data length]});
      |            ~~~~~~~~~~~~~~~~~~
../../electron/shell/common/api/electron_api_native_image_mac.mm:131:11: note: See //docs/unsafe_buffers.md for help.

* chore: add // SAFETY comment for Node-buffer-to-span func

* chore: add // SAFETY comment for NSData-to-span func
2024-10-10 09:34:55 -04:00
Michaela Laurencin
d51ef7d794 build: update NMV to 132 (#44135)
Node PR: https://github.com/nodejs/node/pull/55306

Do not merge before attached Node PR is merged. This PR updates our NMV to 132 for Electron 34

Please merge this PR before branching 34-x-y
2024-10-09 11:55:59 -07:00
Charles Kerr
78fa477726 fix: -Wunsafe-buffer-usage warning in HasWordCharacters() (#44133) 2024-10-09 13:02:00 -05:00
Charles Kerr
dbbdf55493 fix: -Wunsafe-buffer-usage warning in WriteAsciiChunk() (#44134)
* fix: -Wunsafe-buffer-usage warning in WriteAsciiChunk()

* chore: add // SAFETY comment to explain UNSAFE_BUFFERS() use
2024-10-09 12:18:19 -05:00
Charles Kerr
b5227b4a17 fix: -Wunsafe-buffer-usage warnings in GetNextZoomLevel() (#44149)
fixup e8948397 really fix the warning this time
2024-10-09 09:12:48 -05:00
Keeley Hammond
08d315da14 refactor: revert url::DomainIs() for cookie domains (#44153)
build: revert DomainIs refactor
2024-10-08 18:39:37 -07:00
John Kleinschmidt
ebeae6f301 ci: only upload to datadog when running tests (#44152) 2024-10-08 15:07:17 -04:00
Charles Kerr
4cf69f396f fix: context shear in cli_remove_deprecated_v8_flag.patch (#44148)
fix: patch shear in cli_remove_deprecated_v8_flag.patch
2024-10-08 07:54:33 -07:00
electron-roller[bot]
bcbc8d3bb2 chore: bump chromium to 131.0.6762.0 (main) (#44117)
* chore: bump chromium in DEPS to 131.0.6756.0

* chore: update disable_hidden.patch

no code changes; just handling upstream context shear

https://chromium-review.googlesource.com/c/chromium/src/+/5887019

* chore: update feat_expose_raw_response_headers_from_urlloader.patch

Factor out URLLoader's URLRequest configuration into a helper

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5902254

* chore: update fix_disabling_background_throttling_in_compositor.patch

no manual changes; patch applied with fuzz 1

* chore: e patches all

* 5882129: Fix basic auth issues for sub frame and sub resources | https://chromium-review.googlesource.com/c/chromium/src/+/5882129

- Add `is_request_for_navigation` param to
  ElectronBrowserClient::CreateLoginDelegate().

- Propagate the flag as another undocumented property
  in the app.login Event's authenticationResponseDetails object

- Side cleanup: also in CreateLoginDelegate(), use upstream's name
  for the `is_request_for_main_frame` param, renamed back in
  https://chromium-review.googlesource.com/c/chromium/src/+/3256171

* 5875189: [FSA] Check for DANGEROUS extension types when creating a new file. | https://chromium-review.googlesource.com/c/chromium/src/+/5875189

* chore: node ./script/gen-libc++-filenames.js

* chore: bump chromium in DEPS to 131.0.6758.0

* chore: bump chromium in DEPS to 131.0.6760.0

* chore: update patches

* [A11y] Remove Accessibility Object Model (AOM)

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5896593

* chore: bump chromium in DEPS to 131.0.6762.0

* [heap] Remove deprecated V8 flag

Refs https://chromium-review.googlesource.com/c/v8/v8/+/5904046

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2024-10-07 18:06:47 -05:00
John Kleinschmidt
aa40e817c8 ci: add datadog test logging (#44094) 2024-10-07 18:51:23 -04:00
electron-roller[bot]
b95ee8964c chore: bump node to v20.18.0 (main) (#44119)
* chore: bump node in DEPS to v20.18.0

* chore: update patches

* src: improve buffer.transcode performance

https://github.com/nodejs/node/pull/54153

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-10-07 18:51:08 -04:00
electron-roller[bot]
ab1488a1be chore: bump chromium to 131.0.6754.0 (main) (#44110)
* chore: bump chromium in DEPS to 131.0.6754.0

* chore: update gin_enable_disable_v8_platform.patch

fix minor context shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5901115

* chore: e patches all

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-10-03 13:35:03 -04:00
Samuel Attard
122685194a build: add import/order eslint rule (#44085)
* build: add import/order eslint rule

* chore: run lint:js --fix
2024-10-02 19:10:44 -07:00
Charles Kerr
684e345f68 fix: deprecated API and -Wunsafe-buffer-usage warnings in AsarFileValidator (#44068)
* refactor: const correctness

* refactor: extract-method AsarFileValidator::EnsureHashExists()

* refactor: replace use of deprecated crypto API

https://crbug.com/364687923

* refactor: use span API in AsarFileValidator::OnRead()

* refactor: replace use of deprecated crypto API

https://crbug.com/364687923

* fixup! refactor: use span API in AsarFileValidator::OnRead()

fix: electron-ia32-testing FTBFS
2024-10-02 16:44:28 -04:00
Charles Kerr
9df092e034 fix: remove use of deprecated API base::Hash() (#44076) 2024-10-02 16:36:06 -04:00
Keeley Hammond
93dd9fc17b build: use node 20.17 on Windows (#44065)
* build: rebake image

* build: use e-131.0.6734.0-node-20.17-0

* build: bump msvs version to 2022
2024-10-02 20:12:41 +02:00
electron-roller[bot]
59a43ef2e3 chore: bump chromium to 131.0.6752.0 (main) (#44093)
* chore: bump chromium in DEPS to 131.0.6752.0

* chore: update refactor_expose_cursor_changes_to_the_webcontentsobserver.patch

adjust to upstream #include shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5872830

* chore: e patches all

* Remove the <selectlist> prototype implementation

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5855076

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-10-02 08:35:18 -07:00
electron-roller[bot]
5a97ee26ff chore: bump chromium to 131.0.6751.0 (main) (#44087)
chore: bump chromium in DEPS to 131.0.6751.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2024-10-01 21:30:40 -05:00
Samuel Attard
5b34138db8 build: fix relative file read during npm publish (#44088) 2024-10-01 17:09:57 -07:00
electron-roller[bot]
1fc2064f6a chore: bump chromium to 131.0.6750.0 (main) (#44066)
* chore: bump chromium in DEPS to 131.0.6750.0

* Clean up stale base::Feature "RestrictFileURLNavigation"

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5891262

* chore: update mas_avoid_private_macos_api_usage.patch

Comment out some new private macOS API use.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5837702

Xref: https://electronhq.slack.com/archives/C5VT8SQ8K/p1727807285899389

* chore: e patches all

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-10-01 19:34:32 -04:00
Samuel Attard
f4ffd018e6 build: cleanup release scripts, separate cli entrypoints from logic (#44058)
* build: cleanup release scripts, separate cli entrypoints from logic

* build: use repo/org constants
2024-10-01 13:51:40 -07:00
Charles Kerr
15c8759ee0 fix: -Wunsafe-buffer-usage warnings in WebFrameRenderer::ExecuteJavaScript() (#44053) 2024-10-01 10:06:02 -07:00
Charles Kerr
06bce8166b fix: -Wunsafe-buffer-usage warnings in ElectronAccessibilityUI ctor (#44055)
fix: -Wunsafe-buffer-usage warnings in ElectronAccessibilityUI constructor
2024-10-01 10:05:46 -07:00
Charles Kerr
6f88f0c795 perf: use ArrayBuffer::Data() instead of GetBackingStore()->Data() (#44067)
perf: use ArrayBuffer::Data() API

Replace our `GetBackingStore()->Data()` calls with this instead.
Explained by the V8 docs, ArrayBuffer.Data() is

> More efficient shortcut for GetBackingStore()->Data(). The
> returned pointer is valid as long as the ArrayBuffer is alive.
2024-10-01 10:04:57 -07:00
Samuel Attard
f828c1da09 build: remove github actions dependabot on release branches (#44054) 2024-10-01 08:50:42 -07:00
Samuel Attard
47cf1e3acd build: use ts-node to spawn the version-bumper (#44057)
Missed this in the tsification, we should probably call this via API instead of spawning a sub-proc?
2024-09-30 21:19:59 -07:00
Samuel Attard
61565465fd build: convert all release scripts to typescript (#44035)
* build: convert all release scripts to typescript

* fix test imports

* build: fix version bumper export

* refactor: use as const

* spec: fix bad type spec
2024-09-30 17:55:27 -07:00
Keeley Hammond
7ebc427bf5 build: update appveyor to node 20.17 (#44026)
* build: update appveyor to node 20.17

* build: bake new images with npm dir

* build: use e-131.0.6734.0-node-20.17-1
2024-09-30 16:14:46 -04:00
electron-roller[bot]
5d9800e176 chore: bump chromium to 131.0.6748.0 (main) (#44027)
* chore: bump chromium in DEPS to 131.0.6748.0

* chore: gen-libc++-filenames.js

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-09-30 13:32:50 -04:00
Charles Kerr
1d4b86cb3e fix: -Wunsafe-buffer-usage warnings in AddComponentResourceEntries() (#44024)
fix: -Wunsafe-buffer-usage warnings in ElectronComponentExtensionResourceManager::AddComponentResourceEntries()

just replace pointer-and-length args with a span
2024-09-30 11:01:24 -05:00
Charles Kerr
77f7ba96ca fix: -Wunsafe-buffer-usage in electron::SetFontDefaults() (#44014)
* refactor: reduce code duplication in WebContentsPreferences::OverrideWebkitPrefs()

* refactor: limit scope of web_preferences temporary in ElectronBrowserClient::OverrideWebkitPrefs()

* chore: savepoint

* chore: savepoint

* chore: savepoint

* chore: savepoint

* chore: remove logging

* fix: unconditionally write

* chore: naming

* chore: add code comments

* chore: more code comments

* chore: remove unrelated changes

* chore: remove redundant static keyword on function in anonymous namespace

* refactor: naming

* refactor: naming

* refactor: naming

* refactor: slightly more explicit typing

* refactor: remove unnecessary utf16 -> utf8 -> utf16 conversion steps

* chore: remove unused #includes
2024-09-30 15:09:36 +02:00
electron-roller[bot]
af58931efa chore: bump chromium to 131.0.6744.0 (main) (#43948)
* chore: bump chromium in DEPS to 131.0.6738.0

* chore: bump chromium in DEPS to 131.0.6740.0

* 5889025: [LaCrOS] Remove LaCrOS screen capturer. | https://chromium-review.googlesource.com/c/chromium/src/+/5889025

* https://boringssl.googlesource.com/boringssl.git/+/40dd94116ba03678226443ba20c5887459c9bf16/crypto/fipsmodule/digest/digests.c.inc

* chore: update patches

* 5878695: Add IsolationInfo for embedders handling external protocols | https://chromium-review.googlesource.com/c/chromium/src/+/5878695

* 5854304: [UI] Remove alias of mojom  | https://chromium-review.googlesource.com/c/chromium/src/+/5854304

* chore: bump chromium in DEPS to 131.0.6742.0

* chore: update patches

* chore: bump chromium in DEPS to 131.0.6744.0

* fixup! 5889025: [LaCrOS] Remove LaCrOS screen capturer. | https://chromium-review.googlesource.com/c/chromium/src/+/5889025

* chore: e patches all

* chore: update chore_provide_iswebcontentscreationoverridden_with_full_params.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5894233

* [UI] Remove alias of mojom 'WindowShowState'

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5854304

* chore: gen-libc++-filenames.js

* chore: partially revert https://chromium-review.googlesource.com/c/chromium/src/+/5894233

see patch commit message for description

* Clean up stale base::Feature "kFileSystemAccessLocalUNCPathBlock"

This feature is always on by default and doesn't have active finch
experiments.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5881253

* fix: asar integrity test recognizes SIGABRT as a crash

https://chromium-review.googlesource.com/c/chromium/src/+/5882758

ValidateIntegrityOrDie() exits via LOG(FATAL)'s call to
base::ImmediateCrash(). There's been churn there upstream between
5332940 and 5882758 on whether to use SIGTRAP or SIGABRT.  For now,
let's accept both until the churn is done.

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: alice <alice@makenotion.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-09-30 14:54:44 +02:00
Charles Kerr
eb40d2cbfa fix: FTBFS when building with enable_plugins = false (#44003)
* fix: do not build electron_plugin_info_host_impl.cc when plugins are disabled

it fails to build from source with this error:

../../content/public/browser/plugin_service.h:17:2: error: "Plugins should be enabled"
   17 | #error "Plugins should be enabled"

* fix: FTBFS in printing_utils.cc when ENABLE_PDF is false

* fixup! fix: do not build electron_plugin_info_host_impl.cc when plugins are disabled

fix BUILD.gn linting
2024-09-29 17:10:34 -05:00
John Kleinschmidt
27d2a8f9e2 ci: write test logging to console on Windows (#43990)
test: write logging to console on Windows
2024-09-27 15:17:32 -04:00
Shelley Vohr
d4e4cdee6c fix: remove resize listener when BrowserWindow closed (#43972) 2024-09-27 10:34:00 -04:00
Robo
f68184a9f9 feat: add error event for utility process (#43774)
* feat: add error event for utility process

* chore: use public report api

* chore: fix lint

* doc: mark error event as experimental

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-09-27 10:17:06 +09:00
Charles Kerr
8397fef3ef chore: remove unused nogncheck includes (#43964) 2024-09-26 17:09:42 -05:00
Charles Kerr
852f9ff329 perf: build g_dgettext domain name at compile time (#43960)
perf: build GettextPackage name at compile time
2024-09-26 13:10:30 -04:00
Charles Kerr
a974b74e82 fix: replace deprecated libnotify API calls (#43962)
notify_notification_set_hint_string() is deprecated, so let's use
notify_notification_set_hint() instead.

Xref: 2fe1748295
2024-09-26 11:21:45 -05:00
Shelley Vohr
da6ab92353 fix: ensure correct WebContents when checking PDFReadyToPrint (#43943)
* fix: ensure correct WebContents when checking PDFReadyToPrint

* test: fix paths on Windows
2024-09-26 10:54:13 -04:00
Charles Kerr
ddd45db6ca fix: -Wunsafe-buffer-usage warnings in GdkPixbufFromSkBitmap() (#43956)
* fix: -Wunsafe-buffer-usage warnings in GdkPixbufFromSkBitmap()

* refactor: don't change previous behavior for 0-height images

Is a 0x0 image even a thing? I'm not sure; but just in case, let's
treat it the same way the previous implementation did.
2024-09-26 08:32:43 -05:00
John Kleinschmidt
40cae71df8 test: re-enable tests that were disabled in chromium rolls (#43968)
* test: fix should support base url for data urls test

Caused by https://chromium-review.googlesource.com/c/chromium/src/+/5802682

* test: fixup extensions can cancel http requests

* chore: document custom protocol handling on Windows change due to Non-Special Scheme URLs shipping

https://chromium-review.googlesource.com/c/chromium/src/+/5802682
2024-09-26 08:53:27 -04:00
electron-appveyor-updater[bot]
b60013fcf1 build: update appveyor image to latest version (#43971)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-09-26 13:10:34 +02:00
Samuel Attard
74af96da16 build: update some build dependencies (#43882)
* build: update some build dependencies

* build: fix eslint issues after updating

* build: disable ts check on busted js example

* build: update internal types for stricter event handling

* restore url.parse behavior

* fix typing issues

* sigh

* build: update easy deps

* build: skip woa engines check
2024-09-26 00:12:11 -07:00
Fedor Indutny
15db63e26d fix: SCContentSharingPicker crash in iframes (#43905)
When running `getDisplayMedia` from an `iframe` and then destroying that
`iframe`, the destrutcor for ScreenCaptureKitDeviceMac gets run, but it
doesn't clean up the observers for the shared macOS picker.

In this change we remove the observer on cleanup and fix the associated
crash:

    *** Terminating app due to uncaught exception 'NSGenericException', reason: '*** Collection <__NSArrayM: 0x12c024123a0> was mutated while being enumerated.'
     0   CoreFoundation                      0x000000018eda0ec0 __exceptionPreprocess + 176
     1   libobjc.A.dylib                     0x000000018e886cd8 objc_exception_throw + 88
     2   CoreFoundation                      0x000000018ee47f80 -[__NSSingleObjectEnumerator init] + 0
     3   ScreenCaptureKit                    0x000000022971f3e0 -[SCContentSharingPicker contentPickerDidSelectFilter:forStream:] + 436
     4   ReplayKit                           0x00000001d7b879d8 -[RPScreenRecorder contentPickerDidSelectFilter:forStream:] + 84
     5   ReplayKit                           0x00000001d7b95ce0 -[RPDaemonProxy contentPickerDidSelectFilter:forStream:] + 224
     6   CoreFoundation                      0x000000018ed0e8b4 __invoking___ + 148
     7   CoreFoundation                      0x000000018ed0e72c -[NSInvocation invoke] + 428
     8   ReplayKit                           0x00000001d7b91678 -[RPDaemonProxy connection:handleInvocation:isReply:] + 316
     9   Foundation                          0x0000000190899f64 -[NSXPCConnection _decodeAndInvokeMessageWithEvent:reply:flags:] + 1108
     10  Foundation                          0x000000019089b7d0 message_handler_message + 88
     11  Foundation                          0x000000018feb0160 message_handler + 152
     12  libxpc.dylib                        0x000000018e954460 _xpc_connection_call_event_handler + 144
     13  libxpc.dylib                        0x000000018e952bb4 _xpc_connection_mach_event + 1120
     14  libdispatch.dylib                   0x000000018ea94718 _dispatch_client_callout4 + 20
     15  libdispatch.dylib                   0x000000018eab0c00 _dispatch_mach_msg_invoke + 464
     16  libdispatch.dylib                   0x000000018ea9bae8 _dispatch_lane_serial_drain + 368
     17  libdispatch.dylib                   0x000000018eab1954 _dispatch_mach_invoke + 456
     18  libdispatch.dylib                   0x000000018ea9bae8 _dispatch_lane_serial_drain + 368
     19  libdispatch.dylib                   0x000000018ea9c79c _dispatch_lane_invoke + 432
    20  libdispatch.dylib                   0x000000018eaa77e8 _dispatch_root_queue_drain_deferred_wlh + 288
    21  libdispatch.dylib                   0x000000018eaa7034 _dispatch_workloop_worker_thread + 540
    22  libsystem_pthread.dylib             0x000000018ec433d8 _pthread_wqthread + 288
    23  libsystem_pthread.dylib             0x000000018ec420f0 start_wqthread + 8
2024-09-25 16:43:23 -07:00
dependabot[bot]
ff36ff84b7 build(deps-dev): bump eslint-plugin-promise from 4.3.1 to 7.1.0 (#43935)
Bumps [eslint-plugin-promise](https://github.com/eslint-community/eslint-plugin-promise) from 4.3.1 to 7.1.0.
- [Release notes](https://github.com/eslint-community/eslint-plugin-promise/releases)
- [Changelog](https://github.com/eslint-community/eslint-plugin-promise/blob/main/CHANGELOG.md)
- [Commits](https://github.com/eslint-community/eslint-plugin-promise/compare/v4.3.1...v7.1.0)

---
updated-dependencies:
- dependency-name: eslint-plugin-promise
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-25 16:49:03 -05:00
dependabot[bot]
846b31b77d build(deps-dev): bump @types/chai-as-promised from 7.1.3 to 8.0.1 (#43936)
Bumps [@types/chai-as-promised](https://github.com/DefinitelyTyped/DefinitelyTyped/tree/HEAD/types/chai-as-promised) from 7.1.3 to 8.0.1.
- [Release notes](https://github.com/DefinitelyTyped/DefinitelyTyped/releases)
- [Commits](https://github.com/DefinitelyTyped/DefinitelyTyped/commits/HEAD/types/chai-as-promised)

---
updated-dependencies:
- dependency-name: "@types/chai-as-promised"
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-25 09:06:26 -05:00
John Beutner
c8895d0547 fix: close all open sheets before closing window on macOS (#43706) 2024-09-25 13:23:49 +02:00
Charles Kerr
1d3b1284c4 test: ensure sender-pid hint is set in Linux notifications (#43928)
test: expect a `sender-pid` hint in Linux notifications.

This PR ensures that the `sender-pid` hint is set for new notifications.
It also updates the spec to confirm that DBus receives the hint and that
it has the correct value.

This fixes a spec failure when running libnotify >= 0.7.12 (2022-05-05).
Starting with that version, libnotify started injecting `sender-pid` if
not provided by the client. So our tests received a slightly different
DBus payload depending on what version of libnotify was installed,
causing our deep-equals tests to fail.

By always providing and testing the `sender-pid` hint, our behavior and
tests should be consistent across distros.
2024-09-25 13:20:36 +02:00
electron-roller[bot]
30fbeec036 chore: bump chromium to 131.0.6734.0 (main) (#43769)
* chore: bump chromium in DEPS to 130.0.6723.4

* chore: bump chromium in DEPS to 131.0.6724.0

* chore: update patches

* chore: update libc++ filenames

* 5844369: controlledframe: Disable Web Bluetooth for <webview> & <controlledframe>
https://chromium-review.googlesource.com/c/chromium/src/+/5844369

* (multiple CLs): Use an opaque type for FrameTreeNode IDs

5807683: Use an opaque type for FrameTreeNode IDs, part 1 | https://chromium-review.googlesource.com/c/chromium/src/+/5807683
5829746: Use an opaque type for FrameTreeNode IDs, part 2 | https://chromium-review.googlesource.com/c/chromium/src/+/5829746
5836903: Use an opaque type for FrameTreeNode IDs, part 7 | https://chromium-review.googlesource.com/c/chromium/src/+/5836903
5837249: Use an opaque type for FrameTreeNode IDs, part 8 | https://chromium-review.googlesource.com/c/chromium/src/+/5837249
5836564: Use an opaque type for FrameTreeNode IDs, part 12 | https://chromium-review.googlesource.com/c/chromium/src/+/5836564
5837180: Use an opaque type for FrameTreeNode IDs, part 15 | https://chromium-review.googlesource.com/c/chromium/src/+/5837180

* 5822889: [task] Make GetForegroundTaskRunner non-virtual
https://chromium-review.googlesource.com/c/v8/v8/+/5822889

* 5833297: Remove unused inner WebContents attach params
https://chromium-review.googlesource.com/c/chromium/src/+/5833297

* 5806403: Shift PowerMonitor to non static
https://chromium-review.googlesource.com/c/chromium/src/+/5806403

* 5666874: [3/N] Remove old OnPowerChange in PowerObserver
https://chromium-review.googlesource.com/c/chromium/src/+/5666874

* 5829085: [v8] Differentiate between UserVisible and BestEffort task runners
https://chromium-review.googlesource.com/c/chromium/src/+/5829085

* 5791112: [webrtc] Use `c/b/permissions/system` for system permissions
https://chromium-review.googlesource.com/c/chromium/src/+/5791112

* 5825636: [Extensions] Create WebContentsObservers with ExtensionsBrowserClient
https://chromium-review.googlesource.com/c/chromium/src/+/5825636

* fixup! (multiple CLs): Use an opaque type for FrameTreeNode IDs

* fixup! 5791112: [webrtc] Use `c/b/permissions/system` for system permissions https://chromium-review.googlesource.com/c/chromium/src/+/5791112

* chore: bump chromium in DEPS to 131.0.6726.0

* chore: update patches

* chore: update libc++ filenames

* 5858119: Declutter: Allow opening to a specific feature
https://chromium-review.googlesource.com/c/chromium/src/+/5858119

* fix: macOS SDK 15 error

Not sure exactly what changed in the upgrade to macOS SDK 15, but it triggered a new error:

```
electron/shell/browser/ui/message_box_mac.mm:84:7: error: multiple methods named 'highlight:' found with mismatched result, parameter type or attributes
```

The `highlight:` selector a few lines down was ambiguous because the object type of the `NSArray` was not specified. Specifying `NSButton` as the element type makes the selector unambiguous for type checking.

* 5854143: [File Download Access Prevention] Obfuscate download file for enterprise deep scan
https://chromium-review.googlesource.com/c/chromium/src/+/5854143

* 5854811: Use kNotAllowedError instead of kSecurityError for Web MIDI
https://chromium-review.googlesource.com/c/chromium/src/+/5854811

* chore: bump chromium in DEPS to 131.0.6728.0

* chore: update patches

* disable invalid test

* chore: bump chromium in DEPS to 131.0.6730.0

* chore: update patches

* update build tools target commit for new macOS SDK

* chore: update libc++ file names

* chore: bump chromium in DEPS to 131.0.6732.0

* chore: bump chromium in DEPS to 131.0.6734.0

* 5856527: [UI] Use mojo enum for `WindowShowState` in ui/

https://chromium-review.googlesource.com/c/chromium/src/+/5856527

* chore: update build-tools sha to include macOD 15.0 SDK

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: alice <alice@makenotion.com>
2024-09-25 06:19:39 -05:00
Charles Kerr
af54c5a4b6 test: add tests dbus notification images (#43938)
Provide a NativeImage icon in the notification tests and then inspect
the DBus message payload's `image_data` hint to see if it's correct.
This adds test coverage for LibnotifyNotification::Show() and for
GdkPixbufFromSkBitmap().
2024-09-25 13:17:27 +02:00
Shelley Vohr
bcf4095ace fix: crash when focusing WebView webContents (#43921)
fix: crash when focusing WebView
2024-09-24 18:19:04 -05:00
Charles Kerr
500d4f0d05 fix: -Wunsafe-buffer-usage warning in asar_util's ReadFileToString() (#43896) 2024-09-24 15:41:24 -05:00
CezaryKulakowski
e64a66bfd3 fix: detach native view when its removed from parent on macOS (#43627)
Right now DelayedNativeViewHost attaches its underlying native view
when it's being attached to a widget but it doesn't detach it when
it's being detached. It may lead to use-after-free and crash.
2024-09-24 15:28:36 +02:00
dependabot[bot]
7222a9fe1f build(deps-dev): bump null-loader from 4.0.0 to 4.0.1 (#43904)
Bumps [null-loader](https://github.com/webpack-contrib/null-loader) from 4.0.0 to 4.0.1.
- [Release notes](https://github.com/webpack-contrib/null-loader/releases)
- [Changelog](https://github.com/webpack-contrib/null-loader/blob/master/CHANGELOG.md)
- [Commits](https://github.com/webpack-contrib/null-loader/compare/v4.0.0...v4.0.1)

---
updated-dependencies:
- dependency-name: null-loader
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-24 10:13:43 +02:00
dependabot[bot]
65e3c336e0 build(deps-dev): bump eslint from 8.41.0 to 8.57.1 (#43903)
Bumps [eslint](https://github.com/eslint/eslint) from 8.41.0 to 8.57.1.
- [Release notes](https://github.com/eslint/eslint/releases)
- [Changelog](https://github.com/eslint/eslint/blob/main/CHANGELOG.md)
- [Commits](https://github.com/eslint/eslint/compare/v8.41.0...v8.57.1)

---
updated-dependencies:
- dependency-name: eslint
  dependency-type: direct:development
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-23 23:31:47 -07:00
Charles Kerr
79627deea3 refactor: add SerialChooserController::web_contents_ (#43823)
Add a `base::WeakPtr<WebContents>` field to SerialChooserController and
stop subclassing from WebContentsObserver. This follows the Observer docs:

> don't create a `WebContentsObserver` just to be able to check
> for a null `WebContentsObserver::web_contents()`.
> Use a `base::WeakPtr<WebContents>` instead.
2024-09-23 22:38:13 -07:00
Charles Kerr
9598d88b7c refactor: remove C-style void arg type for no-arg functions (#43884)
A small cleanup to remove use of the C-style function declaration idiom.
2024-09-23 22:37:32 -07:00
Charles Kerr
01330805cb refactor: prefer member initializers in asar structs (#43883)
prefactor: prefer member initializers in asar::Archive

prefactor: prefer member initializers in asar::Archive::FileInfo

prefactor: prefer member initializers in asar::IntegrityPayload
2024-09-23 22:37:18 -07:00
Charles Kerr
33d7c9ac3e refactor: hide printing impl details in api::WebContents (#43893)
* refactor: move api::WebContents::OnGetDeviceNameToUse() into an anonymous namespace

* refactor: move api::WebContents::OnPDFCreated() into an anonymous namespace

* refactor: remove unused #include
2024-09-23 22:36:55 -07:00
Keeley Hammond
a3af8ea768 build: use Node 20 in Appveyor images (#43897)
* build: update Appveyor to Node 20

* build: update appveyor images

* chore: return bake script to original form
2024-09-23 16:58:46 -07:00
dependabot[bot]
82879d1f43 build(deps-dev): bump webpack-cli from 4.10.0 to 5.1.4 (#43880)
Bumps [webpack-cli](https://github.com/webpack/webpack-cli) from 4.10.0 to 5.1.4.
- [Release notes](https://github.com/webpack/webpack-cli/releases)
- [Changelog](https://github.com/webpack/webpack-cli/blob/master/CHANGELOG.md)
- [Commits](https://github.com/webpack/webpack-cli/compare/webpack-cli@4.10.0...webpack-cli@5.1.4)

---
updated-dependencies:
- dependency-name: webpack-cli
  dependency-type: direct:development
  update-type: version-update:semver-major
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-23 18:21:43 -05:00
Erick Zhao
fb5baec6d5 docs: add advanced specification for Squirrel updater (#43234)
* docs: add advanced specification for Squirrel updater

* address feedback
2024-09-23 10:20:43 -07:00
Alice Zhao
ceea1225a2 docs: navigation history example (#42980)
* docs: add fiddle example

* docs: add tutorial guide

* refactor: PR review comments

* refactor: add eof

* refactor: render navigation history and make demo better.

* refactor: fix broken links

* refactor: add eof newline

* docs: review feedback :)

* chore: lint add space around list

* doc: transformURL
2024-09-23 10:18:26 -07:00
Samuel Attard
517d04de16 build: add support for fetching github token from sudowoodo (#43808)
* build: add support for fetching github token from sudowoodo

* chore: update release notes cache for tests

* build: support nightlies repo correctly

* build: post token
2024-09-23 09:39:54 -07:00
dependabot[bot]
f0afcaa777 build(deps-dev): bump @types/w3c-web-serial from 1.0.3 to 1.0.7 (#43879)
Bumps [@types/w3c-web-serial](https://github.com/DefinitelyTyped/DefinitelyTyped/tree/HEAD/types/w3c-web-serial) from 1.0.3 to 1.0.7.
- [Release notes](https://github.com/DefinitelyTyped/DefinitelyTyped/releases)
- [Commits](https://github.com/DefinitelyTyped/DefinitelyTyped/commits/HEAD/types/w3c-web-serial)

---
updated-dependencies:
- dependency-name: "@types/w3c-web-serial"
  dependency-type: direct:development
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-23 08:07:53 -05:00
Samuel Attard
be68d4f336 build: update-check-skip on dependabot backport PRs (#43874) 2024-09-23 11:08:03 +02:00
dependabot[bot]
0fb50c408b build(deps): bump github/codeql-action from 3.26.7 to 3.26.8 (#43826)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.7 to 3.26.8.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](8214744c54...294a9d9291)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-23 11:04:21 +02:00
dependabot[bot]
1b52f005ee build(deps): bump actions/setup-node from 4.0.3 to 4.0.4 (#43825)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.0.3 to 4.0.4.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](1e60f620b9...0a44ba7841)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-22 23:40:30 -07:00
Samuel Attard
da449b00dd build: stop dependabot doing things (#43871) 2024-09-22 23:10:23 -07:00
Samuel Attard
8be458d1a2 build: enable dependabot on supported branches (#43755) 2024-09-22 22:57:23 -07:00
Charles Kerr
e894839709 fix: -Wunsafe-buffer-usage warnings in GetNextZoomLevel() (#43803) 2024-09-21 17:21:02 -05:00
Shelley Vohr
f89bd745d5 fix: createWindow shouldn't load URL for webContents (#43775)
* fix: createWindow shouldn't load URL for webContents

* chore: add non about blank test
2024-09-20 09:56:03 +02:00
Charles Kerr
bcb7362ab9 docs: document Windows pitfall when updating patches (#43787) 2024-09-19 23:35:21 -05:00
Charles Kerr
53e89b565d fix: -Wunsafe-buffer-usage warnings in Clipboard::WriteBuffer() (#43795)
* fix: -Wunsafe-buffer-usage warnings in Clipboard::WriteBuffer()

* chore: add a DCHECK to confirm the BigBuffer is full
2024-09-19 23:10:35 -05:00
Fedor Indutny
6aa6bada79 fix: third time screen sharing on macOS (#43767)
Because we used decrementing negative source ids for fake video id when
instantating a native macOS screen share picker, we eventually hit the
`DesktopMediaID::kFakeId = -3` in Chromium source code which displayed a
test green screen.

In this change we reserve our own fake id of `-4` and decrement the
window id integer for uniqueness instead.

Co-authored-by: Fedor Indutny <238531+indutny@users.noreply.github.com>
2024-09-19 18:28:28 -07:00
Charles Kerr
d100921289 refactor: NotificationPresenter::Create() returns a std::unique_ptr<> (#43794) 2024-09-19 19:02:49 -05:00
BILL SHEN
855f219301 chore: fix compile issue about ambiguous error of multiple methods named 'highlight'. (#43773)
chore: fix ambiguous error of multiple methods named 'highlight'
2024-09-19 13:01:36 +02:00
dependabot[bot]
0ac8ff6439 build(deps): bump path-to-regexp from 1.8.0 to 1.9.0 in /spec in the npm_and_yarn group across 1 directory (#43753)
build(deps): bump path-to-regexp

Bumps the npm_and_yarn group with 1 update in the /spec directory: [path-to-regexp](https://github.com/pillarjs/path-to-regexp).


Updates `path-to-regexp` from 1.8.0 to 1.9.0
- [Release notes](https://github.com/pillarjs/path-to-regexp/releases)
- [Changelog](https://github.com/pillarjs/path-to-regexp/blob/master/History.md)
- [Commits](https://github.com/pillarjs/path-to-regexp/compare/v1.8.0...v1.9.0)

---
updated-dependencies:
- dependency-name: path-to-regexp
  dependency-type: indirect
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-19 10:34:06 +02:00
Charles Kerr
5904d31264 perf: hold V8FunctionInvoker args in a std::array (#43752)
perf: hold V8FunctionInvoker args in a std::array
2024-09-18 16:23:29 -05:00
Samuel Attard
8cff5a7d20 build: let darwin/mas run concurrently (#43788) 2024-09-18 13:54:58 -07:00
Charles Kerr
d897359b82 perf: hold Emit() arg arrays in a std::array (#43750)
* refactor: CallMethodWithArgs() now takes a span of value handles

* perf: use std::array instead of std::vector to hold Emit arg parameter packs

* chore: remove unused gin_helper::EmitEvent(iso, obj, name, span<Local>)
2024-09-18 09:40:14 -05:00
electron-appveyor-updater[bot]
02fd8bbcc1 build: update appveyor image to latest version (#43772)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-09-18 09:39:49 -05:00
electron-roller[bot]
4bcbc955dd chore: bump chromium to 130.0.6695.0 (main) (#43454)
* chore: bump chromium in DEPS to 130.0.6673.0

* chore: bump chromium in DEPS to 130.0.6675.0

* chore: bump chromium in DEPS to 130.0.6677.2

* chore: bump chromium in DEPS to 130.0.6679.0

* 5802981: [Partitioned Popins] UKM

https://chromium-review.googlesource.com/c/chromium/src/+/5802981

* 5799275: ash: Create //chrome/browser/ui/ash/web_view

https://chromium-review.googlesource.com/c/chromium/src/+/5799275

* 5791853: [PWA] Allow WebContentsImpl::CreateNewWindow() to use new web contents for loading url

https://chromium-review.googlesource.com/c/chromium/src/+/5791853

* 5805208: Move third_party/jacoco to a cipd/ subdirectory.

https://chromium-review.googlesource.com/c/chromium/src/+/5805208

* chore: fixup patch indices

* 5771091: Introduce InputManager class for handling input in Viz.

https://chromium-review.googlesource.com/c/chromium/src/+/5771091

* 5498921: [Permission] Remove SubscribeToPermissionStatusChange from PermissionManager

https://chromium-review.googlesource.com/c/chromium/src/+/5498921

* 5791853: [PWA] Allow WebContentsImpl::CreateNewWindow() to use new web contents for loading url

https://chromium-review.googlesource.com/c/chromium/src/+/5791853

* 5801311: Don't use int for bindings

https://chromium-review.googlesource.com/c/chromium/src/+/5801311

* 5548827: [Web Install] Define the web-app-installation PermissionPolicy

https://chromium-review.googlesource.com/c/chromium/src/+/5548827

* 5786325: Add Infrastructure for Hand tracking permission

https://chromium-review.googlesource.com/c/chromium/src/+/5786325

* chore: fixup patch indices

* chore: bump chromium in DEPS to 130.0.6681.0

* [Views AX] Move BrowserAccessibility* to //ui/accessibility/platform

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5520052

* chore: e patches all

* Don't have default arguments on virtual functions in render_frame_host.h

https://chromium-review.googlesource.com/c/chromium/src/+/5809399

* test: log if loadURL fails in base url test

* chore: bump chromium in DEPS to 130.0.6683.2

* chore: fix support_mixed_sandbox_with_zygote.patch

content: restore old DisableJit behavior

https://chromium-review.googlesource.com/c/chromium/src/+/5804255

* chore: update patch indices

* chore: bump chromium in DEPS to 130.0.6685.0

* Parallel process launching

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5015584

* chore: update feat_expose_documentloader_setdefersloading_on_webdocumentloader.patch

No manual changes; patch applied with fuzz 1

* chore: e patches all

* chore: bump chromium in DEPS to 130.0.6687.0

* chore: bump chromium in DEPS to 130.0.6689.0

* chore: bump chromium in DEPS to 130.0.6691.0

* chore: bump chromium in DEPS to 130.0.6693.0

* chore: update patches

* chore: bump chromium in DEPS to 130.0.6695.0

* chore: free up macos disk space as soon as possible

* 5824143: Use checked in source lists for third_party/boringssl

https://chromium-review.googlesource.com/c/chromium/src/+/5824143

* chore: update patches

* 5824122: Extensions: Add a new view type enum for developer tools contexts

https://chromium-review.googlesource.com/c/chromium/src/+/5824122

* 5806109: Option for JavaScriptExecuteRequestForTests() to ignore content settings

https://chromium-review.googlesource.com/c/chromium/src/+/5806109

* build: free up disk space on gn check too

* 5799369: [Refactoring] Make allow_http1_for_streaming_upload flags false.

https://chromium-review.googlesource.com/c/chromium/src/+/5799369

* fixup! 5015584: Parallel process launching | https://chromium-review.googlesource.com/c/chromium/src/+/5015584

* Disable failing test for short-term

See: https://github.com/electron/electron/issues/43730

* oops

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: clavin <clavin@electronjs.org>
2024-09-17 18:12:11 -07:00
Samuel Attard
de33cc68f6 build: split darwin/mas macOS publish jobs (#43754) 2024-09-17 15:32:47 -07:00
Samuel Attard
f987f8ad83 build: improve logging on http errors during release process (again, but more) (#43758) 2024-09-17 15:01:02 -07:00
Samuel Attard
cf4ab2186c build: improve logging on http errors during release process (again) (#43757) 2024-09-17 14:49:59 -07:00
Samuel Attard
10ba87a85e build: improve logging on http errors during release process (#43756) 2024-09-17 14:30:51 -07:00
Charles Kerr
233724fe00 chore: iwyu mojom-forward header files (#43741)
* chore: iwyu mojom.h headers

* fixup! chore: iwyu mojom.h headers

make previously-indirect include dependency direct

* fixup! fixup! chore: iwyu mojom.h headers

make previously-indirect include dependency direct
2024-09-17 12:58:56 -07:00
dependabot[bot]
4dc923a327 build(deps): bump the npm_and_yarn group across 2 directories with 5 updates (#43681)
Bumps the npm_and_yarn group with 1 update in the / directory: [express](https://github.com/expressjs/express).
Bumps the npm_and_yarn group with 1 update in the /spec directory: [send](https://github.com/pillarjs/send).


Updates `express` from 4.19.2 to 4.20.0
- [Release notes](https://github.com/expressjs/express/releases)
- [Changelog](https://github.com/expressjs/express/blob/master/History.md)
- [Commits](https://github.com/expressjs/express/compare/4.19.2...4.20.0)

Updates `body-parser` from 1.20.2 to 1.20.3
- [Release notes](https://github.com/expressjs/body-parser/releases)
- [Changelog](https://github.com/expressjs/body-parser/blob/master/HISTORY.md)
- [Commits](https://github.com/expressjs/body-parser/compare/1.20.2...1.20.3)

Updates `path-to-regexp` from 0.1.7 to 0.1.10
- [Release notes](https://github.com/pillarjs/path-to-regexp/releases)
- [Changelog](https://github.com/pillarjs/path-to-regexp/blob/master/History.md)
- [Commits](https://github.com/pillarjs/path-to-regexp/compare/v0.1.7...v0.1.10)

Updates `serve-static` from 1.15.0 to 1.16.0
- [Release notes](https://github.com/expressjs/serve-static/releases)
- [Changelog](https://github.com/expressjs/serve-static/blob/master/HISTORY.md)
- [Commits](https://github.com/expressjs/serve-static/compare/v1.15.0...1.16.0)

Updates `send` from 0.16.2 to 0.19.0
- [Release notes](https://github.com/pillarjs/send/releases)
- [Changelog](https://github.com/pillarjs/send/blob/master/HISTORY.md)
- [Commits](https://github.com/pillarjs/send/compare/0.16.2...0.19.0)

---
updated-dependencies:
- dependency-name: express
  dependency-type: direct:development
  dependency-group: npm_and_yarn
- dependency-name: body-parser
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: path-to-regexp
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: serve-static
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: send
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-09-17 11:27:32 -04:00
Charles Kerr
5a76655fb8 fix: in Emit(), don't leak converted Arg Local<Values> into caller's scope (#43729)
fix: Emit() should not leak converted arg handles into caller's HandleScope
2024-09-17 09:00:52 -05:00
Shelley Vohr
aa719a4066 fix: resizing border on Linux WCO caption buttons (#43724)
Closes https://github.com/electron/electron/issues/43714.

Fixes an issue where the resizing border was not being handled correctly on Linux WCO
caption buttons. This is now taken into account as a part of the NonClientHitTest.
2024-09-17 11:56:43 +02:00
Samuel Attard
c1c8fbfd9a build: make is_mas_build a generated header instead of config (#43737) 2024-09-17 01:38:56 -07:00
dependabot[bot]
b83810982e build(deps): bump github/codeql-action from 3.26.6 to 3.26.7 (#43738)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.6 to 3.26.7.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4dd16135b6...8214744c54)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-16 23:09:24 -05:00
Charles Kerr
b6bf277b6f refactor: reduce code duplication in gin_helper::Promise (#43716)
* refactor: move scope scaffolding into SettletScope

idea stolen from SpellCheckScope

* refactor: move impl of PromiseBase::RejectPromise() to the cc file

* chore: remove unused #include
2024-09-16 23:08:40 -05:00
Charles Kerr
05dfd14913 refactor: add EmitWarning(v8::Isolate*) helper (#43722)
* refactor: add EmitWarning(Isolate*, ...) warning

* chore: remove EmitWarning(node::Environment*, ...)

* chore: add code comments

* fixup! refactor: add EmitWarning(Isolate*, ...) warning

* chore: remove unused node #includes
2024-09-16 15:53:04 -05:00
John Kleinschmidt
7d4f202c1c ci: move Archaeologist to GHA (#43701)
* chore: move Archaeologist to GHA

* chore: test archaelogist changes

* Revert "chore: test archaelogist changes"

This reverts commit a575d6ef3a.

* chore: properly name steps in archaeologist-dig
2024-09-16 15:58:51 -04:00
Niklas Wenzel
f84ffc8fc8 fix: prevent loading spinner when launching utility process on Windows (#43657)
fix: prevent spinning cursor when launching utility process on Windows
2024-09-16 14:20:42 -04:00
Niklas Wenzel
8f0dffea9e docs: document View.removeChildView edge case (#43673) 2024-09-16 11:32:03 +02:00
Charles Kerr
1c3a5ba5d1 refactor: remove use of deprecated API BuildServiceInstanceFor() (#43690)
* refactor: update BadgeManagerFactory

* refactor: update NetworkContextServiceFactory

* refactor: update ElectronExtensionSystemFactory

* refactor: update UsbChooserContextFactory

* refactor: update UsbHidChooserContextFactory

* refactor: update SerialChooserContextFactory

* refactor: update FileSystemAccessPermissionContextFactory
2024-09-12 15:44:14 -05:00
Piotr Płaczek
29c2744e57 feat: hide menu bar on windows fullscreen (#43402)
* feat: hide menu bar on windows fullscreen

* test: state prior to html fullscreen transition

* refactor: restore `#ifdef` for readability

Reference: https://github.com/electron/electron/pull/43402#discussion_r1729356262

* docs: menu bar behavior changed

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-09-12 20:13:04 +02:00
Charles Kerr
3dd7e46291 refactor: avoid minor code repetition in native_image.cc (#43689)
chore: delegate handle creation in NativeImage::Resize()

chore: delegate handle creation in NativeImage::Crop()

chore: delegate handle creation in NativeImage::CreateEmpty()
2024-09-12 10:56:15 -05:00
Charles Kerr
45bae950d5 chore: remove unused base/ includes (#43688) 2024-09-12 16:05:37 +02:00
Shelley Vohr
3c8321a987 fix: EyeDropper working in devtools (#43685) 2024-09-12 15:40:56 +02:00
Shelley Vohr
74b54278bf fix: native View wrapper crash missing when adding child view (#43638)
fix: native View wrapper crash missing when adding child view
2024-09-12 10:01:05 +02:00
Shelley Vohr
dea6a4e5fb fix: ensure SetPluginCanSave updated in PDFs (#43667)
fix: ensure SetPluginCanSave updated in PDFs
2024-09-11 09:25:05 -04:00
Shelley Vohr
90fbf30491 build: compile Node.js with C++20 support (#43555)
* build: compile with C++20 support

* build: update build-image-sha for gcc 10
2024-09-11 09:01:46 -04:00
dependabot[bot]
5580349c3a build(deps-dev): bump webpack from 5.76.0 to 5.94.0 in the npm_and_yarn group across 1 directory (#43659)
build(deps-dev): bump webpack

Bumps the npm_and_yarn group with 1 update in the / directory: [webpack](https://github.com/webpack/webpack).


Updates `webpack` from 5.76.0 to 5.94.0
- [Release notes](https://github.com/webpack/webpack/releases)
- [Commits](https://github.com/webpack/webpack/compare/v5.76.0...v5.94.0)

---
updated-dependencies:
- dependency-name: webpack
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-11 09:56:03 +02:00
Keeley Hammond
309d5dade3 feat: add support for system picker in setDisplayMediaRequestHandler (#43581)
* tmp

* feat: add support for system picker in setDisplayMediaRequestHandler

* oops

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* stuff

* well...

* seems legit

* chore: update patch to handle screenCapturer

* feat: modify API to use useSystemPicker

* fix: gate ScreenCaptureKitPicker to macos 15 or higher

* fix: don't use native picker with legacy media selection

* chore: code review, boolean set & docs update

* fix: add cancelCallback

* docs: clarify session & desktopCapturer docs

---------

Co-authored-by: Samuel Attard <marshallofsound@electronjs.org>
Co-authored-by: Samuel Attard <sam@electronjs.org>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2024-09-10 16:05:57 -07:00
Charles Kerr
a3df950281 fix: -Wunsafe-buffer-usage warning in V8Serializer::Serialize() (#43642) 2024-09-10 15:05:05 -05:00
Milan Burda
0cc60500ed fix: restore Chromium default Content-Disposition header parsing (#43611)
* fix: restore Chromium default Content-Disposition header parsing

* Update api-web-request-spec.ts
2024-09-10 15:32:30 +02:00
Charles Kerr
f1019c2c4a fix: -Wunsafe-buffer-usage warnings in asar file IO (#43624)
* fix: -Wunsafe-buffer-usage warnings in ScopedTemporaryFile::InitFromFile()

* fix: -Wunsafe-buffer-usage warnings in Archive::Init()
2024-09-09 16:34:42 -04:00
Charles Kerr
5718ea4e1e fix: out-of-scope Local handle in node::CallbackScope (#43622)
refactor: use an EscapableHandleScope
2024-09-09 12:14:40 -05:00
Charles Kerr
2844e346b9 refactor: use std::optional in MicrotasksScope (#43621)
avoid an unnecessary heap allocation/free
2024-09-09 12:51:42 -04:00
Zorro Liu
e2fe8f50e2 fix: update BrowserView#lastWindowSize after window resize (#43463)
fix: update BrowserView#lastWindowSize after window resize (#43462)
2024-09-09 14:22:30 +02:00
Charles Kerr
8c5e7bbf6b fix: UvHandle move semantics (#43615)
reassign the uv_handle_t of the source
2024-09-09 14:13:39 +02:00
dependabot[bot]
0d4d752c1b build(deps): bump the npm_and_yarn group across 2 directories with 3 updates (#43511)
* build(deps): bump the npm_and_yarn group across 2 directories with 3 updates

Bumps the npm_and_yarn group with 1 update in the / directory: [braces](https://github.com/micromatch/braces).
Bumps the npm_and_yarn group with 3 updates in the /spec directory: [braces](https://github.com/micromatch/braces), [pdfjs-dist](https://github.com/mozilla/pdf.js) and [ws](https://github.com/websockets/ws).


Updates `braces` from 3.0.2 to 3.0.3
- [Changelog](https://github.com/micromatch/braces/blob/master/CHANGELOG.md)
- [Commits](https://github.com/micromatch/braces/compare/3.0.2...3.0.3)

Updates `braces` from 3.0.2 to 3.0.3
- [Changelog](https://github.com/micromatch/braces/blob/master/CHANGELOG.md)
- [Commits](https://github.com/micromatch/braces/compare/3.0.2...3.0.3)

Updates `pdfjs-dist` from 2.16.105 to 4.2.67
- [Release notes](https://github.com/mozilla/pdf.js/releases)
- [Commits](https://github.com/mozilla/pdf.js/compare/v2.16.105...v4.2.67)

Updates `ws` from 7.5.9 to 7.5.10
- [Release notes](https://github.com/websockets/ws/releases)
- [Commits](https://github.com/websockets/ws/compare/7.5.9...7.5.10)

---
updated-dependencies:
- dependency-name: braces
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: braces
  dependency-type: indirect
  dependency-group: npm_and_yarn
- dependency-name: pdfjs-dist
  dependency-type: direct:development
  dependency-group: npm_and_yarn
- dependency-name: ws
  dependency-type: direct:development
  dependency-group: npm_and_yarn
...

Signed-off-by: dependabot[bot] <support@github.com>

* chore: update api-web-contents-spec to us newer version of pdfjs-dist

* test: create fixture to read PDF files for verification

---------

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-09-09 11:49:43 +02:00
Charles Kerr
0568686340 perf: avoid redundant Promise.GetContext calls (#43609)
refactor: avoid redundant Promise.GetContext calls

Several Promise methods call `GetContext()` multiple times. From looking
at the assembly in obj/electron/electron_lib/promise.o, these redundant
calls are actually being made -- they aren't optmized out.

This PR keeps the return value in a local variable to avoid extra calls.
2024-09-07 23:39:42 -05:00
Charles Kerr
44a4328ea8 refactor: take a uint8_t span in ValidateIntegrityOrDie() (#43592)
refactor: take a uint8_t span in ValidateIntegrityOrDie()

Doing some groundwork for fixing unsafe base::File() APIs:

- Change ValidateIntegrityOrDie() to take a span<const uint8_t> arg.
  We'll need this to migrate asar's base::File API calls away from the
  ones tagged `UNSAFE_BUFFER_USAGE` because the safe counterparts use
  span<uint8_t> too.

- Simplify ValidateIntegrityOrDie()'s implementation by using
  crypto::SHA256Hash() instead of reinventing the wheel.
2024-09-06 20:22:44 -05:00
Charles Kerr
18b1b33adc refactor: NativeWindow::Create() returns a unique_ptr (#43576)
refactor: NativeWindow::Create() returns a unique_ptr
2024-09-06 12:59:32 -04:00
Charles Kerr
fe0d4274e2 fix: confirm a v8::Value is a v8::Object before casting it (#43575)
fix: confirm a v8::Value is a v8::Object before casting it
2024-09-06 11:20:04 -05:00
Charles Kerr
cc5aa65cb4 fix: delete UvTaskRunner's timers only after they're closed (#43561)
* fix: free UvTaskRunner timers only after they are closed

* refactor: UvTaskRunner now holds UvHandles
2024-09-06 07:16:56 -05:00
Shelley Vohr
25f4691e78 fix: ensure version of xdg-dialog-portal with defaultPath support (#43570)
fix: ensure version of xdg-dialog-portal with defaultPath support

Closes https://github.com/electron/electron/issues/43310
2024-09-06 11:12:16 +02:00
Charles Kerr
3fde574db1 fix: -Wunsafe-buffer-usage warnings in url-loader (#43564)
Use v8::ArrayBufferView::CopyContents() instead of doing the pointer
math + memcpy() ourselves. This not only solves the buffer warnings,
but may also avoid some additional overhead:

> Copy the contents of the ArrayBufferView's buffer to an
> embedder defined memory without additional overhead that
> calling ArrayBufferView::Buffer might incur.
2024-09-05 20:22:03 -05:00
Shelley Vohr
eff862b083 build: use proper targets for building (#43550) 2024-09-05 17:03:07 -04:00
Kilian Valkhof
32d5f9e3ef docs: explain ipcRenderer behavior in context-bridge.md (#43455)
* docs: explain ipcRenderer behavior in context-bridge.md

* Update context-bridge.md

* Update context-bridge.md

* Update docs/api/context-bridge.md

Co-authored-by: Erik Moura <erikian@erikian.dev>

* Update context-bridge.md

* Update context-bridge.md

* Update context-bridge.md

* Update docs/api/context-bridge.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update docs/api/context-bridge.md

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

---------

Co-authored-by: Erik Moura <erikian@erikian.dev>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2024-09-05 16:48:22 -04:00
Orko Garai
69df09dc90 fix: Launch apps with XDG_ACTIVATION_TOKEN in ozone/wayland (#43480)
* fix: Launch apps with XDG_ACTIVATION_TOKEN in ozone/wayland

Ensure apps are launched with the activation token received from
xdg_activation_v1 protocol.

* add focus_launched_process option
2024-09-05 13:07:10 -05:00
dependabot[bot]
6aae1264dd build(deps): bump slackapi/slack-github-action from 1.26.0 to 1.27.0 (#43530)
Bumps [slackapi/slack-github-action](https://github.com/slackapi/slack-github-action) from 1.26.0 to 1.27.0.
- [Release notes](https://github.com/slackapi/slack-github-action/releases)
- [Commits](70cd7be8e4...37ebaef184)

---
updated-dependencies:
- dependency-name: slackapi/slack-github-action
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-05 11:26:17 -05:00
dependabot[bot]
4b5a831979 build(deps): bump actions/upload-artifact from 4.3.6 to 4.4.0 (#43528)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.3.6 to 4.4.0.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](834a144ee9...50769540e7)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-05 12:04:52 +02:00
David Sanders
2c3840af76 ci: remove blocked/need-info label on user comment (#43562) 2024-09-05 10:12:02 +02:00
John Kleinschmidt
73d480d401 build: fix telemetry error when using autoninja (#43563) 2024-09-05 10:08:27 +02:00
Charles Kerr
2d868ecb8d perf: use v8::Local<v8::Object> as the key in ObjectCache (#43519)
* perf: use v8::Object* as direct keys instead of using hash + a linked list

* refactor: use v8::Local<v8::Object> as the key
2024-09-04 22:53:06 -05:00
Charles Kerr
0467790aee chore: migrate to v8::Object::SetPrototypeV2() (#43535)
chore: migrate to v8::Object::SetPrototypeV2().

Xref: https://chromium-review.googlesource.com/c/v8/v8/+/5600627

[api] Mark v8::Object::GetPrototype() for deprecation

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-09-04 20:30:54 -05:00
Charles Kerr
8ae5aacc8c refactor: declare gin::Wrapper subclasses as final (#43527)
As per the gin docs: "Wrappable<T> explicitly does not support further
subclassing of T. Subclasses of Wrappable<T> should be declared final."
2024-09-04 18:40:02 -05:00
Keeley Hammond
94f2722fa3 build: don't run symbol generation on PS (#43554)
fix: don't run symbol generation on PS
2024-09-04 17:18:57 +01:00
Charles Kerr
054cbcd6eb fix: don't use deprecate-soon class v8::String::Value (#43518)
* fix: remove use of deprecated v8::String::Value

Upstream marked v8::String::Value as `V8_DEPRECATE_SOON` last month,
so let's stop using it.

The replacement code mostly does the same as v8::String::Value();
but since our test only cares about the length and not the contents,
we get a small perf win of not needing to allocate a char array and
not needing to call Local::String::Write().

Upstream V8_DEPRECATE_SOON:
Xref: https://chromium-review.googlesource.com/c/v8/v8/+/5667299kkk

v8::String::Value() implementation:
20226b740b/src/api/api.cc (10883)

History on why we used it:
80c1a9739d
f49ed30f72

* Update shell/common/gin_converters/file_path_converter.h

Co-authored-by: Robo <hop2deep@gmail.com>

* fixup! Update shell/common/gin_converters/file_path_converter.h

do not return success for all non-Null non-Strings

---------

Co-authored-by: Robo <hop2deep@gmail.com>
2024-09-04 08:56:14 -05:00
dependabot[bot]
4c83016cf3 build(deps): bump github/codeql-action from 3.26.3 to 3.26.6 (#43529)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.3 to 3.26.6.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](883d8588e5...4dd16135b6)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-09-04 09:35:09 -04:00
Orko Garai
53dcda1fe9 fix: Use XDG_ACTIVATION_TOKEN in wayland when launched by other app (#43481)
When an electron app is launched by another app ensure that the
XDG_ACTIVATION_TOKEN env var is read and used for activation using
xdg_activation_v1 protocol.
2024-09-04 12:54:00 +02:00
George Xu
635d421123 fix: systemMediaPermissionDenied should not check camera perms when the request is asking for screen share (#43517)
* fix: systemMediaPermissionDenied: should check for screen capture perms instead of camera

* Revert "fix: systemMediaPermissionDenied: should check for screen capture perms instead of camera"

This reverts commit e9cc672165.

* should only do these checks for audio or video, but not screenshare

* no service

* oops

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-09-04 09:56:26 +01:00
Charles Kerr
b42c0ae00d fix: -Wunsafe-buffer-usage warnings in IsUrlArg() (#43477)
* fix: -Wunsafe-buffer-usage warnings in IsUrlArg()

* chore: improve code comments for CheckCommandLineArguments()

* chore: reduce diffs from main

* refactor: CheckCommandLineArguments takes a StringVector arg

Fixes another buffer warning!
2024-09-03 21:51:39 -04:00
John Kleinschmidt
90ba2df4fa build: free up macos disk space as soon as possible (#43533)
* chore: free up macos disk space as soon as possible

* build: free up disk space on gn check too
2024-09-03 21:32:05 -04:00
John Kleinschmidt
c41a28d7c8 chore: speed up cache only reclient for fork PRs (#43497) 2024-08-29 13:51:06 -04:00
Robo
41b8fdca5c fix: devtools dock state with WCO on linux (#43490) 2024-08-29 09:17:00 +09:00
electron-roller[bot]
38512efd25 chore: bump node to v20.17.0 (main) (#43428)
* chore: bump node in DEPS to v20.17.0

* module: disallow CJS <-> ESM edges in a cycle from require(esm)

https://github.com/nodejs/node/pull/52264

* src: expose LookupAndCompile with parameters

https://github.com/nodejs/node/pull/53886

* src: fix -Wshadow warning

https://github.com/nodejs/node/pull/53885

* lib: convert WeakMaps in cjs loader with symbol properties

https://github.com/nodejs/node/pull/52095

* src: reduce unnecessary serialization of CLI options in C++

https://github.com/nodejs/node/pull/52451

* build: ensure v8_pointer_compression_sandbox is enabled on 64bit

https://github.com/nodejs/node/pull/53884

* lib: improve error message when index not found on cjs

https://github.com/nodejs/node/pull/53859

* src,lib: expose getCategoryEnabledBuffer to use on node.http

https://github.com/nodejs/node/pull/53602

* deps: update c-ares to v1.32.2

https://github.com/nodejs/node/pull/53865

* chore: fixup patch indices

* deps: update V8 to 12.2

https://github.com/nodejs/node/pull/51362

* stream: Expose DuplexPair API

https://github.com/nodejs/node/pull/34111

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-08-26 15:09:33 -04:00
Charles Kerr
7cea992926 refactor: simplify KeyWeakMap impl (#43461) 2024-08-26 13:19:05 -05:00
Charles Kerr
2390706030 refactor: prefer std::ranges over begin() and end() (#43464) 2024-08-26 10:58:32 -04:00
David Sanders
56829f75c1 chore: cleanup include groupings (#43478) 2024-08-26 10:44:20 -04:00
Charles Kerr
5994b34a5d chore: remove unused WinFrameView::kInactiveTitlebarFeatureAlpha (#43448)
added in Aug 2021 (41646d11, #29600) but never used
2024-08-23 20:59:41 -05:00
electron-appveyor-updater[bot]
e6555ac5e1 build: update appveyor image to latest version (#43451)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-23 18:36:32 -04:00
Charles Kerr
5a1eeea102 perf: prefer GURL string_view getters (#43443)
* chore: avoid double-call to url.scheme() in WebContentsZoomController::SetZoomMode()

* perf: use gurl.scheme_piece() in GetAppInfoHelperForProtocol()

* perf: use gurl.scheme_piece() in Browser::GetApplicationNameForProtocol()

* refactor: add std::less<> to HandlersMap

This lets us search it using string_view keys

* refactor: ProtocolRegistry::FindRegistered() now takes a std::string_view

* perf: use gurl.scheme_piece() in InspectableWebContents::LoadNetworkResource()

* refactor: ProtocolRegistry::FindIntercepted() now takes a std::string_view

* perf: use gurl.scheme_piece() in SimpleURLLoaderWrapper::GetURLLoaderFactoryForURL()

* perf: use gurl.scheme_piece() in ProxyingURLLoaderFactory::CreateLoaderAndStart()

* perf: use gurl.host_piece() in ElectronWebUIControllerFactory::GetWebUIType()

* perf: use gurl.host_piece() in ElectronWebUIControllerFactory::CreateWebUIControllerForURL()
2024-08-23 17:15:45 -05:00
Charles Kerr
7f34b0e6f5 chore: remove unused method asar::ClearArchives() (#43442)
chore: remove unused asar::ClearArchives()

last use removed in Jun 2021 (b1d1ac65, #29293)
2024-08-23 14:53:01 -05:00
John Kleinschmidt
c1eee18e41 test: add -pdf-ready-to-print event to WebContents for testing (#43436) 2024-08-23 12:34:26 -05:00
Charles Kerr
9ce0ca74c3 build: remove fix_disable_scope_reuse_associated_dchecks.patch (#43441)
chore: remove fix_disable_scope_reuse_associated_dchecks.patch
2024-08-23 11:04:20 -04:00
Shelley Vohr
3a5a1ea7bd docs: titleBarOverlay is defined as a BaseWindow ctor option (#43430)
docs: titleBarOverlay is defined as a BaseWindow ctor option
2024-08-23 11:02:43 -04:00
Shelley Vohr
6e4d90fcdb fix: ensure bounds stability in OnWidgetBoundsChanged (#43431)
* fix: ensure bounds stability in OnWidgetBoundsChanged

* Update shell/browser/native_window_views.cc

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-08-23 11:02:05 -04:00
Erick Zhao
fd8d9f06fd chore: mention signed commit requirement (#43406)
chore: mentioned signed commit requirement
2024-08-23 15:52:33 +02:00
Alexander Cyon
ca0837c852 chore: fix typos in 'shell/' folder. (#43373) 2024-08-22 19:48:32 -05:00
reito
1aeca6fd0e feat: GPU shared texture offscreen rendering (#42953)
* feat: GPU shared texture offscreen rendering

* docs: clarify texture infos that passed by the paint event.

* feat: make gpu osr spec test optional

* fix: osr image compare

* fix: remove duplicate test

* fix: update patch file

* fix: code review

* feat: expose more metadata

* feat: use better switch design

* feat: add warning when user forget to release the texture.

* fix: typo

* chore: update patch

* fix: update patch

* fix: update patch description

* fix: update docs

* fix: apply suggestions from code review

Co-authored-by: Charles Kerr <charles@charleskerr.com>

* fix: apply suggested fixes

---------

Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-08-22 19:23:13 -05:00
electron-roller[bot]
b481966f02 chore: bump chromium to 130.0.6672.0 (main) (#43445)
chore: bump chromium in DEPS to 130.0.6672.0

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2024-08-22 18:27:25 -05:00
electron-roller[bot]
baf0182a42 chore: bump chromium to 130.0.6671.0 (main) (#43429)
* chore: bump chromium in DEPS to 130.0.6671.0

* 5802591: [Partitioned Popins] (6) Add permissions policy for popin

https://chromium-review.googlesource.com/c/chromium/src/+/5802591

* 5794132: [video pip] Move back to tab button to the header

https://chromium-review.googlesource.com/c/chromium/src/+/5794132

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-08-22 13:16:40 -05:00
Shelley Vohr
50ce448556 fix: menu should allow focused BaseWindow where possible (#43404)
fix: menu should allow focused BaseWindow
2024-08-22 14:13:30 -04:00
Shelley Vohr
7391db93e2 build: roll sysroots (#43261) 2024-08-22 16:22:12 +02:00
Alexander Cyon
b27dc7514e fix: documentation spelling errors (#43366)
chore: fix typos in 'docs/' folder.
2024-08-22 15:44:55 +02:00
Alexander Cyon
ae0c8881c3 chore: fix typos in 'spec/' folder (and one in 'lib/' folder) (#43374) 2024-08-22 15:44:15 +02:00
Shelley Vohr
4ae43dcb3b fix: touch bar functionality on BaseWindow (#43353)
* fix: touch bar functionality on BaseWindow

* test: add test for BaseWindow.setTouchBar
2024-08-22 12:48:25 +02:00
electron-appveyor-updater[bot]
46bed807ca build: update appveyor image to latest version (#43369)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-22 10:12:57 +02:00
Shelley Vohr
755c6640fd docs: clarify icon value in Notification (#43377)
* docs: clarify icon value in Notification

* Update docs/api/notification.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2024-08-21 19:38:06 -05:00
Charles Kerr
4fbf18a021 refactor: move impl functions into private namespace (#43372) 2024-08-21 15:26:06 -05:00
electron-roller[bot]
f366caac84 chore: bump chromium to 130.0.6669.0 (main) (#43397)
* chore: bump chromium in DEPS to 130.0.6669.0

* 5789734: Consolidate all the accessibility scale factor utility code into one file

https://chromium-review.googlesource.com/c/chromium/src/+/5789734

* 5798543: [autofill] Don't emit autofill audit reports if inspector not connected

https://chromium-review.googlesource.com/c/chromium/src/+/5798543

* 5797073: [wasm] Spill all loop inputs before entering loop

https://chromium-review.googlesource.com/c/v8/v8/+/5797073

* chore: fixup patch indices

* 5795224: Version 13.0.0

https://chromium-review.googlesource.com/c/v8/v8/+/5795224

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-08-21 12:34:18 -04:00
David Sanders
4874233aae chore: set wg-infra as CODEOWNER for GHA build configs (#43223)
* chore: set wg-releases as CODEOWNER for GHA build configs

* chore: change to wg-infra
2024-08-21 10:49:22 +02:00
David Sanders
b7af0537c8 docs: update timelines for E33 (#43389) 2024-08-20 15:47:32 -07:00
Keeley Hammond
7da9c0b2f7 docs: update window customization tutorial (#43388) 2024-08-20 15:29:01 -07:00
Shelley Vohr
46af43db49 chore: cherry-pick 9797576 from v8 (#43376) 2024-08-20 16:49:02 -04:00
Charles Kerr
93a6f3e607 refactor: NodeBindings::Create() returns a unique_ptr (#43361)
* refactor: NodeBindings::Create() returns a unique_ptr

* empty commit
2024-08-20 15:34:59 -04:00
Charles Kerr
a2de94dda1 chore: remove unused ConvertableToTraceFormatWrapper (#43356)
* chore: remove unused ConvertableToTraceFormatWrapper

Last use removed in Apr 2024 (39bf441b, #41880)

* fixup! chore: remove unused ConvertableToTraceFormatWrapper

remove now-unused trace_event.h header, too
2024-08-20 15:21:43 -04:00
electron-roller[bot]
2cc14c6e8f chore: bump chromium to 129.0.6668.0 (main) (#43368)
* chore: bump chromium in DEPS to 129.0.6668.0

* 5787687: [Extensions] Remove EventRouterForwarder from BrowserProcess

https://chromium-review.googlesource.com/c/chromium/src/+/5787687

* 5788808: Resolve Blob URL's origin using info from browser process

https://chromium-review.googlesource.com/c/chromium/src/+/5788808

* chore: fixup patch indices

* 5786747: Remove "int WriteFile"

https://chromium-review.googlesource.com/c/chromium/src/+/5786747

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-08-20 16:54:27 +02:00
dependabot[bot]
945aabfaee build(deps): bump github/codeql-action from 3.26.0 to 3.26.3 (#43365)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.26.0 to 3.26.3.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](eb055d739a...883d8588e5)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-08-20 13:11:50 +02:00
Charles Kerr
3186c2f0ef refactor: remove unused SetWMSpecState (#43347)
last use removed in Aug 2022 by 53cd2315 #35179
2024-08-19 17:15:19 -04:00
Charles Kerr
44e4e4521c chore: remove unused method Erase() (#43348)
Last use removed in Mar 2018 by 4b39d17e
2024-08-19 17:14:57 -04:00
Vít Černý
189675575c feat: extend navigationHistory API (#42014)
* feat: extend navigationHistory API

* refactor: simplify index checking

* refactor: rename 'getHistory' and 'replaceHistory' methods of navigationHistory

* refactor: rename delete*() methods to remove*()

* feat: remove navigationHistory.replaceHistory()

* tests: add tests for removeEntryAtIndex and getAllEntries
2024-08-19 15:46:04 -04:00
electron-roller[bot]
4c3014944c chore: bump chromium to 129.0.6664.0 (main) (#43329)
* chore: bump chromium in DEPS to 129.0.6657.0

* chore: update patches

* chore: bump chromium in DEPS to 129.0.6658.0

* chore: update patches

* 5743786: [ServiceWorker] Populate service worker start token to WorkerId.

https://chromium-review.googlesource.com/c/chromium/src/+/5743786

* 5784424: [Extensions] Move ownership of Dispatcher to ExtensionsRendererClient

https://chromium-review.googlesource.com/c/chromium/src/+/5784424

* chore: bump chromium in DEPS to 129.0.6659.0

* chore: bump chromium in DEPS to 129.0.6660.0

* chore: update patches

* chore: bump chromium in DEPS to 129.0.6662.0

* chore: bump chromium in DEPS to 129.0.6664.0

* 5789627: [Partitioned Popins] (3) `popin` feature triggers third-party storage partitioning

https://chromium-review.googlesource.com/c/chromium/src/+/5789627

* 5791367: Remove some chrome:: namespace from chrome/browser/app_mode/*

https://chromium-review.googlesource.com/c/chromium/src/+/5791367

* 5791522: [SCK] Skip redundant getShareableContentWithCompletionHandler

https://chromium-review.googlesource.com/c/chromium/src/+/5791522

* 5761330: Send refresh rate prefs b/w RefreshRateController and DisplayPrivate

https://chromium-review.googlesource.com/c/chromium/src/+/5761330

* chore: fixup patch indices

* 5793591: Remove unused GetHeader overload

https://chromium-review.googlesource.com/c/chromium/src/+/5793591

* 5787624: [Extensions] Simplify ExtensionsRendererClient::RenderThreadStarted()

https://chromium-review.googlesource.com/c/chromium/src/+/5787624

* 5721709: Fix Incorrect last_accessed_time Tracking for Tabs

https://chromium-review.googlesource.com/c/chromium/src/+/5721709

* 5789215: [Extensions] Add a //chrome/common/extensions build target

https://chromium-review.googlesource.com/c/chromium/src/+/5789215

* Roll V8 from 48f669a0758c to eee3eb91d01c

48f669a075..eee3eb91d0

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-08-19 14:52:53 -04:00
Shelley Vohr
cc16de7032 fix: printing occasionally showing failed when cancelled (#43337)
Closes https://github.com/electron/electron/issues/36084
2024-08-19 14:25:14 -04:00
Piotr Płaczek
4d51edc504 docs: api history (#42982)
* feat(api-history): api history schema

Reference: f36e0a8483/text/0004-api-history-schema.md

* feat(api-history): add `lint:api-history` to `package.json`

* docs(api-history): add api history to `styleguide.md`

* docs(api-history): `win.flashFrame(flag)`

* docs(api-history): `new WebContentsView([options])`

* docs(api-history): non-navigation APIs on `WebContents`

* docs(api-history): `nativeImage.toDataURL`

* docs(api-history): `window.flashFrame(bool)`

* docs(api-history): `browser-view.md`

* docs(api-history): `ipcRenderer`

* docs(api-history): `protocol.*Protocol`

* revert: `new WebContentsView([options])`

This reverts commit 0a11efcf57.

* Apply suggestions from code review

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>

* fix(api-history): remove incorrect `pr-url`

Reference: https://github.com/electron/electron/pull/42982/files#r1692532877

* docs(api-history): schema word choice

Co-authored-by: Erick Zhao <erick@hotmail.ca>

Reference: 0b1b6a7cc0

* docs(api-history): nicer format example in `styleguide.md`

Reference: https://github.com/electron/electron/pull/42982#discussion_r1692539906

* docs(api-history): Always use double quotes for descriptions

* docs(api-history): `styleguide.md` improvements

* docs(api-history): copy `ipc-renderer.md` change to `context-bridge.md`

* docs(api-history): `styleguide.md` placement

* docs(api-history): add migration guide

* docs(api-history): remove confusing `breaking-changes-header` in `browser-view.md`

Reference: 7b03c0703d (r1703444772)

* docs(api-history): move migration guide

Reference: https://github.com/electron/electron/pull/42982#discussion_r1703441001

* docs(api-history): update `breaking-changer-header`

Reference: https://github.com/electron/electron/pull/43217

* docs(api-history): deprecate `browser-view.md`

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2024-08-19 11:17:10 -07:00
Calvin
8474bbe689 build: update NMV to 130 for Electron 33 (#43325) 2024-08-19 12:47:40 -04:00
Shelley Vohr
3f71ed7355 build: fix valid versions in issue version parsing (#43346) 2024-08-19 11:04:30 +02:00
Shelley Vohr
d7689bb9b5 docs: expand dialog window to BaseWindow (#43334)
docs: expand dialog window to BaseWindow
2024-08-16 10:49:10 -04:00
Shelley Vohr
b497700e36 test: fixup Node.js snapshot tests to run correctly (#43332) 2024-08-16 11:17:42 +02:00
electron-appveyor-updater[bot]
1c991ff765 build: update appveyor image to latest version (#43331)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-15 16:09:47 -04:00
Shelley Vohr
4801a54d08 refactor: migrate deprecated platform_util_mac calls (#43161)
refactor: migrate deprecated platform_util_mac calls
2024-08-15 10:53:38 -04:00
electron-roller[bot]
a7c52f1fb2 chore: bump chromium to 129.0.6656.0 (main) (#43323)
* chore: bump chromium in DEPS to 129.0.6656.0

* chore: update patches

* 5750664: Introduce Signin.NumberOfActiveAccounts.* metrics

https://chromium-review.googlesource.com/c/chromium/src/+/5750664

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-08-14 16:47:37 -04:00
Shelley Vohr
286384258b fix: blank page when printing pdf (#43309) 2024-08-14 15:47:47 -04:00
Shelley Vohr
f6bae51025 build: remove upstreamed DraggableRegions patch (#43311)
build: remove upstreamed patch
2024-08-14 10:11:02 -04:00
electron-appveyor-updater[bot]
ffcbc32031 build: update appveyor image to latest version (#43318)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-14 10:10:33 -04:00
Robo
9b166b3ed4 feat: support app#login event for utility process net requests (#42631)
* feat: support app#login event for utility process net requests

* chore: address review feedback

* GlobalRequestID: Avoid unwanted inlining and narrowing int conversions

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5702737
2024-08-14 11:36:47 +09:00
David Sanders
62406708cd docs: fix formatting in fuses tutorial (#43303) 2024-08-13 15:27:44 -04:00
electron-roller[bot]
d004329f6f chore: bump chromium to 129.0.6654.0 (main) (#43312)
* chore: bump chromium in DEPS to 129.0.6654.0

* chore: update patches

* 5766075: Chromium UI for integration with the MacOS SCContentSharingPicker

https://chromium-review.googlesource.com/c/chromium/src/+/5766075

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-08-13 15:04:43 -04:00
electron-appveyor-updater[bot]
275b6a13b7 build: update appveyor image to latest version (#43308)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-13 11:25:05 -04:00
dependabot[bot]
a9e56f2c36 build(deps): bump dsanders11/github-app-commit-action from 1.4.0 to 1.5.0 (#43305)
build(deps): bump dsanders11/github-app-commit-action

Bumps [dsanders11/github-app-commit-action](https://github.com/dsanders11/github-app-commit-action) from 1.4.0 to 1.5.0.
- [Release notes](https://github.com/dsanders11/github-app-commit-action/releases)
- [Changelog](https://github.com/dsanders11/github-app-commit-action/blob/main/.releaserc.json)
- [Commits](48d2ff8c1a...43de6da2f4)

---
updated-dependencies:
- dependency-name: dsanders11/github-app-commit-action
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-08-13 15:13:55 +02:00
electron-roller[bot]
bc2628ad7e chore: bump chromium to 129.0.6652.0 (main) (#43298)
* chore: bump chromium in DEPS to 129.0.6652.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-08-12 13:47:27 -04:00
Charles Kerr
bba31189a0 feat: accept-encoding zstd (#43150)
* fix: accept-encoding zstd

* Update shell/browser/net/system_network_context_manager.cc

Co-authored-by: Sam Maddock <smaddock@slack-corp.com>

* chore: make lint happy

---------

Co-authored-by: Sam Maddock <smaddock@slack-corp.com>
2024-08-12 10:00:04 -04:00
electron-appveyor-updater[bot]
0f55b45282 build: update appveyor image to latest version (#43268)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-12 09:32:52 -04:00
Shelley Vohr
d294871980 chore: deprecate textured BrowserWindow type option on macOS (#43133) 2024-08-12 10:32:35 +02:00
electron-roller[bot]
c9b7806418 chore: bump chromium to 129.0.6650.0 (main) (#43266)
* chore: bump chromium in DEPS to 129.0.6645.0

* chore: update patches

* chore: bump chromium in DEPS to 129.0.6646.0

* refactor: remove ppapi dependency

PPAPI removal - https://issues.chromium.org/issues/40511450
PDF viewer migration - https://issues.chromium.org/issues/40511452

* chore: update patches

* chore: enable `content_enable_legacy_ipc`

We were indirectly relying on this via `enable_ppapi=true`, with
633a57d9b6 ppapi is now disabled and
this commit makes the dependency explicit.

* fix: gn check

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2024-08-12 10:28:33 +02:00
Charles Kerr
23bcca3ffc refactor: put empty virtual function definitions in header (#43285)
* refactor: in FramelessView, move empty function decls to header

* refactor: in electron::api::WebContents, move empty function decls to header

* refactor: in electron::api::NativeWindow, move empty function decls to header

* refactor: in electron::OffScreenWebContentsView, move empty function decls to header

* refactor: in electron::OffScreenRenderWidgetHostView, move empty function decls to header

* refactor: in auto_updater::AutoUpdater, move empty function decls to header

* refactor: in electorn::api::FrameSubscriber, move empty function decls to header

* refactor: in electorn::api::SimpleURLLoaderWrapper, move empty function decls to header

* refactor: in electorn::InspectableWebContents, move empty function decls to header

* refactor: in electorn::OffScreenVideoConsumer, move empty function decls to header

* refactor: in electron::OffScreenWebContentsView, move empty function decls to header

* refactor: in electron::TrayIcon, move empty function decls to header

* refactor: in electron::ViewsDelegate, move empty function decls to header

* refactor: in electron::MediaCaptureDevicesDispatcher, move empty function decls to header

* refactor: in electron::UsbChooserContext::DeviceObserver, move empty function decls to header

* refactor: in electron::ProxyingWebSocket, move empty function decls to header

* refactor: in electron::Notification, move empty function decls to header

* refactor: in electron::PlatformNotificationService, move empty function decls to header

* Revert "refactor: in electron::PlatformNotificationService, move empty function decls to header"

This reverts commit 9103750d03b9ba1ceccba43d11dfdc2404ff6191.

* refactor: in electron::ElectronPDFDocumentHelperClient, move empty function decls to header

* refactor: in electron::api::SpellCheckClient, move empty function decls to header

* refactor: in electron::ElectronExtensionHostDelegate, move empty function decls to header

* refactor: in electron::PlatformNotificationService, move empty function decls to header

* refactor: in electron::NativeWindowViews, move empty function decls to header

* chore: move SetTouchBar() back to cc

* Revert "refactor: in auto_updater::AutoUpdater, move empty function decls to header"

This reverts commit c43d6862d3.
2024-08-12 09:56:51 +02:00
Charles Kerr
bff298987f chore: remove unused Notification fields icon_path_, has_icon_ (#43286)
Last use of `icon_path_` was removed on May 29, 2017 (c741b584)
Last use of `has_icon_` was removed on May 30, 2017 (5048425e)
2024-08-12 09:55:54 +02:00
Shelley Vohr
6d13c503c5 refactor: update chrome.scripting extensions api impls (#43205) 2024-08-11 21:31:37 +02:00
Charles Kerr
7721fdf886 chore: remove unused method ElectronDesktopWindowTreeHostLinux::UpdateClientDecorationHints() (#43283)
Xref: dff980c9c2

Removed in #41868
2024-08-10 18:55:10 -05:00
Charles Kerr
c35739d60d refactor: use url::DomainIs() to check cookie domains (#43262)
* test: add tests to exercise pre-exsiting cookie domain matching behavior

* refactor: use url::DomainIs() to match cookie domains

* docs: fix typo
2024-08-09 18:35:18 -05:00
Charles Kerr
c4dfff9844 fix: accidental handle copying in a range loop (#43260)
fix: accidental handle copying

Xref: https://github.com/electron/electron/pull/37857
2024-08-09 13:38:03 -05:00
Shelley Vohr
346244ef9e build: add nacl back to buildtools gitignore (#43238) 2024-08-09 19:09:01 +02:00
dependabot[bot]
4edc7a4372 build(deps): bump actions/upload-artifact from 4.3.4 to 4.3.6 (#43245)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.3.4 to 4.3.6.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](0b2256b8c0...834a144ee9)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-08-09 10:43:51 +02:00
Shelley Vohr
f49f6ff68b fix: check screen capture permissions in desktopCapturer (#43080)
fix: check screen capture permissions in desktopCapturer
2024-08-09 10:08:49 +02:00
Shelley Vohr
0718c2b9ee fix: system-context-menu with frameless BrowserWindows (#43243) 2024-08-09 10:08:01 +02:00
electron-roller[bot]
1a6563fb66 chore: bump chromium to 129.0.6644.0 (main) (#43224)
* chore: bump chromium in DEPS to 129.0.6640.0

* chore: update patches

* Reland "DEPS: update ninja to 1.12.1"

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5645474

* chore: bump chromium in DEPS to 129.0.6642.0

* chore: update patches

* chore: bump chromium in DEPS to 129.0.6644.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2024-08-08 17:16:59 -05:00
electron-appveyor-updater[bot]
11fdc6f78e build: update appveyor image to latest version (#43237)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-08 16:10:16 +02:00
dependabot[bot]
0fcc18359f build(deps): bump github/codeql-action from 3.25.15 to 3.26.0 (#43246)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.25.15 to 3.26.0.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](afb54ba388...eb055d739a)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-08-08 16:09:14 +02:00
Shelley Vohr
70dda694e2 build: fix build when enable_pdf_viewer and enable_electron_extensions disabled (#43206)
build: fix build when enable_pdf_viewer and enable_electron_extensions disabled
2024-08-07 14:51:38 +02:00
David Sanders
aa19087bed ci: set labels on Dependabot PRs for GitHub Actions deps (#43222) 2024-08-07 11:57:40 +02:00
Felix Rieseberg
3fabf7837e docs: Document ideal iconPath size (#43149) 2024-08-07 11:43:05 +02:00
dependabot[bot]
8d5ad8afe1 build(deps): bump mikefarah/yq from 4.44.2 to 4.44.3 (#43220)
Bumps [mikefarah/yq](https://github.com/mikefarah/yq) from 4.44.2 to 4.44.3.
- [Release notes](https://github.com/mikefarah/yq/releases)
- [Changelog](https://github.com/mikefarah/yq/blob/master/release_notes.txt)
- [Commits](f15500b20a...bbdd97482f)

---
updated-dependencies:
- dependency-name: mikefarah/yq
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-08-07 10:02:31 +02:00
Shelley Vohr
45891aa75b build: fix patchup logic only running on one platform (#43139) 2024-08-07 10:01:59 +02:00
Charles Kerr
6293bbced0 perf: avoid redundant calls to GetView() (#43216)
* perf: avoid double-calls to GetView()

There are a lot of places where we call the virtual method GetView()
twice in succession: the first to check if the view exists, and the
second to use. This PR holds the view in a temp variable instead, e.g.:

if (auto* view = foo->GetView())
  view->DoSomething();

* perf: avoid discarded GetView() call
2024-08-06 11:25:59 -05:00
Piotr Płaczek
f42331f277 docs: add missing deprecations to breaking-changes.md (#43217)
* docs: deprecate `BrowserView`

Reference: https://github.com/electron/electron/pull/35658

* docs: deprecate `webContents.goToIndex(index)`

Reference: https://github.com/electron/electron/pull/41752/files#diff-18ed6a5b5a9084c976509502962b7f05989a8bd13a2ba3dc02868056938c03b6R1165-R1167

* docs: deprecate some protocol methods

Reference: https://github.com/electron/electron/pull/36674/files#diff-74861ecada868821b139e79f244ea32b840a93f60de572d585117a0ff8d165c8R380
2024-08-06 09:07:36 -07:00
electron-roller[bot]
29fd2d343b chore: bump chromium to 129.0.6638.0 (main) (#43207)
* chore: bump chromium in DEPS to 129.0.6638.0

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
2024-08-06 17:43:48 +09:00
electron-appveyor-updater[bot]
c70f86fe03 build: update appveyor image to latest version (#43204)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-08-05 16:41:40 -04:00
Samuel Attard
701a09d44f build: use smaller instances for gn-check (#43187) 2024-08-05 15:42:41 -04:00
John Kleinschmidt
a4dcb0fb32 build: fixup patches in main (#43218)
chore: fixup patches in main
2024-08-05 13:51:17 -04:00
David Sanders
acd39bd077 ci: auto label bug issues with platform (#43198) 2024-08-05 09:52:49 -04:00
Charles Kerr
3d766e9ccb perf: don't build unused vectors in HidChooserContext (#43192)
* refactor: remove unused code in HidChooserContext::DeviceRemoved()

* refactor: remove unused code in HidChooserContext::OnHidManagerConnectionError()

* refactor: use structured bindings for readability
2024-08-05 15:31:58 +02:00
Charles Kerr
6877671390 fix: gin_helper::MicrotasksScope instantiation (#43185) 2024-08-05 08:24:27 -05:00
Shelley Vohr
e64302cc91 refactor: simplify window moveAbove/moveTop impl on macOS (#43157)
refactor: simplify window moveAbove/moveTop impl on macOS
2024-08-05 09:57:16 +02:00
Shelley Vohr
2a613cabaa refactor: migrate electron_login_helper to non-deprecated API (#43182)
refactor: migrate electron_login_helper to non-deprecated API
2024-08-05 09:56:18 +02:00
Shelley Vohr
78995b956e fix: potential draggable regions crash in DevTools (#43179) 2024-08-05 09:56:08 +02:00
electron-roller[bot]
f508f6b6b5 chore: bump chromium to 129.0.6636.0 (main) (#43194)
* chore: bump chromium in DEPS to 129.0.6636.0

* chore: e patches all

to make GH actions happy

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-08-04 11:36:40 -05:00
electron-roller[bot]
20e77afe0f chore: bump chromium to 129.0.6634.0 (main) (#43189)
* chore: bump chromium in DEPS to 129.0.6634.0

* chore: update chore_add_electron_deps_to_gitignores.patch

no manual changes. patch applied with fuzz 1.

* chore: e patches all

* chore: update call to gfx::Image::CreateFrom1xPNGBytes()

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5743597

The call now takes a base::span

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-08-04 07:31:31 -05:00
Charles Kerr
5a809a6694 refactor: prefer std::ranges over base::ranges (#43172)
Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5668999

Xref: https://groups.google.com/a/chromium.org/g/cxx/c/ZnIbkfJ0Glw
2024-08-02 21:21:59 -05:00
Charles Kerr
305b28e9c7 chore: bump chromium to 129.0.6632.0 (#43184)
* chore: bump chromium in DEPS to 129.0.6632.0

* chore: update build_do_not_depend_on_packed_resource_integrity.patch

apply patch manually due to context shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5755242

* chore: e patches all
2024-08-02 13:58:13 -05:00
Charles Kerr
5b18cc46bc chore: bump chromium to 129.0.6630.0 (main) (#43087)
* chore: bump chromium in DEPS to 129.0.6623.0

* chore: update mas_avoid_private_macos_api_usage.patch.patch

remove the changes to media/audio/mac/audio_manager_mac.cc,
since upstream has also made this change now.

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5738654

* chore: update fix_disable_scope_reuse_associated_dchecks.patch

We had been removing a couple of `DCHECK`. Upstream changed their
code to limit when these `DCHECK`s get called, so let's see if our
change is still needed.

Xref: https://chromium-review.googlesource.com/c/v8/v8/+/5739076

* chore: e patches all

* Bump the Chrome macOS deployment target to 11.0

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5734361

BREAKING CHANGE: Bump the Chrome macOS deployment target to 11.0

* src: stop using deprecated fields of `v8::FastApiCallbackOptions`

Xref: d0000b118d
Xref: https://chromium-review.googlesource.com/c/v8/v8/+/5741336
Xref: https://chromium-review.googlesource.com/c/v8/v8/+/5741199

* fixup! chore: update fix_disable_scope_reuse_associated_dchecks.patch

chore: re-disable DCHECKs

yep, it is still needed

* refactor use non-deprecated variant of openApplicationAtURL

old version is deprecated now in macOS 11

Xref: https://developer.apple.com/documentation/appkit/nsworkspace/1534810-launchapplicationaturl

Xref: https://developer.apple.com/documentation/appkit/nsworkspace/3172700-openapplicationaturl

* chore: bump chromium in DEPS to 129.0.6626.0

* chore: e patches all

* chore: disable NSUserNotification deprecation errors

* chore: disable NSWindowStyleMaskTexturedBackground deprecation errors

Xref: https://github.com/electron/electron/issues/43125

* chore: disable deprecation errors in platform_util_mac.mm

* chore: disable launchApplication deprecation errors

* chore: bump chromium in DEPS to 129.0.6630.0

* chore: update refactor_expose_file_system_access_blocklist.patch

apply patch manually due to context shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5745444

* chore: update deps_add_v8_object_setinternalfieldfornodecore.patch

no manual changes. patch applied with fuzz 1 (offset -5 lines)

* chore: e patches all

* fix: add clang_x64_v8_arm64/snapshot_blob.bin to the zip manifest

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5746173

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
2024-08-02 09:02:11 -05:00
Tingsong (Terrence) Ou
7c79221a54 docs: fixed broken electron-fiddle links in the "Tutorial - Publishing and Updating" doc (#43129)
fixed electron-fiddle build and config links
2024-08-01 20:28:50 -05:00
Charles Kerr
e7ca92a574 chore: remove unused internal env.unSetVar() (#43148)
chore: remove unused unSetVar JS binding

Added in Oct 2020 (b33f2260, #25623) but never used
2024-08-01 18:41:41 -05:00
Shelley Vohr
3a07bd8821 fix: take bluetooth serial ports into account in serial.getPorts() (#43101)
* fix: take bluetooth serial ports into account in serial.getPorts()

* chore: remove port.path.LossyDisplayName()
2024-08-01 11:13:31 -05:00
dependabot[bot]
cc956420ef build(deps): bump ossf/scorecard-action from 2.3.3 to 2.4.0 (#43094)
Bumps [ossf/scorecard-action](https://github.com/ossf/scorecard-action) from 2.3.3 to 2.4.0.
- [Release notes](https://github.com/ossf/scorecard-action/releases)
- [Changelog](https://github.com/ossf/scorecard-action/blob/main/RELEASE.md)
- [Commits](dc50aa9510...62b2cac7ed)

---
updated-dependencies:
- dependency-name: ossf/scorecard-action
  dependency-type: direct:production
  update-type: version-update:semver-minor
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-08-01 12:47:56 +02:00
cptpcrd
2337d8676d fix: handle failing to enter fullscreen on macOS (#43112)
* fix: handle failing to enter/exit fullscreen on macOS

On macOS, failing to enter/exit fullscreen can fail. If this happens,
properly restore the original window state.

* refactor: remove fail to exit fullscreen handlers

Seem to be unnecessary since the window exits fullscreen anyway.
2024-08-01 12:13:13 +02:00
Charles Kerr
45e5ccc55e chore: remove unused KeyWeakMap JS bindings (#43111)
The last three pieces of code that used it were removed in:

- Oct 2020 (8df4faa8 #25711)
- Jun 2020 (e1e73fa5 #24115)
- Jun 2020 (c0182bca #24116).
2024-07-31 16:37:04 -05:00
Charles Kerr
a68a33f036 docs: fix broken link in bug report template (#43105)
chore: fix broken link in bug report template
2024-07-31 11:45:07 -04:00
Shelley Vohr
791e6df82a docs: update Node.js stable release policy (#43100)
* docs: update Node.js stable release policy

* Update docs/tutorial/electron-timelines.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2024-07-31 16:33:58 +02:00
dependabot[bot]
283810dbfc build(deps): bump github/codeql-action from 3.25.13 to 3.25.15 (#43095)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.25.13 to 3.25.15.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](2d790406f5...afb54ba388)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-31 10:00:39 +02:00
Shelley Vohr
ed3242adc1 fix: vibrant view is inserted into Views API hierarchy (#43078)
* fix: vibrant view is inserted into Views API hierarchy (#42263)

* Update shell/browser/native_window_mac.mm

Co-authored-by: Charles Kerr <charles@charleskerr.com>

---------

Co-authored-by: Hans Halverson <hans_halverson@alumni.brown.edu>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
2024-07-30 18:21:20 -05:00
John Kleinschmidt
87fb2ad70c build: fixup ffmpeg release on x64 macOS (#43093)
chore: fixup arch on x64 macOS ffmpeg
2024-07-30 16:35:11 -04:00
Charles Kerr
1bcc566ad8 chore: remove unused & undocumented function v8Util.deleteHiddenValue() (#43090)
chore: remove unused v8Util.deleteHiddenValue()

Its last use was removed in Nov 2020 by c8d77cae4a (#26659)
2024-07-30 15:25:37 -05:00
electron-appveyor-updater[bot]
60bb4a2617 build: update appveyor image to latest version (#43098)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-07-30 11:44:18 -04:00
Charles Kerr
47dde3b6e2 chore: remove unused class electron::ObjectLifeMonitor (#43089)
* chore: remove unused electron::ObjectLifeMonitor

The last users were removed in June 2020 e1e73fa5f (#24115)
and May 2020 9d7ba982 (#23592).

* fixup! chore: remove unused electron::ObjectLifeMonitor

fix: oops
2024-07-30 08:25:28 -05:00
John Kleinschmidt
1a6e651844 test: fixup flaky visibility test (#43064) 2024-07-30 09:14:45 -04:00
Shelley Vohr
d09a2e513c fix: showInactive window not showing (#43079)
fix: showInactive window not showing

Refs https://github.com/electron/electron/pull/42226 and https://github.com/electron/electron/pull/43033
2024-07-30 12:37:27 +02:00
Charles Kerr
7e9eb9e3f1 perf: avoid duplicate calculations in gin_helper::Dictionary getters (#43073)
* perf: cache the dictionary handle

* refactor: prefer result.IsJust() over !result.IsNothing()

for consistency

* refactor: prefer maybe.FromMaybe() over maybe.IsJust() && maybe.FromJust()

the inlined code is simpler

* refactor: simplify Get() impl

* refactor: add private helper Dictionary::MakeKey()

refactor: add private helper Dictionary::MakeHiddenKey()
2024-07-29 12:43:28 -05:00
Charles Kerr
e70ce89235 chore: more iwyu (#43063)
* chore: iwyu shell/browser/electron_pdf_document_helper_client.h

* chore: iwyu shell/browser/hid/electron_hid_delegate.h

* chore: iwyu content/public/browser/web_contents.h

* chore: iwyu shell/browser/usb/electron_usb_delegate.h

* chore: iwyu shell/browser/browser_observer.h

* chore: iwyu shell/browser/bluetooth/electron_bluetooth_delegate.h

* chore: iwyu shell/browser/serial/electron_serial_delegate.h

* chore: iwyu shell/browser/api/frame_subscriber.h

* chore: iwyu mojo/public/cpp/bindings/

* chore: iwyu components/

* chore: iwyu extensions/

* chore: iwyu shell/common/gin_helper/

* chore: iwyu v8/

* chore: iwyu base/containers/linked_list.h

* chore: iwyu shell/browser/native_window.h

* chore: iwyu shell/browser/api/electron_api_base_window.h

* chore: iwyu shell/common/node_includes.h

* chore: iwyu gin/handle.h

* chore: iwyu base/functional/callback.h

* chore: iwyu ui/gfx/

* chore: iwyu content/public/browser/render_frame_host.h

* fix: mac

* fix: mac

* fix: win

* chore: iwyu base/files/file_path.h

* chore: iwyu base/unguessable_token.h

* chore: iwyu ui/display/screen.h

* chore: iwyu chrome/browser/predictors/preconnect_manager.h

* chore: iwyu base/observer_list_types.h

* chore: iwyu content/public/browser/web_contents.h

* chore: iwyu chrome/browser/devtools/devtools_eye_dropper.h

* chore: iwyu shell/browser/ui/inspectable_web_contents.h

* chore: iwyu content/public/browser/keyboard_event_processing_result.h

* chore: iwyu net/cookies/canonical_cookie.h

* chore: iwyu net/base/address_list.h

* chore: iwyu net/cert/x509_certificate.h

* chore: iwyu net/cookies/cookie_change_dispatcher.h

* chore: iwyu net/dns/public/host_resolver_results.h

* fix: mac

* Revert "chore: iwyu net/cert/x509_certificate.h"

This reverts commit 002896f71146e90f1e29e090a1d6eede48cee11e.
2024-07-29 12:42:57 -05:00
electron-roller[bot]
92496c1930 chore: bump chromium to 129.0.6616.0 (main) (#43012)
* chore: bump chromium in DEPS to 128.0.6613.0

* chore: 5725076: Update EventType names | https://chromium-review.googlesource.com/c/chromium/src/+/5725076

* chore: export patches

* chore: 5725076: Update EventType names | https://chromium-review.googlesource.com/c/chromium/src/+/5725076 for windows

* chore: bump chromium in DEPS to 129.0.6614.0

* 5725672: Add a feature to limit the number of preconnect in LoadingPredictor | https://chromium-review.googlesource.com/c/chromium/src/+/5725672

* chore: bump chromium in DEPS to 129.0.6616.0

* chore: e patches all and resolve conflict in  patches/v8/fix_disable_scope_reuse_associated_dchecks.patch

* 5730656: Show an error dialog when UpdatePrintSettings() fails | https://chromium-review.googlesource.com/c/chromium/src/+/5730656

* chore: gen-libc++-filenames

* 5729956: Finally remove string_piece.h | https://chromium-review.googlesource.com/c/chromium/src/+/5729956

* chore: replace all references of base::StringPiece with std::string_view

* chore: remove more references of stringPiece in favor of string_view

* chore: rename string_piece variables to string_view

* 5508795: Remove the NotificationService | https://chromium-review.googlesource.com/c/chromium/src/+/5508795

* 5734053: Revert Rename GlobalFeatures to GlobalDesktopFeatures. | https://chromium-review.googlesource.com/c/chromium/src/+/5734053

* chore: resolve conflict with main without merge

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Alice Zhao <alice@makenotion.com>
2024-07-29 09:37:35 -04:00
Alice Zhao
4286234721 fix: redirect webview navigation methods (#42981) 2024-07-29 13:00:51 +02:00
Fedor Indutny
55e7a47d70 fix: always terminate active Node Streams (#43056)
`.destroy()` is an important method in the lifecycle of a Node.js
Readable stream. It is typically called to reclaim the resources
(e.g., close file descriptor). The only situations where calling
it manually isn't necessary are when the following events are
emitted first:

- `end`: natural end of a stream
- `error`: stream terminated due to a failure

Prior to this commit the ended state was incorrectly tracked together
with a pending internal error. It led to situations where the request
could get aborted during a read and then get marked as ended (having
pending error).

With this change we disentangle pending "error" and "destroyed" cases to
always properly terminate an active Node.js Readable stream.

Co-authored-by: Fedor Indutny <79877362+indutny-signal@users.noreply.github.com>
2024-07-27 12:25:43 -05:00
Keeley Hammond
8db1563d73 fix: remove InspectableWebContentsViewMac (#43033)
* Revert "refactor: remove InspectableWebContentsViewMac in favor of the Views version (#41326)"

This reverts commit e67ab9a93d.

* build: fix gn check

* chore: implement setCornerRadii in inspectable_web_contents_view_mac

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: pass in cornerRadii value in setCornerRadii

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>

* fix: forward declaration

* 5578714: Remove 0-arg (default) constructor for views::Widget::InitParams.

https://chromium-review.googlesource.com/c/chromium/src/+/5578714

* fix: contents_web_view_ -> contents_view_

* chore: remove extraneous includes

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-07-27 11:44:22 -05:00
electron-roller[bot]
b3d52c01e8 chore: bump node to v20.16.0 (main) (#43029)
* chore: bump node in DEPS to v20.16.0

* test: skip unstable shadow realm gc tests

https://github.com/nodejs/node/pull/52855

* test: extend env for `test-node-output-errors`

https://github.com/nodejs/node/pull/53535

* src: fix typo in env.cc

https://github.com/nodejs/node/pull/53418

* src: reset `process.versions` during pre-execution

https://github.com/nodejs/node/pull/53444

* chore: fixup patch indices

* src,permission: --allow-wasi & prevent WASI exec

https://github.com/nodejs/node/pull/53124

* tls: use SSL_get_peer_tmp_key

https://github.com/nodejs/node/pull/53366

* deps: update c-ares to 1.29.0

https://github.com/nodejs/node/pull/53155

* src: account for OpenSSL unexpected version

* crypto: fix propagation of "memory limit exceeded"

https://github.com/nodejs/node/pull/53300

* process: add process.getBuiltinModule(id)

https://github.com/nodejs/node/pull/52762

* windows 32bit: config change callback needs to be stdcall

8f265c9d51

* fix: building with UNICODE

https://github.com/c-ares/c-ares/pull/802

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2024-07-26 12:52:05 -04:00
BILL SHEN
77ba40bc01 chore: avoid crash while notification removal (#43040)
* avoid crash of operation on an invalid entry while erase set iterator.

* fix notification removal crash due to the nullptr presenter

---------

Co-authored-by: bill.shen <shenyb32768@gmail.com>
2024-07-26 15:34:40 +02:00
Keeley Hammond
2fd04a78a1 fix: revert BrowserWindow unresponsive handling refactor (#43034)
* Revert "refactor: JSify BrowserWindow unresponsive handling (#37902)"

This reverts commit 67ba30402b.

* chore: remove BrowserWindow::SetTitleBarOverlay

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-07-25 13:02:02 -07:00
electron-appveyor-updater[bot]
0886d2f50f build: update appveyor image to latest version (#43021)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-07-25 15:21:02 -04:00
Charles Kerr
660872c048 refactor: move safe_storage functions into anonymous namespace (#43032) 2024-07-25 13:18:13 -05:00
Shelley Vohr
976f5d1b75 fix: File System API permissions should reset on WebContents destruction (#43009)
fix: active File System API permissions should reset on WebContents destruction
2024-07-25 09:53:30 -04:00
Charles Kerr
aa23198ad8 chore: remove more unused #include calls (#43000)
* chore: in shell/renderer/renderer_client_base.h, remove include media/base/key_systems_support_registration.h

last use removed in c670e38b (##41610)

* chore: iwyu electron/fuses.h

* chore: iwyu media/base/video_frame.h

* chore: iwyu base/functional/callback.h

* chore: iwyu base/task/cancelable_task_tracker.h

* chore: iwyu shell/browser/draggable_region_provider.h

* chore: iwyu shell/browser/ui/inspectable_web_contents_view.h

* chore: iwyu ui/aura/window.h

* chore: iwyu ui/base/win/shell.h

* chore: iwyu ui/display/win/screen_win.h

* chore: iwyu ui/gfx/geometry/insets.h

* chore: iwyu ui/display/display.h

* chore: iwyu ui/gfx/geometry/skia_conversions.h

* chore: iwyu ui/gfx/geometry/rect_conversions.h

* chore: iwyu ui/gfx/geometry/point.h

* chore: iwyu ui/gfx/scoped_canvas.h

* chore: iwyu ui/gfx/image/image.h

* chore: iwyu ui/accessibility/ax_node_data.h

* chore: iwyu ui/views/animation/ink_drop_highlight.h

* chore: iwyu ui/gfx/font_list.h

* chore: iwyu ui/linux/nav_button_provider.h

* chore: iwyu shell/browser/ui/views/frameless_view.h

* chore: iwyu services/metrics/public/cpp/ukm_source_id.h

* chore: iwyu net/http/http_util.h

* chore: iwyu net/base/mime_util.h

* chore: iwyu content/public/common/content_client.h

* chore: iwyu <list>

* chore: iwyu <optional>

* chore: iwyu <memory>

* chore: iwyu base/files/file_path.h

* chore: iwyu ui/base/cursor/cursor.h

* chore: iwyu build/build_config.h

* chore: iwyu content/public/browser/web_contents.h

* chore: iwyu shell/browser/hid/hid_chooser_context.h

* chore: iwyu shell/common/platform_util.h

* chore: iwyu base/task/single_thread_task_runner.h

* chore: iwyu content/browser/renderer_host/render_widget_host_impl.h

* chore: iwyu content/public/browser/render_widget_host.h

* chore: iwyu shell/browser/electron_browser_context.h

* chore: iwyu content/public/browser/web_contents_observer.h

* chore: iwyu content/public/browser/render_frame_host.h

* chore: iwyu content/public/browser/media_stream_request.h

* chore: iwyu chrome/common/chrome_paths.h

* chore: iwyu chrome/browser/icon_manager.h

* chore: iwyu printing/print_settings.h

* chore: iwyu renderer/pepper_helper.h

* chore: iwyu shell/browser/api/process_metric.h

* chore: iwyu shell/browser/electron_browser_client.h

* chore: iwyu shell/browser/electron_browser_context.h

* chore: iwyu shell/browser/api/electron_api_session.h

* chore: iwyu shell/browser/api/electron_api_app.h

* chore: iwyu shell/browser/ui/views/client_frame_view_linux.h

* chore: iwyu shell/browser/native_window_views.h

* chore: iwyu base/win/windows_version.h

* chore: iwyu shell/common/electron_paths.h

* chore: iwyu content/public/common/content_switches.h

* chore: iwyu third_party/skia/include/core/SkRRect.h

* chore: iwyu third_party/skia/include/core/SkBitmap.h

* chore: iwyu third_party/skia

* chore: iwyu shell/browser/osr/osr_host_display_client.h

* chore: iwyu shell/browser/login_handler.h

* chore: iwyu shell/browser/javascript_environment.h

* chore: iwyu shell/browser/event_emitter_mixin.h

* fix: mac

* fix: mac

* chore: iwyu base/nix/xdg_util.h

* fix: win

* fix: win

* fix: win

* fix: win
2024-07-25 11:25:45 +02:00
Shelley Vohr
cfdcf48e1b fix: desktopCapturer breaks BrowserWindow resizable on macOS (#43013)
* fix: desktopCapturer breaks BrowserWindow resizable on macOS

* test: oops fix showing
2024-07-25 11:17:37 +02:00
David Sanders
c2c079dc82 build: update docs-parser and typescript-definitions packages (#43038)
build: update docs-parser and typescript-definitions pacakges
2024-07-25 11:00:32 +02:00
David Sanders
f979d4c742 test: add test for nodeCliInspect fuse (#43035) 2024-07-25 11:00:02 +02:00
Charles Kerr
df524c6eca chore: use v8::Local<>, not v8::Handle<> (#43019)
v8::Handle is an alias for v8::Local that "is kept around for historical
reasons" and is disabled when V8_IMMINENT_DEPRECATION_WARNING is defined
2024-07-24 18:24:07 -05:00
Shelley Vohr
5669a40d5c feat: add transparency checking to nativeTheme (#42862)
* feat: add transparency checking to nativeTheme

Refs https://chromium-review.googlesource.com/c/chromium/src/+/4684870

* chore: deprecate previous function

* chore: fix lint
2024-07-24 14:38:22 +02:00
Shelley Vohr
9fc760bc4c docs: note macOS fullscreen events in fullscreen query (#42997)
docs: note macOS fullscreen events in fs query
2024-07-23 16:40:59 -04:00
electron-roller[bot]
3e22f992b0 chore: bump chromium to 128.0.6611.0 (main) (#42779)
* chore: bump chromium in DEPS to 128.0.6577.0

* chore: bump chromium in DEPS to 128.0.6579.0

* 5675706: Reland "Reland "Reland "Reland "Add toolchains without PartitionAlloc-Everywhere for dump_syms et al""""

https://chromium-review.googlesource.com/c/chromium/src/+/5675706

* 5668597: [PDF Ink Signatures] Prompt download menu on save when there are edits

https://chromium-review.googlesource.com/c/chromium/src/+/5668597

* 5677014: Reland "Pull data_sharing_sdk from CIPD"

https://chromium-review.googlesource.com/c/chromium/src/+/5677014

* chore: fixup patch indices

* chore: bump chromium in DEPS to 128.0.6581.0

* chore: bump chromium in DEPS to 128.0.6583.0

* update patches

* 5455480: [Extensions] Allow service worker requests to continue without a cert

https://chromium-review.googlesource.com/c/chromium/src/+/5455480

* try to get some debugging output from script/push-patch.js

* chore: bump chromium in DEPS to 128.0.6585.0

* chore: bump chromium in DEPS to 128.0.6587.0

* update patches

* chore: bump chromium in DEPS to 128.0.6589.0

* more patch work

* maybe over here?

* chore: update patches

* 5673207: [HTTPS Upgrades] Disable in captive portal login webview

https://chromium-review.googlesource.com/c/chromium/src/+/5673207

* 5636785: Extensions: WAR: manifest.json's use_dynamic_url requires a dynamic url

https://chromium-review.googlesource.com/c/chromium/src/+/5636785

* chore: bump chromium in DEPS to 128.0.6591.0

* 5665458: Trigger WN2 page when feature is enabled

https://chromium-review.googlesource.com/c/chromium/src/+/5665458

* update patches

* chore: bump chromium in DEPS to 128.0.6593.0

* chore: bump chromium in DEPS to 128.0.6595.0

* chore: bump chromium in DEPS to 128.0.6597.0

* (patch update) 5694586: [compile hints] Remove the usage of v8::Isolate::SetJavaScriptCompileHintsMagicEnabledCallback API
https://chromium-review.googlesource.com/c/chromium/src/+/5694586

* update patches

* 5691287: Reland "Change blink::WebKeyboardEvent to use std::array in is members"
https://chromium-review.googlesource.com/c/chromium/src/+/5691287

The code changed here is modeled after code in `content/renderer/pepper/event_conversion.cc` that was also modified in this CL, so I took the same approach.

* 5529018: Cleanup EnableWebHidOnExtensionServiceWorker flag
https://chromium-review.googlesource.com/c/chromium/src/+/5529018

* 5526324: [Code Health] Add deprecation comment for base::SupportsWeakPtr.
https://chromium-review.googlesource.com/c/chromium/src/+/5526324

Note that this CL actually does make `SupportsWeakPtr` strictly restricted to existing implementations, no new ones. We could add a patch to add ourselves to this list, but it looks like we'll have to refactor this anyways in the near future. Since the refactor seems straightforward, let's try that first.

* chore: bump chromium in DEPS to 128.0.6598.0

* chore: update patches

* 5704737: Rename ExclusiveAccessContext::GetActiveWebContents to avoid conflict
https://chromium-review.googlesource.com/c/chromium/src/+/5704737

* chore: bump chromium in DEPS to 128.0.6601.0

* chore: update patches

* Add `base::StringPiece` header includes

Chromium is working on replacing `base::StringPiece` with `std::string_view`. (See the Chromium Bug below.) They're currently running mass codemods (across many multiple changes) to replace uses of `StringPiece` with `string_view`, including removing the header include for `StringPiece` in those files. This cascades down to our files that were implicitly depending on those includes through some other include.

They're on track to eventually deprecate and remove `StringPiece` so our code should be converted, but that can be done as an upgrade follow-up task. For now, adding the header back to files that need it should suffice for minimal upgrade changes.

Chromium Bug: https://issues.chromium.org/issues/40506050

* 5702737: GlobalRequestID: Avoid unwanted inlining and narrowing int conversions
https://chromium-review.googlesource.com/c/chromium/src/+/5702737

contender for smallest commit 2024

* 5706534: Rename GlobalFeatures to GlobalDesktopFeatures.
https://chromium-review.googlesource.com/c/chromium/src/+/5706534

* 5691321: ui: remove params variants of SelectFile listener functions
https://chromium-review.googlesource.com/c/chromium/src/+/5691321

* 5714949: [Extensions] Display re-enable dialog for MV2 disabled stage
https://chromium-review.googlesource.com/c/chromium/src/+/5714949

* chore: update libc++ filenames

* patch: disable scope reuse & associated dchecks in v8 (hopefully temp, upgrade follow-up)

* fixup! Add `base::StringPiece` header includes

* update MAS patch

5710330: Add crash keys to debug NativeWidgetMacNSWindowBorderlessFrame exception
https://chromium-review.googlesource.com/c/chromium/src/+/5710330

* chore: bump chromium in DEPS to 128.0.6603.0

* chore: update patches

* 5713258: Reland "Preparation for decoupling creation/initialization of context"
https://chromium-review.googlesource.com/c/chromium/src/+/5713258

When destroying a context, it must already be shutdown, and this change enforces it with a new CHECK.

We were overriding `BrowserContextKeyedServiceFactory::BrowserContextShutdown` with an empty implementation, which differed from the default implementation that notifies the `KeyedServiceFactory` that the context has shutdown. Since we were missing this notification, the CHECK would later trip when the service was being destoryed because it was not registered as shutdown when it was shutdown.

* chore: bump chromium in DEPS to 128.0.6605.2

* chore: update patches

* refactor: linux open/save dialog patch

Our existing implementation was relying on an opaque `void* params` parameter that was passed through `ui::SelectFileDialog`.

Recently, that parameter has been getting removed:
- 5691321: ui: remove params variants of SelectFile listener functions | https://chromium-review.googlesource.com/c/chromium/src/+/5691321
- 5709097: ui: remove SelectFileDialog impl params | https://chromium-review.googlesource.com/c/chromium/src/+/5709097
- https://issues.chromium.org/issues/340178601 "reconsider SelectFileDialog"

This restructures the patch to work with mostly the same mechanics, but directly on the `ui::SelectFileDialog` object. This nets us some wins in terms of a smaller patch.

* 5713262: DevTools UI binding AIDA client event returns response
https://chromium-review.googlesource.com/c/chromium/src/+/5713262

* fixup! refactor: linux open/save dialog patch

* chore: bump chromium in DEPS to 128.0.6606.0

* chore: update patches

* fixup! refactor: linux open/save dialog patch

* chore: bump chromium in DEPS to 128.0.6607.0

* chore: update printing.patch

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5722937

* fix: pwd error in electron-test, nan-test

fix: unshallow depot_tools before 3-way apply

* chore: e patches all

* fixup! fix: pwd error in electron-test, nan-test

* chore: bump chromium in DEPS to 128.0.6609.0

* chore: bump chromium in DEPS to 128.0.6611.0

* chore: update patches

* chore: update libcxx filenames

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: Jeremy Rose <nornagon@nornagon.net>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
Co-authored-by: clavin <clavin@electronjs.org>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: Alice Zhao <alice@makenotion.com>
2024-07-23 08:59:44 -07:00
dependabot[bot]
364631ee0b build(deps): bump github/codeql-action from 3.25.12 to 3.25.13 (#42999)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.25.12 to 3.25.13.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](4fa2a79536...2d790406f5)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-23 12:38:02 +02:00
Shelley Vohr
3c9d4452c6 docs: improve desktop capture example (#42957) 2024-07-23 11:55:23 +02:00
dependabot[bot]
daa8244cdf build(deps): bump actions/upload-artifact from 4.3.3 to 4.3.4 (#42998)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.3.3 to 4.3.4.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](https://github.com/actions/upload-artifact/compare/v4.3.3...0b2256b8c012f0828dc542b3febcab082c67f72b)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-23 10:18:36 +02:00
Shelley Vohr
8454f4e49f feat: emit an event when accessing restricted path in File System Access API (#42561)
* fix: show a dialog when accessing restricted path in File System Access API

* fix: allow overriding initial blocked paths

* docs: fix doc

* Update docs/api/session.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* fix: change block to deny for consistency

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2024-07-22 12:18:15 +02:00
Charles Kerr
60c4c9fec6 chore: remove unused #includes (#42971)
* chore: iwyu buildflags.h

* chore: iwyu dictionary.h

* chore: iwyu arguments.h

* chore: iwyu values.h

* chore: iwyu compiler_specific.h

* chore: iwyu binder_map.h

* chore: iwyu <vector>

* chore: iwyu <set>

* chore: iwyu raw_ptr

* chore: iwyu gfx/canvas.h

* chore: iwyu gfx/color_utils.h

* chore: iwyu base/strings/stringprintf.h

* chore: iwyu base/task/thread_pool.h

* chore: iwyu base/no_destructor.h

* chore: iwyu base/path_service.h

* chore: iwyu base/files/file_pathh

* chore: iwyu base/strings/sys_string_conversions.h

* chore: iwyu base/logging.h

* chore: iwyu base/command_line.h

* chore: iwyu base/files/file_util.h

* chore: iwyu base/files/scoped_file.h

* chore: iwyu base/strings/utf_string_conversions.h

* chore: iwyu base/environment.h

* chore: iwyu base/scoped_observation.h

* chore: iwyu base/strings/string_split.h

* chore: iwyu base/strings/pattern.h

* chore: iwyu base/json/string_escape.h

* chore: iwyu base/json/json_reader.h

* chore: iwyu base/memory/singleton.h

* chore: iwyu base/observer_list.h

* chore: iwyu base/timer/timer.h

* fixup! chore: iwyu values.h

* chore: iwyu shell/browser/browser.h

* chore: iwyu base/stl_util.h

* chore: iwyu base/strings/string_util.h

* chore: iwyu shell/browser/javascript_environment.h

* chore: iwyu base/memory/ref_counted.h

* chore: iwyu base/environment.h

* chore: iwyu content/public/browser/browser_thread.h

* chore: remove unused typedef gin_helper::EventEmitter::ValueArray

* chore: iwyu gin/wrappable.h

* chore: iwyu shell/common/gin_helper/function_template_extensions.h

* chore: iwyu shell/common/gin_converters/login_item_settings_converter.h

* chore: iwyu shell/common/gin_helper/arguments.h

* chore: iwyu ui/gfx/skia_util.h

* chore: iwyu ui/gfx/geometry/rect.h

* chore: iwyu ui/gfx/image/image.h

* chore: iwyu base/strings/strcat.h

* chore: iwyu ui/native_theme/native_theme.h

* fixup! chore: iwyu shell/browser/javascript_environment.h

* fixup! chore: iwyu gfx/canvas.h

* fixup! chore: iwyu content/public/browser/browser_thread.h

* fixup! chore: iwyu ui/native_theme/native_theme.h

* fixup! chore: iwyu ui/native_theme/native_theme.h
2024-07-22 11:31:32 +02:00
David Sanders
296a558c32 build: update @electron/lint-roller to 2.3.0 (#42950) 2024-07-22 10:45:49 +02:00
Charles Kerr
780677e00f chore: remove unused BaseWindow::GetWeakPtr() (#42973)
last caller removed in 67ba3040 (#37902)
2024-07-22 10:44:34 +02:00
Charles Kerr
8c8a7709e6 chore: remove unused WrappableBase::AfterInit() (#42974)
last caller removed in 6159066c (#22916)
2024-07-22 10:44:21 +02:00
Charles Kerr
c72a714dd5 refactor: remove WindowListObserver::OnWindowAdded() (#42979)
refactor: remove WindowListObserver::OnWindowRemove()

these have never been used
2024-07-22 10:44:08 +02:00
Charles Kerr
7a101a1c4b refactor: remove unused web contents preferences methods (#42947)
* chore: remove unused WebContentsPreferences::ShouldDisableDialogs()

* chore: remove unused WebContentsPreferences::ShouldUseSafeDialogs()

caller removed in 85bc005c

* chore: remove unused WebContentsPreferences::GetSafeDialogsMessage()

caller removed in 85bc005c

* refactor: WebContentsPreferences::GetPreloadPath() now returns a std::optional<base::FilePath>

* refactor: make WebContentsPreferences::last_preference() const
2024-07-19 12:26:57 -05:00
Charles Kerr
5b7ed6097e chore: remove unused typedef CreateDownloadPathCallback (#42949)
chore: remove unused typedef ElectronDownloadManagerDelegate::CreateDownloadPathCallback

use was removed in e3c580e9
2024-07-19 11:49:58 -05:00
Charles Kerr
32a74b0942 chore: remove unused field ElectronBrowserClient::browser_main_parts_ (#42956)
chore: remove unused field ElectronBrowserClient::browser_main_parts_

caller removed in 48d0b09a
2024-07-19 11:48:52 -05:00
Charles Kerr
5773a2dce6 fix: dangling raw_ptr NodeBindings::uv_env_ (#42933) 2024-07-17 23:30:09 -05:00
Charles Kerr
bc345db351 fix: dangling raw_ptr<views::View> in api::View (#42929) 2024-07-17 21:31:48 -05:00
David Sanders
ce45450c28 ci: refactor non-maintainer lockfile change check to request changes (#42855) 2024-07-17 12:28:08 -07:00
arno renevier
81bdba67ec feat: Implement password delegate for NSS (#41205)
* feat: Implement password delegate for NSS (#41188)

Introduce an app event client-certificate-request-password. It allows
the user to display a UI to prompt for the password.

An alternative would have been to implement a class similar to
CryptoModulePasswordDialogView, to provide the UI. This might have been
simpler for the user, comparing to letting them implement the UI. But it
seems like electron does not have an i18n framework, so it's not
possible to provide a locale aware UI.

* fix lint:markdown error

* address review comments

* use a trampoline handler in JS. The api exposed is now app.setClientCertRequestPasswordHandler
* use properties on the Event object instead of positional parameters
* remove ChromeNSSCryptoModuleDelegate::OnPassword in favor of args->GetNext(&password_)

* address review comments second round

- backslash escape parametrized TypeScript
- rename hostName param to hostname
- use base::ScopedAllowBaseSyncPrimitivesForTesting
- and then, rename ChromeNSSCryptoModuleDelegate to ElectronNSSCryptoModuleDelegate

* Update docs/api/app.md

Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>

* Update docs/api/app.md

Co-authored-by: Erick Zhao <erick@hotmail.ca>

---------

Co-authored-by: Arno Renevier <arnaud@switchboard.app>
Co-authored-by: Sam Maddock <samuel.maddock@gmail.com>
Co-authored-by: Erick Zhao <erick@hotmail.ca>
2024-07-17 09:48:03 -04:00
dependabot[bot]
c210ae9b33 build(deps): bump actions/download-artifact from 4.1.7 to 4.1.8 (#42831)
Bumps [actions/download-artifact](https://github.com/actions/download-artifact) from 4.1.7 to 4.1.8.
- [Release notes](https://github.com/actions/download-artifact/releases)
- [Commits](65a9edc588...fa0a91b85d)

---
updated-dependencies:
- dependency-name: actions/download-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-17 15:18:41 +02:00
dependabot[bot]
734ba50ee1 build(deps): bump amannn/action-semantic-pull-request from 5.5.2 to 5.5.3 (#42834)
build(deps): bump amannn/action-semantic-pull-request

Bumps [amannn/action-semantic-pull-request](https://github.com/amannn/action-semantic-pull-request) from 5.5.2 to 5.5.3.
- [Release notes](https://github.com/amannn/action-semantic-pull-request/releases)
- [Changelog](https://github.com/amannn/action-semantic-pull-request/blob/main/CHANGELOG.md)
- [Commits](cfb60706e1...0723387faa)

---
updated-dependencies:
- dependency-name: amannn/action-semantic-pull-request
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-17 15:18:33 +02:00
wujinli
9023707b9b fix: crash with creating OffScreenWebContentsView (#42920)
On the Mac platform, OffScreenWebContentsView uses Automatic Reference
Counting (ARC) to handle the lifecycle of offScreenView_. However, this
private member variable is not initialized and its value is undefined.
In some cases, it is initialized to a garbage value, which may cause ARC
to release the value incorrectly, resulting in a crash.
2024-07-17 13:09:32 +02:00
dependabot[bot]
2875fab452 build(deps): bump actions/setup-node from 4.0.2 to 4.0.3 (#42917)
Bumps [actions/setup-node](https://github.com/actions/setup-node) from 4.0.2 to 4.0.3.
- [Release notes](https://github.com/actions/setup-node/releases)
- [Commits](60edb5dd54...1e60f620b9)

---
updated-dependencies:
- dependency-name: actions/setup-node
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-17 11:36:52 +02:00
Shelley Vohr
fd907bc0a3 fix: getUserMedia needs macOS system permissions check (#42899)
fix: getUserMedia needs macOS system permissions check

Closes https://github.com/electron/electron/issues/42714
Closes https://github.com/electron/electron/issues/29861
2024-07-17 11:30:05 +02:00
Sam Maddock
c7709747d0 ci: upload test artifacts (#42925)
* Upload test-artifacts directory

* Rename test artifacts directory to avoid conflicts

* Update .gitignore

* Upload test artifacts

* Update .gitignore

* Update move-artifacts.sh

* Update artifacts.ts

* Update pipeline-segment-electron-test.yml

* Make output less noisy

* reduce artifact image size
2024-07-16 22:56:56 -07:00
Sam Maddock
778d3098a0 feat: customize border radius of Views (#42320)
* feat: add View#setBorderRadius

test: initial setBorderRadius tests

fix: robustly set border radius

chore: add PAUSE_CAPTURE_TESTS for easier screencap dev

feat: add view border radius support

test: view border radius

refactor: cleanup view code

* maybe delay capture to fix tests?

* refactor: retry screen captures in an attempt to fix flakiness

* refactor: ScreenCapture constructor no longer async

* increase screen capture timeout, feels a little short

* refactor: move rounded rect util into chromium_src

* skip some capture tests on mas
2024-07-16 20:16:25 -04:00
Shelley Vohr
cbd11bb605 fix: BrowserWindow.setBackgroundColor should work with transparency (#42824)
fix: BrowserWindow.setBackgroundColor should work with transparency
2024-07-16 20:11:49 +02:00
Calvin
81351dd1a9 build: fix clang format location helper (again) (#42911) 2024-07-16 11:21:18 -04:00
dependabot[bot]
f575e52586 build(deps): bump github/codeql-action from 3.25.11 to 3.25.12 (#42916)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.25.11 to 3.25.12.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](b611370bb5...4fa2a79536)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-16 11:25:42 +02:00
Theo Gravity
bab3fcc9ab feat: add getPercentComplete / getCurrentBytesPerSecond / getEndTime to DownloadItem (#42805)
feat: getCurrentSpeed / getPercentComplete / getEndTime on DownloadItem
2024-07-15 19:32:44 -04:00
David Sanders
0fddfd1b28 ci: auto comment on new issues for unsupported majors (#42856) 2024-07-15 15:25:47 -04:00
Keeley Hammond
c006e129b3 build: remove CircleCI (#42844)
* build: remove CircleCI

* chore: remove remaining CircleCI references
2024-07-15 14:26:41 -04:00
reito
f173a0637a chore: fix npm run lint not working on Windows (#42281)
* fix: fixed the `npm run lint` not working on Windows.

* chore: more fixes for lint on Windows

* chore: revert change to patch linting

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2024-07-15 18:08:33 +02:00
Shelley Vohr
ae1a684d10 fix: iteration issues in hid RevokeEphemeralDevicePermission (#42851)
fix: iteration issues in hid RevokeEphemeralDevicePermission
2024-07-15 10:41:38 -04:00
Robo
1e1dc22e16 fix: crash when resolving proxy due to network service restart (#42878) 2024-07-15 17:46:24 +09:00
Shelley Vohr
bbd7f4a5ad fix: File System Access API should remember last picked directory (#42850) 2024-07-14 18:43:37 +02:00
Calvin
493bc3ac9d fix: desktopCapturer and screen display ids should match (#42883)
* fix: `desktopCapturer` and `screen` display IDs should match

* simplify wide-to-utf8 conversion

* remove unnecessary include
2024-07-14 09:51:57 +02:00
John Kleinschmidt
3a6a201534 build: fixup GHA running on fork PRs (#42880)
* chore: update build-tools for GHA

* chore: don't rely on environment variables for source cache location
2024-07-13 13:38:03 -04:00
Samuel Attard
53d7cca7a2 build: use new arc runner names (#42881) 2024-07-12 22:22:49 -07:00
David Sanders
7dd6d7697d chore: allow multiple OS selection on bug reports (#42854) 2024-07-11 13:23:43 -07:00
John Kleinschmidt
514e9bbb04 build: update build-tools for GHA (#42870)
chore: update build-tools for GHA
2024-07-11 16:18:26 -04:00
Shelley Vohr
dab006b1cf ci: fix Nan test failure on Linux (#42863)
ci: Nan test failure on Linux
2024-07-11 10:47:02 -04:00
Shelley Vohr
4e10eeb87e fix: desktopCapturer and screen source ids should match screen ids (#42781)
* fix: desktopCapturer screen source ids should match screen ids

* test: add a regression test
2024-07-10 16:32:29 -07:00
Shelley Vohr
fa6ce4f0f8 fix: High Contrast mode not working on Windows (#42853)
Closes https://github.com/electron/electron/issues/42609
Refs https://chromium-review.googlesource.com/c/chromium/src/+/5324688
Refs https://chromium-review.googlesource.com/c/chromium/src/+/5368321
2024-07-10 15:14:02 -07:00
Charles Kerr
f9d94211bb refactor: do not subclass ElectronSpeechRecognitionManagerDelegate from SpeechRecognitionEventListener (#42806)
All the listener functions are empty stubs (and have been since d4e3c39)
so it doesn't seem like we need a listener?

SpeechRecognitionManagerDelegate declares this method:

> // Checks whether the delegate is interested (returning a non nullptr
> // ptr) or not (returning nullptr) in receiving a copy of all sessions
> // events. This is called on the IO thread.
> virtual SpeechRecognitionEventListener* GetEventListener() = 0;

This PR has ElectronSpeechRecognitionManagerDelegate stop subclassing
from the Listener and changes GetEventListener() to return nullptr.
2024-07-10 15:32:50 +02:00
electron-roller[bot]
48fc352bcf chore: bump node to v20.15.1 (main) (#42841)
* chore: bump node in DEPS to v20.15.1

* chore: update patches

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
2024-07-10 14:52:06 +02:00
John Kleinschmidt
1a9f99b3ed chore: speed up azcopy on src cache (#42742) 2024-07-09 16:20:18 -04:00
dependabot[bot]
34e7648478 build(deps): bump github/codeql-action from 3.25.10 to 3.25.11 (#42832)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.25.10 to 3.25.11.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](23acc5c183...b611370bb5)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-09 11:27:37 +02:00
dependabot[bot]
c2ea3881fc build(deps): bump actions/upload-artifact from 4.3.3 to 4.3.4 (#42833)
Bumps [actions/upload-artifact](https://github.com/actions/upload-artifact) from 4.3.3 to 4.3.4.
- [Release notes](https://github.com/actions/upload-artifact/releases)
- [Commits](65462800fd...0b2256b8c0)

---
updated-dependencies:
- dependency-name: actions/upload-artifact
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-07-09 11:25:07 +02:00
David Sanders
170b72ccfa ci: fix CircleCI config (#42829)
* ci: fix CircleCI config

* ci: fix syntax error
2024-07-08 21:38:05 -04:00
Shelley Vohr
e54ffdf7ed build: clean up BoringSSL patch (#42730) 2024-07-08 16:35:54 -04:00
Charles Kerr
e9db02948e fix: multiple move() calls on the same unique_ptr (#42788) 2024-07-08 11:04:35 -04:00
Charles Kerr
27e3273f0a refactor: minor electron browser context cleanup (#42789)
* refactor: make DevicePermissionMap private to electron::ElectronBrowserContext

refactor: make PartitionPath private to electron::ElectronBrowserContext

* refactor: remove unused forward declarations of v8 classes

* chore: forward declare gin::Arguments

* refactor: use unique_ptr operator bool
2024-07-08 16:49:41 +02:00
electron-appveyor-updater[bot]
e99e554655 build: update appveyor image to latest version (#42771)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-07-08 12:56:52 +02:00
Charles Kerr
5ff91159cd fix: dangling raw_ptr ElectronBrowserContext::extension_system_ (#42785)
The extension system is freed by the DestroyBrowserContextServices()
call in the destructor, so we need to zero out the pointer to avoid
a dangling raw_ptr error.
2024-07-08 12:56:03 +02:00
Charles Kerr
e89da2bad2 fix: dangling raw_ptr<Session> in UserDataLink (#42786)
* fix: dangling raw_ptr<Session> in UserDataLink

* chore: make linter happy
2024-07-08 12:55:48 +02:00
Shelley Vohr
cb2e7f130b fix: potentially closed webContents in BrowserView (#42633) 2024-07-08 12:13:53 +02:00
Shelley Vohr
2f4a46f47a fix: video and audio capture should be separate (#42775) 2024-07-08 10:11:40 +02:00
Shelley Vohr
ac074a5548 refactor: run Windows SelectFileDialog out of process (#42758)
* refactor: run Windows SelectFileDialog out of process

* fix: add missing IS_WIN guard

* refactor: use upstream SelectFileDialogFactory

* fix: build chrome/services/util_win/public/mojom target
2024-07-05 11:36:44 +02:00
electron-roller[bot]
19e030a6e8 chore: bump chromium to 128.0.6573.0 (main) (#42766)
* chore: bump chromium in DEPS to 128.0.6573.0

* chore: update patches

* 5665092: Remove default arguments on virtual functions in WebContents

https://chromium-review.googlesource.com/c/chromium/src/+/5665092

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-07-05 09:51:21 +02:00
Shelley Vohr
5bff883c40 chore: clean up outdated goma references (#42762) 2024-07-05 09:44:34 +02:00
Shelley Vohr
25eb1bd4b2 build: remove all publish & build on macOS (#42763) 2024-07-03 15:17:17 -04:00
electron-roller[bot]
07e6b34a07 chore: bump chromium to 128.0.6571.0 (main) (#42749)
* chore: bump chromium in DEPS to 128.0.6571.0

* 5636652: [4/n] Introduce RenderInputRouterClient and move InputRouterClient implementation to RenderInputRouter.

https://chromium-review.googlesource.com/c/chromium/src/+/5636652

* 5655811: Revert "Reland "Reland "Add toolchains without PartitionAlloc-Everywhere for dump_syms et al"""

https://chromium-review.googlesource.com/c/chromium/src/+/5655811

* 5581006: [tracing] Forward startup tracing config as shmem

https://chromium-review.googlesource.com/c/chromium/src/+/5581006

* chore: fixup patch indices

* 5608450: [Views AX] Move Image Auto Captioning strings to ui/

https://chromium-review.googlesource.com/c/chromium/src/+/5608450

* 5648900: [Extensions] Move ExtensionAPIEnabledForServiceWorkerScript()

https://chromium-review.googlesource.com/c/chromium/src/+/5648900

* 5651681: Remove Web Speech API profanity masking

https://chromium-review.googlesource.com/c/chromium/src/+/5651681

* 5651361: `content::RenderFrame::GetBrowserInterfaceBroker`: return a const-ref.

https://chromium-review.googlesource.com/c/chromium/src/+/5651361

* 5604943: Start capture of toolbar after gesture end events are received

https://chromium-review.googlesource.com/c/chromium/src/+/5604943

* 5624392: [BRP] Enforce raw_ptr/ref in Renderer code

https://chromium-review.googlesource.com/c/chromium/src/+/5624392

* 5659259: Portals: Remove WebContentsView::TransferDragSecurityInfo

https://chromium-review.googlesource.com/c/chromium/src/+/5659259

* 5230721: Move ComposeStatus to components/compose

https://chromium-review.googlesource.com/c/chromium/src/+/5230721

* 5647894: [api] Cleanup usages of v8::ReturnValue<void>::Set[NonEmpty](..)

https://chromium-review.googlesource.com/c/v8/v8/+/5647894

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-07-03 11:15:35 -04:00
Charles Kerr
cf5fb4505e refactor: make session::browser_context_ a const raw_ref (#42728)
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-07-02 17:53:36 -04:00
Erick Zhao
0a8eae9019 docs(autoUpdater): document static storage strategy (#42690)
* docs: `autoUpdater` static storage strategy

* summary must be followed by newline

* lint: fix whitespace for code blocks

* lint: `js` -> `javascript`

* bump

* `javascript` -> `js`

* bump
2024-07-02 19:06:38 +02:00
Erick Zhao
6cca75ac76 docs(autoUpdater): signing is only a pre-req on macOS (#42709)
docs: correctly state that signing is a pre-req for autoUpdater only on macOS
2024-07-02 19:06:25 +02:00
electron-appveyor-updater[bot]
67d7944271 build: update appveyor image to latest version (#42748)
Co-authored-by: electron-appveyor-updater[bot] <161660339+electron-appveyor-updater[bot]@users.noreply.github.com>
2024-07-02 10:38:43 -04:00
Shelley Vohr
1729a9868c fix: use BlockedRequest struct to handle webRequest data (#42647)
Fixes an issue where Chromium could crash on a dangling unretained pointer in one of several webRequest functions. This was happening as a result of the fact that we had outstanding blocking requests continue to reference state owned by ProxyingWebsocket and ProxyingURLLoaderFactory after the requests were destroyed.

This had been going on for a few years, and was likely leading to some ongoing memory issues. To fix this, we need to ensure that all state is cleaned up in OnRequestWillBeDestroyed. I chose to create a new BlockedRequest struct to do so, which approximates the approach that upstream takes. The complexities of doing so also made our templated approach more trouble than it felt worth, so i pried that apart into separate handlers.
2024-07-02 14:02:49 +02:00
electron-roller[bot]
8a8241163d chore: bump chromium to 128.0.6558.0 (main) (#42413)
* chore: bump chromium in DEPS to 127.0.6526.0

* chore: update network_service_allow_remote_certificate_verification_logic.patch

manually apply patch due to minor upstream shear

Xref: https://chromium-review.googlesource.com/c/chromium/src/+/5598454

* chore: update fix_move_autopipsettingshelper_behind_branding_buildflag.patch

No manual changes; patch applied with fuzz 1

* chore: update refactor_expose_file_system_access_blocklist.patch

No manual changes; patch applied with fuzz 2

* chore: update revert_heap_add_checks_position_info.patch

No manual changes; patch applied with fuzz 1

* chore: e patches all

* chore: bump chromium in DEPS to 127.0.6527.0

* chore: update patches

* chore: bump chromium in DEPS to 127.0.6529.0

* chore: bump chromium in DEPS to 127.0.6531.0

* chore: update patches

* 5596349: Remove PDF OCR toggle from settings.

https://chromium-review.googlesource.com/c/chromium/src/+/5596349

* 5585932: [video-pip] Add minimize button to video picture-in-picture window

https://chromium-review.googlesource.com/c/chromium/src/+/5585932

* 5604487: Reland "[api] Deprecate v8::FunctionCallbackInfo::Holder() for real"

https://chromium-review.googlesource.com/c/v8/v8/+/5604487

* 5581721: [DEPS] Update clang-format location

https://chromium-review.googlesource.com/c/chromium/src/+/5581721

* 5597904: [Windows] Remove ConvertToLongPath from Sandbox Utilities.

https://chromium-review.googlesource.com/c/chromium/src/+/5597904

ResolveNTFunctionPtr was removed in this CL.

* fix: visibility state specs on macOS

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5605407

* Revert "fix: visibility state specs on macOS"

This reverts commit 1eee30a33d.

* temp: disable occlusion checker on macOS

* chore: bump chromium in DEPS to 128.0.6535.0

* chore: update patches

* [Extensions] Move some scriptings files out of the API directory.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5606682

* fix[node]: do not use soon-to-be-deprecated V8 API

* fix: update api_remove_allcan_read_write.patch

* chore: update patches

* chore: update patches

* chore: fix lf mismatch in api_remove_allcan_read_write.patch

* chore: update patches

* chore: bump chromium in DEPS to 128.0.6538.0

* chore: update v8 patches

* chore: update patches

* ui/gl/features.gni: Set use_egl=true unconditionally.

Refs https://chromium-review.googlesource.com/c/chromium/src/+/5569748
Refs https://issues.chromium.org/issues/344606399

* chore: bump chromium in DEPS to 128.0.6540.0

* chore: bump chromium in DEPS to 128.0.6541.0

* chore: update patches

* chore: fix nan read/write patch

* chore: bump chromium in DEPS to 128.0.6543.0

* 5626254: Use sandbox_type instead of process_type | https://chromium-review.googlesource.com/c/chromium/src/+/5626254

* chore: update patches

* rework nan patches

* 5621488: Apply consistent naming conventions to zoom values | https://chromium-review.googlesource.com/c/chromium/src/+/5621488

* chore: bump chromium in DEPS to 128.0.6544.0

* 5605693: Remove files from third_party/ninja | https://chromium-review.googlesource.com/c/chromium/src/+/5605693

* chore: update patches

* chore: maybe fix nan patch, part 3

* chore: delete nan patch

* chore: re-add nan patch (attempt 2)

* chore: add test patch

* fixup! add test patch

* chore: bump chromium in DEPS to 128.0.6549.0

* chore: bump chromium in DEPS to 128.0.6551.0

* 5637699: Add command line to ASAN Additional Info section | https://chromium-review.googlesource.com/c/chromium/src/+/5637699

* chore: update patches

* chore: bump chromium in DEPS to 128.0.6553.0

* chore: bump chromium in DEPS to 128.0.6555.0

* fix: add property query interceptors

* chore: bump chromium in DEPS to 128.0.6557.0

* 5583182: Automatic Fullscreen: Prototype Permissions API query support | https://chromium-review.googlesource.com/c/chromium/src/+/5583182

* 5613297: Move render input router and related dependencies to //components/input | https://chromium-review.googlesource.com/c/chromium/src/+/5613297

* chore: update patches

* test: skip methodswithdata-test.js nan test

* chore: bump chromium in DEPS to 128.0.6558.0

* chore: update patches

* build: reference correct ninja cipd ref

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5605693

* update libcxx filenames

* refactor: CursorManager moved to //components/input

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5613297

* refactor: spanify mojo Read/WriteData methods

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5619291

* refactor: remove constexpr from KeyboardCodeFromKeyIdentifier

Ref: unknown

Added TODO to investigate after

* chore: update patches

* refactor: improve type safety of a11y ids

Ref: https://chromium-review.googlesource.com/c/chromium/src/+/5614590

* chore: disable tls node tests that don't apply given boringssl tls configuration

Ref: https://boringssl-review.googlesource.com/c/boringssl/+/68487

* chore: add patch to fix nan v8 incompat with NamedPropertyHandlerConfiguration and IndexedPropertyHandlerConfiguration

Ref: https://chromium-review.googlesource.com/c/v8/v8/+/5630388

* fix: limit subspan length per feedback

* Fix incorrect CalculateInsetsInDIP check

* 5645742: Reland "Reland "Add toolchains without PartitionAlloc-Everywhere for dump_syms et al""

https://chromium-review.googlesource.com/c/chromium/src/+/5645742

* chore: more Windows logging

* 5617471: Add NPU blocking to chromium blocklist

https://chromium-review.googlesource.com/c/chromium/src/+/5617471

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Charles Kerr <charles@charleskerr.com>
Co-authored-by: PatchUp <73610968+patchup[bot]@users.noreply.github.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
Co-authored-by: deepak1556 <hop2deep@gmail.com>
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
Co-authored-by: Alice Zhao <alice@makenotion.com>
Co-authored-by: Samuel Attard <marshallofsound@electronjs.org>
Co-authored-by: VerteDinde <vertedinde@electronjs.org>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-07-02 09:51:33 +02:00
Anny Yang
14303a0a71 docs: grammar fix in isBeingCaptured docs (#42692) 2024-07-01 15:01:27 -04:00
Chris Stringer
2b5342cb49 docs - Update net.md (#42691)
Update net.md

Changes heading level for net.resolveHost() entry to H3
2024-07-01 14:45:49 -04:00
Alice Zhao
e9a93a8c5c fix: setTopBrowserView focus issue with reordering (#42653)
* fix: reorder top browser view instead of adding/removing

* fix: update browserViews order

* test: add a test for setTopBrowserView
2024-07-01 11:36:04 +02:00
Keeley Hammond
efff369639 build: remove MacOS x64 from CircleCI (#42718) 2024-07-01 11:34:37 +02:00
Keeley Hammond
3ac57e17d5 build: fix clang format/lint (#42715)
* build: fix clang format path

* fix: use gclient sync instead of gclient runhooks

Refs https://chromium-review.googlesource.com/c/chromium/tools/depot_tools/+/5659261

* fix: use gclient sync instead of gclient runhooks in GHA

---------

Co-authored-by: David Sanders <dsanders11@ucsbalum.com>
2024-06-28 13:30:07 -07:00
Shelley Vohr
398dde9dfb build: use inputs for target_arch in build (#42684) 2024-06-27 08:11:10 -07:00
Shelley Vohr
32e5012017 feat: enable Windows Control Overlay on Linux (#41769) 2024-06-27 14:56:36 +02:00
David Sanders
1d4b00692d build: bump version in .nvmrc to 20 (#42668) 2024-06-27 13:46:11 +02:00
electron-roller[bot]
ec24b51808 chore: bump node to v20.15.0 (main) (#42616)
* chore: bump node in DEPS to v20.15.0

* doc: Add OpenSSL errors to API docs

https://github.com/nodejs/node/pull/34213

* test: crypto-rsa-dsa testing for dynamic openssl

https://github.com/nodejs/node/pull/52781

* src: allow preventing debug signal handler start

https://github.com/nodejs/node/pull/46681

* cli: allow running wasm in limited vmemory with --disable-wasm-trap-handler

https://github.com/nodejs/node/pull/52766

* chore: fixup indices

---------

Co-authored-by: electron-roller[bot] <84116207+electron-roller[bot]@users.noreply.github.com>
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-06-27 13:34:39 +02:00
Shelley Vohr
c628de52d9 fix: defaultPath should apply on all dialog types in Linux Portal (#42655)
fix: defaultPath should apply on all dialog types in Linux Portal dialogs
2024-06-27 11:07:26 +02:00
Shelley Vohr
2b31d8459d fix: param passed to showSaveDialogSync on Linux (#42652)
fix: pass correct param to sync functions on Linux
2024-06-27 10:23:18 +02:00
Keeley Hammond
912706b23a build: strip linux release binaries (#42675) 2024-06-26 17:41:36 -07:00
Samuel Attard
b31acfb706 docs: clarify security semantics of safeStorage (#42666)
* docs: clarify security semantics of safeStorage

* Apply suggestions from code review

Co-authored-by: Erick Zhao <erick@hotmail.ca>

* Update safe-storage.md

* Update safe-storage.md

---------

Co-authored-by: Erick Zhao <erick@hotmail.ca>
2024-06-26 13:24:06 -07:00
Shelley Vohr
607b9b8f11 build: clean up upload-index-json error handling (#42657) 2024-06-26 09:25:58 -07:00
Keeley Hammond
a8baa6f1ad build: remove CircleCI from release pipeline (#42651)
* build: remove CircleCI from release pipeline

* build: remove IS_GHA_RELEASE and CHECK_DIST_MANIFEST
2024-06-25 14:25:04 -07:00
Shelley Vohr
3534923bd2 build: account for subjectAndDescription null in patch linting (#42636)
fix: account for subjectAndDescription null in patch linting
2024-06-24 22:32:43 -07:00
Keeley Hammond
66b8b79229 build: turn on GitHub Actions by default for all branches and pull requests (#42623)
* build: turn GitHub Actions on by default for push and pull_request

* build: try env var build-image-sha

* build: use ternery for input vs default

* build: pain

* build: modify setup to cascade build-image-sha

* build: move outputs into setup step

* build: add SAS key generation on re-run

* build: only build on push, not pull_request

* build: only build on push for main & release branches, build on PR for everything else

* build: rebase with main, handle asan build

* build: add exit 1, sha value
2024-06-24 12:06:13 +02:00
Corbin Crutchley
243be0a638 docs: fix typo in ASAR integrity docs (#42538)
Fix typo in ASAR integrity docs
2024-06-22 20:26:23 +02:00
Charles Kerr
24d6c28b5a chore: remove walkdir dev dependency (#42591) 2024-06-21 10:31:10 -04:00
George Xu
ba8ad4716b feat: expose system preferences to utility process (#42203)
* chore: expose  system preferences to utility process

* chore: add tests, doc changes and module-list update

* relative link

* use @

* fix test

* chore: disable linux test

* kick

* noop on windows utility process
2024-06-20 11:15:57 -04:00
Shelley Vohr
37608933ae fix: fetch-dependent interfaces in Web Workers (#42579) 2024-06-20 11:01:50 -04:00
Keeley Hammond
edb939ae80 build: Add ASan Linux build to Actions build/test (#42545)
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-06-20 12:11:53 +02:00
Milan Burda
003c32331d chore: add/fix interface comments for sections of methods (#42566) 2024-06-20 10:49:07 +02:00
Shelley Vohr
18abeb3add build: re-enable self-cert codesigning on x64 macOS (#42576)
build: re-enable self-cert codesigning
2024-06-19 10:28:07 -04:00
Charles Kerr
dad6e130f5 build: remove fs-extra devdep (#42533)
* build: remove fs-extra dependency from script/gen-filenames.ts

* build: remove fs-extra dependency from script/spec-runner.js

* build: remove fs-extra dependency from script/gn-asar.js

* build: remove fs-extra dependency from spec/api-autoupdater-darwin-spec.ts

* build: remove fs-extra dependency from spec/api-safe-storage-spec.ts

* build: remove fs-extra dependency from spec/lib/codesign-helpers.ts

* build: remove fs-extra dependency from spec/api-app-spec.ts

* build: remove fs-extra dependency from spec/esm-spec.ts

* build: remove fs-extra dependency from spec/lib/fs-helpers.ts

* build: remove fs-extra dependency from spec/lib/api-shell-spec.ts

* build: remove fs-extra dependency from spec/api-context-bridge-spec.ts

* build: remove fs-extra dependency from spec/asar-integrity-spec.ts

* build: remove fs-extra dependency from spec/node-spec.ts

* build: remove fs-extra devdiv

* fixup! build: remove fs-extra dependency from spec/api-context-bridge-spec.ts

* fix: use force: true when removing directories

* chore: reduce diffs to main
2024-06-19 10:10:16 -04:00
Shelley Vohr
8e8ea3ee8b fix: MessagePort closing unexpectedly with non-cloneable objects (#42535)
* fix: MessagePort closing unexpectedly with non-cloneable objects

* fix: handle serialization failure in parentPort
2024-06-19 11:27:07 +02:00
Keeley Hammond
6d2c72b14e build: correct GCLIENT_EXTRA_ARGS in linux-publish (#42575) 2024-06-18 21:54:20 -07:00
Charles Kerr
980e884fa5 build: remove klaw dependency (#42529)
* refactor: remove klaw dependency

Node 20 added recursive readdir() so klaw is not needed

* fixup! refactor: remove klaw dependency

findMatchingFiles returns a Promise<string[]>
2024-06-18 18:54:26 -04:00
Keeley Hammond
71338140a4 build: add symbol_level=1 to GN_BUILDFLAG_ARGS on release (#42571)
* build: add symbol_level=1 to GN_BUILDFLAG_ARGS on release

* build: move to GN_EXTRA_ARGS, remove GN_BUILDFLAG_ARGS
2024-06-18 14:03:53 -07:00
David Sanders
2e4857fbcb ci: auto close non-maintainer PRs that touch lockfiles (#42534) 2024-06-18 15:30:08 -04:00
Robo
29b8fbf419 chore: cherry-pick f8010390 from chromium (#42559) 2024-06-19 01:28:51 +09:00
dependabot[bot]
540a42fb96 build(deps): bump github/codeql-action from 3.25.7 to 3.25.10 (#42540)
Bumps [github/codeql-action](https://github.com/github/codeql-action) from 3.25.7 to 3.25.10.
- [Release notes](https://github.com/github/codeql-action/releases)
- [Changelog](https://github.com/github/codeql-action/blob/main/CHANGELOG.md)
- [Commits](f079b84933...23acc5c183)

---
updated-dependencies:
- dependency-name: github/codeql-action
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-06-18 12:14:56 +02:00
dependabot[bot]
b8512a0cd9 build(deps): bump actions/checkout from 4.1.6 to 4.1.7 (#42539)
Bumps [actions/checkout](https://github.com/actions/checkout) from 4.1.6 to 4.1.7.
- [Release notes](https://github.com/actions/checkout/releases)
- [Changelog](https://github.com/actions/checkout/blob/main/CHANGELOG.md)
- [Commits](a5ac7e51b4...692973e3d9)

---
updated-dependencies:
- dependency-name: actions/checkout
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-06-18 12:14:15 +02:00
Shelley Vohr
86cf60c3f1 chore: improve error message on failed SMApp register/unregister (#42526) 2024-06-18 10:51:37 +02:00
Samuel Attard
e217b063a5 build: fix nan/node tests on GHA (#42548) 2024-06-18 10:49:39 +02:00
John Kleinschmidt
ae88e64c88 test: use longer timeout on contentTracing tests on WOA (#42537) 2024-06-18 10:37:18 +02:00
David Sanders
6d4c2057e4 docs: add backticks around example URL (#42536) 2024-06-17 16:35:26 -07:00
dependabot[bot]
db9742a1ff build(deps): bump mikefarah/yq from 4.44.1 to 4.44.2 (#42541)
Bumps [mikefarah/yq](https://github.com/mikefarah/yq) from 4.44.1 to 4.44.2.
- [Release notes](https://github.com/mikefarah/yq/releases)
- [Changelog](https://github.com/mikefarah/yq/blob/master/release_notes.txt)
- [Commits](557dcb87b8...f15500b20a)

---
updated-dependencies:
- dependency-name: mikefarah/yq
  dependency-type: direct:production
  update-type: version-update:semver-patch
...

Signed-off-by: dependabot[bot] <support@github.com>
Co-authored-by: dependabot[bot] <49699333+dependabot[bot]@users.noreply.github.com>
2024-06-17 16:34:32 -07:00
Samuel Attard
a0a13ad623 build: fix macOS tests on GHA (#42524)
* build: use --frozen-lockfile

* build: don't include src/electron in src artifacts

* Use mac intel runner for mac-x64 tests

* test: debug mac tests not exiting

* skip navigator.serial tests on GHA

* TCC magic

* Fix release notes tests needing ELECTRON_GITHUB_TOKEN

* Add Azure env vars to gn check pipeline segment

* use RO token for tests

* temporarily disable codesign tests

* test: disable LoginItemSettings on x64 macOS

* test: bump up time on protocol test for slower machines

* fixup: use RO token for tests

---------

Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-06-17 16:33:44 -07:00
Shelley Vohr
b35adaee2d build: fix clang format location helper (#42527) 2024-06-17 19:47:59 +02:00
Shelley Vohr
1a4d58a9fb build: run GN Check everywhere (#42515)
* build: run GN Check everywhere

* build: remove gn check matrix

---------

Co-authored-by: Samuel Attard <sam@electronjs.org>
2024-06-17 08:58:29 -07:00
Samuel Attard
2b259bd69e build: de-dupe load build tools into composite action (#42518) 2024-06-17 11:26:18 +02:00
Samuel Attard
a371c2cd54 build: fix GHA arm tests (#42514) 2024-06-16 10:59:51 -07:00
Shelley Vohr
6bf83b389b build: add GN check step (#42508)
* build: add GN check step

* Remove extra loggin

* Fix BUILD_TOOLS_SHA

* Fix concurrency group naming
2024-06-14 15:29:11 -05:00
Samuel Attard
2c985366c8 build: fix dubious ownership error in version bumper spec (#42509) 2024-06-14 13:47:58 -05:00
Keeley Hammond
429d50bb18 build: add production-release environment to publish jobs (#42483)
* build: move publish workflows to use production environment

* build: pass in target_cpu to GN_EXTRA_ARGS on Linux
2024-06-14 11:14:38 -05:00
Keeley Hammond
5b98be3ccb build: add docs-only path gating to GHA (#42499)
* build: add docs only workflow

* build: add path filtering action

* build: add actions/checkout

* build: explicitly set shell to bash -_-

* build: why regex when you could do something much dumber

* build: correct conditionals

* test: (do not merge) add base for testing

* test: remove git base (used for testing)
2024-06-14 11:08:41 -05:00
John Kleinschmidt
5397560ab3 build: adjust concurrency for release branches (#42507)
Co-authored-by: Shelley Vohr <shelley.vohr@gmail.com>
2024-06-14 11:08:21 -05:00
Samuel Attard
c2c3673e8a build: fix linux tests (#42496)
* build: use runuser for electron spec runner

* chown

* run tests in priv

* fixed

* build: setup testing on arm for GHA

* no build-tools for test

* start xvfb for the right user

* no more gn-build-type

* debug env

* ue xvfb-run

* use 8 core for node tests

* build: do test sharding on linux

* fix: disable hung node test

* build: index splits are hard

* build: use --init to reap children

* allow write junit

* use custom xvfb wrapper

* pipefail

* dont kill xvfb, its already dead

---------

Co-authored-by: John Kleinschmidt <jkleinsc@electronjs.org>
2024-06-14 10:57:28 -05:00
Shelley Vohr
c1094013eb build: allow running only mac, lint, or linux (#42504)
build: allow running only mac or linux
2024-06-14 10:08:04 -05:00
Keeley Hammond
8650682c5b build: revert removal of CIPD patch from depot tools (#42500)
Revert "build: remove the CIPD patch from depot tools (#42484)"

This reverts commit a0a8bd2222.
2024-06-14 09:11:30 -05:00
Shelley Vohr
422511753f build: use BUILD_TYPE from env (#42498)
build: use BUILD_TYPE from env
2024-06-14 06:47:18 -05:00
Samuel Attard
9f862af743 build: add lint GHA job (#42494) 2024-06-13 22:14:49 -05:00
John Kleinschmidt
16b2a09787 build: only load SDK for mac builds (#42485) 2024-06-13 17:49:38 -05:00
Keeley Hammond
ad8e89de01 build: fix v8 toolchain for macOS x64 (#42492)
build: do better
2024-06-13 17:14:57 -05:00
Samuel Attard
b7aad14e8d build: run gha on tag not branch (#42490) 2024-06-13 17:14:45 -05:00
Keeley Hammond
c41ded2e89 build: remove gclient-extra-args from publish jobs (#42491)
build: remove gclient-extra-args from publish ymls
2024-06-13 17:11:47 -05:00
Keeley Hammond
4701795dc0 build: fix datetime module for Linux Publish (#42489) 2024-06-13 16:36:45 -05:00
Samuel Attard
cfdc623c4d build: pin and dedupe build image sha (#42488) 2024-06-13 16:35:47 -05:00
Keeley Hammond
9e066e7b74 build: add v8_toolchain to darwin/x64 (#42487)
build: add v8_toolchain to darwin/x64
2024-06-13 16:35:20 -05:00
Shelley Vohr
9fe1b05025 build: upload separate artifact for src files (#42486) 2024-06-13 16:35:13 -05:00
Keeley Hammond
a0a8bd2222 build: remove the CIPD patch from depot tools (#42484)
* build: try to remove the CIPD patch from depot tools

* build: remove cipd patch from GHA
2024-06-13 16:06:16 -05:00
Samuel Attard
b92a4023c1 build: unify pipelines (#42482) 2024-06-13 16:02:38 -05:00
Tomáš Hübelbauer
15c404a3c8 docs: fix the Apple HIG link for Dock context menu (#42450)
Fix the Apple human interface guidelines link for Dock context menu

The link seems to have changed. This is the up to date link.
2024-06-13 15:24:05 -05:00
Shelley Vohr
0affad3be6 build: add several missing test steps for GHA (#42479) 2024-06-13 14:26:20 -05:00
Shelley Vohr
30885e5f9f build: add Linux GHA test step (#42460)
* build: add Linux GHA test step

* Switch to medium AKS runners

* Add missing BUILD_TYPE to restore-artifact

* Fix untar to current dir

* Remove known hosts logic

* Add missing Node.js headers step

* Fix for active SSH sessions

* Fix storing artifacts

* Build on x64 for test
2024-06-13 14:14:33 -05:00
Keeley Hammond
75d0e725be build: fix conditional for sas token (#42481) 2024-06-13 09:43:06 -05:00
Keeley Hammond
42266546eb build: move hunspell generation to Linux (#42480) 2024-06-13 09:37:36 -05:00
Samuel Attard
f72096194f build: reuse checkout steps across mac and linux (#42475) 2024-06-13 09:09:35 -05:00
Samuel Attard
1e219e457b build: generate deps hash quietly (#42476) 2024-06-13 01:43:33 -05:00
Keeley Hammond
a4f201a5f3 build: add needed steps/tweaks to Linux publish job (#42477)
* build: add libcxx to Linux publish

* build: temp change ref to branch

* build: remove hunspell dictionaries

* build: modify release build script for linux

* build: switch back to main
2024-06-12 23:13:17 -05:00
Shelley Vohr
5abefc5dc3 build: use GN_EXTRA_ARGS on macOS (#42473)
* build: use GN_EXTRA_ARGS on macOS

* Switch back to main
2024-06-12 22:12:30 -05:00
Keeley Hammond
9d6c894e89 build: save/restore cache on Linux builds (#42472)
* build: update checkout and cache restore for Linux

* build: clean up variables

* build: temporarily set ref to branch

* build: actually check if cache exists or not and correctly store it

* build: correct cache paths

* build: restore electron_node/deps/v8

* build: restore sha to @main, not branch

* build: remove cache_key and use $DEPSHASH

* build: remove sas, backup_cache logic

* build: revert openssl deletion
2024-06-12 17:41:07 -05:00
Samuel Attard
08bd588e71 build: use dynamic RO sas token provided by sas-sidecar (#42470) 2024-06-12 16:04:28 -05:00
Shelley Vohr
2afe657873 build: cleanup to macos pipeline (#42445)
* build: cleanup to macos pipeline

* Fix generated artifact key finding

* Fix cache restore key

* Switch ref to main

* Use artifacts for build artifact persisting

* Fix TARGET_ARCH env var in test

* Remove npm install
2024-06-12 14:58:47 -05:00
Mark Lee
1d2f2eb113 docs(web-embeds): replace BrowserView ref with WebContentsView (#42416) 2024-06-12 14:55:06 -05:00
Keeley Hammond
f6a9c55907 build: remove unneeded installs/secrets (#42467)
build: remove unneeded azure installs/secrets
2024-06-12 14:53:18 -05:00
Keeley Hammond
1cb63b4d77 build: use the linux aks for macos checkout/cache (#42447)
* build: use the linux aks for checkout/cache

* build: use latest container sha

* build: persist the AKS cache (first try)

* build (do not merge): use current branch for workflows

* build: do not check for existing cache

* build: try to move src into /var/portal

* build: add AZURE_AKS_CACHE_SHARE_NAME & AZURE_AKS_CACHE_STORAGE_ACCOUNT

* build: add volumes: /mnt/cross-instance-cache

* build: temporarily skip cache exists checks

* build: reset to aks-linux-large, upload/download tar

* build: pass detailed credentials into download

* build: be better

* build: add skip if cache exists, declare env vars earlier

* build: add quotes

* build: change to connection-string

* build: remove connection string

* build: migrate to azcopy

* build: lol

* build: revert ref to @main
2024-06-12 14:21:19 -05:00
Shelley Vohr
ffe1d70f1d build: add Linux GHA build step (#42432)
Co-authored-by: Keeley Hammond <khammond@slack-corp.com>
2024-06-12 14:16:49 -05:00
1807 changed files with 96230 additions and 48895 deletions

1
.claude/.gitignore vendored Normal file
View File

@@ -0,0 +1 @@
settings.local.json

24
.claude/settings.json Normal file
View File

@@ -0,0 +1,24 @@
{
"permissions": {
"allow": [
"Bash(e sync)",
"Bash(e patches --list-targets:*)",
"Bash(git add:*)",
"Bash(git am:*)",
"Bash(git commit:*)",
"Bash(git log:*)",
"Bash(git show:*)",
"Bash(e patches:*)",
"Bash(e sync:*)",
"Skill(electron-chromium-upgrade)",
"Read(*)",
"Bash(echo:*)",
"Bash(e build:*)",
"Bash(tee:*)",
"Bash(git diff:*)",
"Bash(git rev-parse:*)"
],
"deny": [],
"ask": []
}
}

View File

@@ -0,0 +1,184 @@
---
name: electron-chromium-upgrade
description: Guide for performing Chromium version upgrades in the Electron project. Use when working on the roller/chromium/main branch to fix patch conflicts during `e sync --3`. Covers the patch application workflow, conflict resolution, analyzing upstream Chromium changes, and proper commit formatting for patch fixes.
---
# Electron Chromium Upgrade: Phase One
## Summary
Run `e sync --3` repeatedly, fixing patch conflicts as they arise, until it succeeds. Then export patches and commit changes atomically.
## Success Criteria
Phase One is complete when:
- `e sync --3` exits with code 0 (no patch failures)
- All changes are committed per the commit guidelines
Do not stop until these criteria are met.
**CRITICAL** Do not delete or skip patches unless 100% certain the patch is no longer needed. Complicated conflicts or hard to resolve issues should be presented to the user after you have exhausted all other options. Do not delete the patch just because you can't solve it.
**CRITICAL** Never use `git am --skip` and then manually recreate a patch by making a new commit. This destroys the original patch's authorship, commit message, and position in the series. If `git am --continue` reports "No changes", investigate why — the changes were likely absorbed by a prior conflict resolution's 3-way merge. Present this situation to the user rather than skipping and recreating.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (where most patches apply)
- `patches/`: Patch files organized by target
- `docs/development/patches.md`: Patch system documentation
## Pre-flight Checks
Run these once at the start of each upgrade session:
1. **Clear rerere cache** (if enabled): `git rerere clear` in both the electron and `..` repos. Stale recorded resolutions from a prior attempt can silently apply wrong merges.
2. **Ensure pre-commit hooks are installed**: Check that `.git/hooks/pre-commit` exists. If not, run `yarn husky` to install it. The hook runs `lint-staged` which handles clang-format for C++ files.
## Workflow
1. Run `e sync --3` (the `--3` flag enables 3-way merge, always required)
2. If succeeds → skip to step 5
3. If patch fails:
- Identify target repo and patch from error output
- Analyze failure (see references/patch-analysis.md)
- Fix conflict in target repo's working directory
- Run `git am --continue` in affected repo
- Repeat until all patches for that repo apply
- IMPORTANT: Once `git am --continue` succeeds you MUST run `e patches {target}` to export fixes
- Return to step 1
4. When `e sync --3` succeeds, run `e patches all`
5. **Read `references/phase-one-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e sync --3` | Clone deps and apply patches with 3-way merge |
| `git am --continue` | Continue after resolving conflict (run in target repo) |
| `e patches {target}` | Export commits from target repo to patch files |
| `e patches all` | Export all patches from all targets |
| `e patches {target} --commit-updates` | Export patches and auto-commit trivial changes |
| `e patches --list-targets` | List targets and config paths |
## Patch System Mental Model
```
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
## When to Edit Patches
| Situation | Action |
|-----------|--------|
| During active `git am` conflict | Fix in target repo, then `git am --continue` |
| Modifying patch outside conflict | Edit `.patch` file directly |
| Creating new patch (rare, avoid) | Commit in target repo, then `e patches {target}` |
Fix existing patches 99% of the time rather than creating new ones.
## Patch Fixing Rules
1. **Preserve authorship**: Keep original author in TODO comments (from patch `From:` field)
2. **Never change TODO assignees**: `TODO(name)` must retain original name
3. **Update descriptions**: If upstream changed (e.g., `DCHECK``CHECK_IS_TEST`), update patch commit message to reflect current state
4. **Never skip-and-recreate a patch**: If `git am --continue` says "No changes — did you forget to use 'git add'?", do NOT run `git am --skip` and create a replacement commit. The patch's changes were already absorbed by a prior 3-way merge resolution. This means an earlier conflict resolution pulled in too many changes. Present the situation to the user for guidance — the correct fix may require re-doing an earlier resolution more carefully to keep each patch's changes separate.
# Electron Chromium Upgrade: Phase Two
## Summary
Run `e build -k 999 -- --quiet` repeatedly, fixing build issues as they arise, until it succeeds. Then run `e start --version` to validate Electron launches and commit changes atomically.
Run Phase Two immediately after Phase One is complete.
## Success Criteria
Phase Two is complete when:
- `e build -k 999 -- --quiet` exits with code 0 (no build failures)
- `e start --version` has been run to check Electron launches
- All changes are committed per the commit guidelines
Do not stop until these criteria are met. Do not delete code or features, never comment out code in order to take short cut. Make all existing code, logic and intention work.
## Context
The `roller/chromium/main` branch is created by automation to update Electron's Chromium dependency SHA. No work has been done to handle breaking changes between the old and new versions. Chromium APIs frequently are renamed or refactored. In every case the code in Electron must be updated to account for the change in Chromium, strongly avoid making changes to the code in chromium to fix Electrons build.
**Key directories:**
- Current directory: Electron repo (always run `e` commands here)
- `..` (parent): Chromium repo (do not touch this code to fix build issues, just read it to obtain context)
## Workflow
1. Run `e build -k 999 -- --quiet` (the `--quiet` flag suppresses per-target status lines, showing only errors and the final result)
2. If succeeds → skip to step 6
3. If build fails:
- Identify underlying file in "electron" from the compilation error message
- Analyze failure
- Fix build issue by adapting Electron's code for the change in Chromium
- Run `e build -t {target_that_failed}.o` to build just the failed target we were specifically fixing
- You can identify the target_that_failed from the failure line in the build log. E.g. `FAILED: 2e506007-8d5d-4f38-bdd1-b5cd77999a77 "./obj/electron/chromium_src/chrome/process_singleton_posix.o" CXX obj/electron/chromium_src/chrome/process_singleton_posix.o` the target name is `obj/electron/chromium_src/chrome/process_singleton_posix.o`
- **Read `references/phase-two-commit-guidelines.md` NOW**, then commit changes following those instructions exactly.
- Return to step 1
4. **CRITICAL**: After ANY commit (especially patch commits), immediately run `git status` in the electron repo
- Look for other modified `.patch` files that only have index/hunk header changes
- These are dependent patches affected by your fix
- Commit them immediately with: `git commit -am "chore: update patches (trivial only)"`
5. Return to step 1
6. When `e build` succeeds, run `e start --version`
7. Check if you have any pending changes in the Chromium repo by running `git status`
- If you have changes follow the instructions below in "A. Patch Fixes" to correctly commit those modifications into the appropriate patch file
## Commands Reference
| Command | Purpose |
|---------|---------|
| `e build -k 999 -- --quiet` | Build Electron, continue on errors, suppress status lines |
| `e build -t {target}.o` | Build just one specific target to verify a fix |
| `e start --version` | Validate Electron launches after successful build |
## Two Types of Build Fixes
### A. Patch Fixes (for files in chromium_src or patched Chromium files)
When the error is in a file that Electron patches (check with `grep -l "filename" patches/chromium/*.patch`):
1. Edit the file in the Chromium source tree (e.g., `/src/chrome/browser/...`)
2. Create a fixup commit targeting the original patch commit:
```bash
cd .. # to chromium repo
git add <modified-file>
git commit --fixup=<original-patch-commit-hash>
GIT_SEQUENCE_EDITOR=: git rebase --autosquash --autostash -i <commit>^
```
3. Export the updated patch: `e patches chromium`
4. Commit the updated patch file following `references/phase-one-commit-guidelines.md`.
To find the original patch commit to fixup: `git log --oneline | grep -i "keyword from patch name"`
The base commit for rebase is the Chromium commit before patches were applied. Find it by checking the `refs/patches/upstream-head` ref.
### B. Electron Code Fixes (for files in shell/, electron/, etc.)
When the error is in Electron's own source code:
1. Edit files directly in the electron repo
2. Commit directly (no patch export needed)
# Critical: Read Before Committing
- Before ANY Phase One commits: Read `references/phase-one-commit-guidelines.md`
- Before ANY Phase Two commits: Read `references/phase-two-commit-guidelines.md`
# Skill Directory Structure
This skill has additional reference files in `references/`:
- patch-analysis.md - How to analyze patch failures
- phase-one-commit-guidelines.md - Commit format for Phase One
- phase-two-commit-guidelines.md - Commit format for Phase Two
Read these when referenced in the workflow steps.

View File

@@ -0,0 +1,119 @@
# Analyzing Patch Failures
## Investigation Steps
1. **Read the patch file** at `patches/{target}/{patch_name}.patch`
2. **Examine current state** of the file in Chromium at mentioned line numbers
3. **Check recent upstream changes:**
```bash
cd .. # or relevant target repo
git log --oneline -10 -- {file}
```
4. **Find Chromium CL** in commit messages:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/{CL_NUMBER}
```
## Critical: Resolve by Intent, Not by Mechanical Merge
When resolving a patch conflict, do NOT blindly preserve the patch's old code. Instead:
1. **Understand the upstream CL's full scope** — not just the conflicting hunk.
Run `git show <commit> --stat` and read diffs for all affected files.
Upstream may have removed structs, members, or methods that the patch
references in other hunks or files.
2. **Re-read the patch commit message** to understand its *intent* — what
behavior does it need to preserve or add?
3. **Implement the intent against the new upstream code.** If the patch's
purpose is "add a feature flag guard", add only the guard — don't also
restore old code inside the guard that upstream separately removed.
### Lesson: Upstream Removals Break Patch References
- **Trigger:** Patch conflict involves an upstream refactor (not just context drift)
- **Strategy:** After identifying the upstream CL, check its full diff for
removed types, members, and methods. If the patch's old code references
something removed, the resolution must use the new upstream mechanism.
- **Evidence:** An upstream CL removed a `HeadlessModeWindow` struct from a
header, but the conflict was only in a `.mm` file. Mechanically keeping the
patch's old line (`headless_mode_window_ = ...`) produced code referencing
a nonexistent type — caught only on review, not at patch-apply time.
### Lesson: Separate Patch Purpose from Patch Implementation
- **Trigger:** Conflict between "upstream simplified code" vs "patch has older code"
- **Strategy:** Identify the *minimal* change the patch needs. If the patch
wraps code in a conditional, only add the conditional — don't restore old
code that was inside the conditional but was separately cleaned up upstream.
- **Evidence:** An occlusion patch needed only a feature flag check, but the
old patch also contained a version check that upstream intentionally removed.
Mechanically preserving the old patch code re-added the removed check.
### Lesson: Finish the Adaptation at Conflict Time
- **Trigger:** A patch conflict involves an upstream API removal or replacement
- **Strategy:** When resolving the conflict, fully adapt the patch to use the
new API in the same commit. Don't remove the old code and leave behind stale
references that will "be fixed in Phase Two." Each patch fix commit should be
a complete resolution.
- **Evidence:** A safestorage patch conflicted because Chromium removed Keychain V1.
The conflict was resolved by removing V1 hunks, but the remaining code still
called V1 methods (`FindGenericPassword` with 3 args, `ItemDelete` with
`SecKeychainItemRef`). These should have been adapted to V2 APIs in the same
commit, not deferred.
## Common Failure Patterns
| Pattern | Cause | Solution |
|---------|-------|----------|
| Context lines don't match | Surrounding code changed | Update context in patch |
| File not found | File renamed/moved | Update patch target path |
| Function not found | Refactored upstream | Find new function name |
| `DCHECK` → `CHECK_IS_TEST` | Macro change | Update to new macro |
| Deleted code | Feature removed | Verify patch still needed |
## Using Git Blame
To find the CL that changed specific lines:
```bash
cd ..
git blame -L {start},{end} -- {file}
git log -1 {commit_sha} # Look for Reviewed-on: line
```
## Verifying Patch Necessity
Before deleting a patch, verify:
1. The patched functionality was intentionally removed upstream
2. Electron doesn't need the patch for other reasons
3. No other code depends on the patched behavior
When in doubt, keep the patch and adapt it.
## Phase Two: Build-Time Patch Issues
Sometimes patches that applied successfully in Phase One cause build errors in Phase Two. This can happen when:
1. **Incomplete types**: A patch disables a header include, but new upstream code uses the type
2. **Missing members**: A patch modifies a class, but upstream added new code referencing the original
### Finding Which Patch Affects a File
```bash
grep -l "filename.cc" patches/chromium/*.patch
```
Matching Existing Patch Patterns
When fixing build errors in patched files, examine the existing patch to understand its style:
- Does it use #if 0 / #endif guards?
- Does it use #if BUILDFLAG(...) conditionals?
- What's the pattern for disabled functionality?
Apply fixes consistent with the existing patch style.

View File

@@ -0,0 +1,102 @@
# Phase One Commit Guidelines
Only follow these instructions if there are uncommitted changes to `patches/` after Phase One succeeds.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Each Commit Must Be Complete
When resolving a patch conflict, fully adapt the patch to the new upstream code in the same commit. If the upstream change removes an API the patch uses, update the patch to use the replacement API now — don't leave stale references knowing they'll need fixing later. The goal is that each commit represents a finished resolution, not a partial one that defers known work to a future phase.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
### Patch conflict fixes
Use `fix(patch):` prefix. The title should name the upstream change, not your response to it:
```
fix(patch): {topic headline}
Ref: {Chromium CL link}
Co-Authored-By: <AI model attribution>
```
Only add a description body if it provides clarity beyond the title. For straightforward context drift or simple API renames, the title + Ref is sufficient.
Examples:
- `fix(patch): constant moved to header`
- `fix(patch): headless mode refactor upstream`
- `fix(patch): V1 Keychain removal`
### Upstreamed patch removal
When patches are no longer needed (applied cleanly with "already applied" or confirmed upstreamed), group ALL removals into a single commit:
```
chore: remove upstreamed patch
```
or (if multiple):
```
chore: remove upstreamed patches
```
If the patch file did NOT contain a `Reviewed-on: https://chromium-review.googlesource.com/c/chromium/...` link, add a `Ref:` in the commit. If it did (i.e. cherry-picks), no `Ref:` is needed.
### Trivial patch updates
After all fix commits, stage remaining trivial changes (index, line numbers, context only):
```bash
git add patches
git commit -m "chore: update patches (trivial only)"
```
**Conflict resolution can produce trivial results.** A `git am` conflict doesn't always mean the patch content changed — context drift alone can cause a conflict. After resolving and exporting, inspect the patch diff: if only index hashes, line numbers, and context lines changed (not the patch's own `+`/`-` lines), it's trivial and belongs here, not in a `fix(patch):` commit.
## Atomic Commits
Each patch conflict fix gets its own commit with its own Ref.
IMPORTANT: Try really hard to find the CL reference per the instructions below. Each change you made should in theory have been in response to a change made in Chromium that you identified or can identify. Try for a while to identify and include the ref in the commit message. Do not give up easily.
## Finding CL References
Use `git log` or `git blame` on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Example Commits
### Patch conflict fix (simple — title is sufficient)
```
fix(patch): constant moved to header
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7536483
Co-Authored-By: <AI model attribution>
```
### Patch conflict fix (complex — description adds value)
```
fix(patch): V1 Keychain removal
Upstream deleted the V1 Keychain API. Removed V1 hunks and adapted
keychain_password_mac.mm to use KeychainV2 APIs.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7540447
Co-Authored-By: <AI model attribution>
```

View File

@@ -0,0 +1,84 @@
# Phase Two Commit Guidelines
Only follow these instructions if there are uncommitted changes in the Electron repo after any fixes are made during Phase Two that result a target that was failing, successfully building.
Ignore other instructions about making commit messages, our guidelines are CRITICALLY IMPORTANT and must be followed.
## Commit Message Style
**Titles** follow the 60/80-character guideline: simple changes fit within 60 characters, otherwise the limit is 80 characters. Exception: upstream Chromium CL titles are used verbatim even if longer.
Always include a `Co-Authored-By` trailer identifying the AI model that assisted (e.g., `Co-Authored-By: <AI model attribution>`).
## Two Commit Types
### For Electron Source Changes (shell/, electron/, etc.)
```
{CL-Number}: {upstream CL's original title}
Ref: {Chromium CL link}
Co-Authored-By: <AI model attribution>
```
Use the **upstream CL's original commit title** — do not paraphrase or rewrite it. To find it: `git log -1 --format=%s <chromium-commit-hash>`.
Only add a description body if it provides clarity beyond what the title already says (e.g., when Electron's adaptation is non-obvious). For simple renames, method additions, or straightforward API updates, the title + Ref link is sufficient.
Each change should have its own commit and its own Ref. Logically group into commits that make sense rather than one giant commit. You may include multiple "Ref" links if required.
For a CL link in the format `https://chromium-review.googlesource.com/c/chromium/src/+/2958369` the "CL-Number" is `2958369`.
IMPORTANT: Try really hard to find the CL reference. Each change you made should in theory have been in response to a change in Chromium. Do not give up easily.
### For Patch Updates (patches/chromium/*.patch)
Use the same fixup workflow as Phase One and follow `references/phase-one-commit-guidelines.md` for the commit message format (`fix(patch):` prefix, topic style).
## Dependent Patch Header Updates
After any patch modification, check for other affected patches:
```bash
git status
# If other .patch files show as modified with only index, line number, and context changes:
git add patches/
git commit -m "chore: update patches (trivial only)"
```
## Finding CL References
Use git log or git blame on Chromium source files. Look for:
```
Reviewed-on: https://chromium-review.googlesource.com/c/chromium/src/+/XXXXXXX
```
If no CL found after searching: `Ref: Unable to locate CL`
## Example Commits
### Electron Source Fix (simple — title is self-explanatory)
```
7535923: Rename ozone buildflags
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7535923
Co-Authored-By: <AI model attribution>
```
### Electron Source Fix (complex — description adds value)
```
7534194: Convert some functions in ui::Clipboard to async
Adapted ExtractCustomPlatformNames calls to use RunLoop pattern
consistent with existing ReadImage implementation, since upstream
converted the API from synchronous return to callback-based.
Ref: https://chromium-review.googlesource.com/c/chromium/src/+/7534194
Co-Authored-By: <AI model attribution>
```

View File

@@ -25,9 +25,19 @@ Codespaces doesn't lean very well into gclient based checkouts, the directory st
/workspaces/electron
```
## Goma
## Reclient
If you are a maintainer [with Goma access](../docs/development/goma.md) it should be automatically configured and authenticated when you spin up a new codespaces instance. You can validate this by checking `e d goma_auth info` or by checking that your build-tools configuration has a goma mode of `cluster`.
If you are a maintainer [with Reclient access](../docs/development/reclient.md) you'll need to ensure you're authenticated when you spin up a new codespaces instance. You can validate this by checking `e d rbe info` - your build-tools configuration should have `Access` type `Cache & Execute`:
```console
Authentication Status: Authenticated
Since: 2024-05-28 10:29:33 +0200 CEST
Expires: 2024-08-26 10:29:33 +0200 CEST
...
Access: Cache & Execute
```
To authenticate if you're not logged in, run `e d rbe login` and follow the link to authenticate.
## Running Electron

View File

@@ -1,4 +1,5 @@
{
"name": "Electron Core Development Environment",
"dockerComposeFile": "docker-compose.yml",
"service": "buildtools",
"onCreateCommand": ".devcontainer/on-create-command.sh",
@@ -33,27 +34,15 @@
"surajbarkale.ninja",
"ms-vscode.cpptools",
"mutantdino.resourcemonitor",
"dsanders11.vscode-electron-build-tools",
"dbaeumer.vscode-eslint",
"shakram02.bash-beautify",
"marshallofsound.gnls-electron",
"marshallofsound.gnls-electron"
],
"settings": {
"editor.tabSize": 2,
"bashBeautify.tabSize": 2,
"typescript.tsdk": "node_modules/typescript/lib",
"[gn]": {
"editor.formatOnSave": true
},
"[javascript]": {
"editor.codeActionsOnSave": {
"source.fixAll.eslint": true
}
},
"[typescript]": {
"editor.codeActionsOnSave": {
"source.fixAll.eslint": true
}
},
"javascript.preferences.quoteStyle": "single",
"typescript.preferences.quoteStyle": "single"
}

View File

@@ -2,7 +2,7 @@ version: '3'
services:
buildtools:
image: ghcr.io/electron/devcontainer:77262e58c37631ab082482f42c33cdf68c6c394b
image: ghcr.io/electron/devcontainer:eac3529546ea8f3aa356d31e345715eef342233b
volumes:
- ..:/workspaces/gclient/src/electron:cached

View File

@@ -48,7 +48,8 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
\"gen\": {
\"args\": [
\"import(\\\"//electron/build/args/testing.gn\\\")\",
\"use_remoteexec = true\"
\"use_remoteexec = true\",
\"use_siso=true\"
],
\"out\": \"Testing\"
},
@@ -58,14 +59,13 @@ if [ ! -f $buildtools/configs/evm.testing.json ]; then
},
\"\$schema\": \"file:///home/builduser/.electron_build_tools/evm-config.schema.json\",
\"configValidationLevel\": \"strict\",
\"reclient\": \"$1\",
\"goma\": \"none\",
\"preserveXcode\": 5
\"remoteBuild\": \"siso\",
\"preserveSDK\": 5
}
" >$buildtools/configs/evm.testing.json
}
write_config remote_exec
write_config
e use testing
else

View File

@@ -1,5 +1,4 @@
# These env vars are only necessary for creating Electron releases.
# See docs/development/releasing.md
APPVEYOR_CLOUD_TOKEN=
ELECTRON_GITHUB_TOKEN=

3
.gitattributes vendored
View File

@@ -1,6 +1,9 @@
# `git apply` and friends don't understand CRLF, even on windows. Force those
# files to be checked out with LF endings even if core.autocrlf is true.
*.patch text eol=lf
DEPS text eol=lf
yarn.lock text eol=lf
script/zip_manifests/*.manifest text eol=lf
patches/**/.patches merge=union
# Source code and markdown files should always use LF as line ending.

9
.github/CODEOWNERS vendored
View File

@@ -11,12 +11,15 @@ DEPS @electron/wg-upgrades
/docs/breaking-changes.md @electron/wg-releases
/npm/ @electron/wg-releases
/script/release @electron/wg-releases
appveyor.yml @electron/wg-releases
appveyor-bake.yml @electron/wg-releases
appveyor-woa.yml @electron/wg-releases
# Security WG
/lib/browser/devtools.ts @electron/wg-security
/lib/browser/guest-view-manager.ts @electron/wg-security
/lib/browser/rpc-server.ts @electron/wg-security
/lib/renderer/security-warnings.ts @electron/wg-security
# Infra WG
/.github/actions/ @electron/wg-infra
/.github/workflows/*-publish.yml @electron/wg-infra
/.github/workflows/build.yml @electron/wg-infra
/.github/workflows/pipeline-*.yml @electron/wg-infra

View File

@@ -1,6 +1,6 @@
name: Bug Report
description: Report an Electron bug
title: "[Bug]: "
description: Report a bug in Electron
type: 'bug'
labels: "bug :beetle:"
body:
- type: checkboxes
@@ -20,13 +20,14 @@ body:
description: |
What version of Electron are you using?
Note: Please only report issues for [currently supported versions of Electron](https://www.electronjs.org/docs/latest/tutorial/support#currently-supported-versions).
placeholder: 17.0.0
Note: Please only report issues for [currently supported versions of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline).
placeholder: 32.0.0
validations:
required: true
- type: dropdown
attributes:
label: What operating system are you using?
label: What operating system(s) are you using?
multiple: true
options:
- Windows
- macOS
@@ -57,6 +58,16 @@ body:
label: Last Known Working Electron version
description: What is the last version of Electron this worked in, if applicable?
placeholder: 16.0.0
- type: dropdown
attributes:
label: Does the issue also appear in Chromium / Google Chrome?
description: If it does, please report the issue in the [Chromium issue tracker](https://issues.chromium.org/issues), not against Electron. Electron will inherit the fix once Chromium resolves the issue.
options:
- I don't know how to test
- "Yes"
- "No"
validations:
required: true
- type: textarea
attributes:
label: Expected Behavior
@@ -72,7 +83,7 @@ body:
- type: input
attributes:
label: Testcase Gist URL
description: If you can reproduce the issue in a standalone test case, please use [Electron Fiddle](https://github.com/electron/fiddle) to create one and to publish it as a [GitHub gist](https://gist.github.com) and put the gist URL here. This is **the best way** to ensure this issue is triaged quickly.
description: Electron maintainers need a standalone test case to reproduce and fix your issue. Please use [Electron Fiddle](https://github.com/electron/fiddle) to create one and to publish it as a [GitHub gist](https://gist.github.com). Then put the gist URL here. Issues without testcase gists receive less attention and might be closed without a maintainer taking a closer look. To maximize how much attention your issue receives, please include a testcase gist right from the start.
placeholder: https://gist.github.com/...
- type: textarea
attributes:

View File

@@ -1,3 +1,4 @@
blank_issues_enabled: false
contact_links:
- name: Discord Chat
url: https://discord.gg/APGC3k5yaH

View File

@@ -1,6 +1,6 @@
name: Feature Request
description: Suggest an idea for Electron
title: "[Feature Request]: "
type: 'enhancement'
labels: "enhancement :sparkles:"
body:
- type: checkboxes

View File

@@ -0,0 +1,14 @@
name: Maintainer Issue (not for public use)
description: Only to be created by Electron maintainers
body:
- type: checkboxes
attributes:
label: Confirmation
options:
- label: I am a [maintainer](https://github.com/orgs/electron/people) of the Electron project. (If not, please create a [different issue type](https://github.com/electron/electron/issues/new/).)
required: true
- type: textarea
attributes:
label: Description
validations:
required: true

View File

@@ -10,10 +10,11 @@ Contributors guide: https://github.com/electron/electron/blob/main/CONTRIBUTING.
#### Checklist
<!-- Remove items that do not apply. For completed items, change [ ] to [x]. -->
- [ ] PR description included and stakeholders cc'd
- [ ] PR description included
- [ ] I have built and tested this PR
- [ ] `npm test` passes
- [ ] tests are [changed or added](https://github.com/electron/electron/blob/main/docs/development/testing.md)
- [ ] relevant documentation, tutorials, templates and examples are changed or added
- [ ] relevant API documentation, tutorials, and examples are updated and follow the [documentation style guide](https://github.com/electron/electron/blob/main/docs/development/style-guide.md)
- [ ] [PR release notes](https://github.com/electron/clerk/blob/main/README.md) describe the change in a way relevant to app developers, and are [capitalized, punctuated, and past tense](https://github.com/electron/clerk/blob/main/README.md#examples).
#### Release Notes

View File

@@ -5,10 +5,10 @@ inputs:
description: 'Target arch'
required: true
target-platform:
description: 'Target platform'
description: 'Target platform, should be linux, win, macos'
required: true
artifact-platform:
description: 'Artifact platform, should be linux, darwin or mas'
description: 'Artifact platform, should be linux, win, darwin or mas'
required: true
step-suffix:
description: 'Suffix for build steps'
@@ -17,9 +17,6 @@ inputs:
is-release:
description: 'Is release build'
required: true
strip-binaries:
description: 'Strip binaries (Linux only)'
required: false
generate-symbols:
description: 'Generate symbols'
required: true
@@ -29,6 +26,9 @@ inputs:
is-asan:
description: 'The ASan Linux build'
required: false
upload-out-gen-artifacts:
description: 'Whether to upload the out/${dir}/gen artifacts'
required: false
runs:
using: "composite"
steps:
@@ -38,7 +38,17 @@ runs:
run: |
GN_APPENDED_ARGS="$GN_EXTRA_ARGS target_cpu=\"x64\" v8_snapshot_toolchain=\"//build/toolchain/mac:clang_x64\""
echo "GN_EXTRA_ARGS=$GN_APPENDED_ARGS" >> $GITHUB_ENV
- name: Set GN_EXTRA_ARGS for Windows
shell: bash
if: ${{inputs.target-arch != 'x64' && inputs.target-platform == 'win' }}
run: |
GN_APPENDED_ARGS="$GN_EXTRA_ARGS target_cpu=\"${{ inputs.target-arch }}\""
echo "GN_EXTRA_ARGS=$GN_APPENDED_ARGS" >> $GITHUB_ENV
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Build Electron ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
rm -rf "src/out/Default/Electron Framework.framework"
@@ -54,35 +64,63 @@ runs:
sudo launchctl limit maxfiles 65536 200000
fi
NINJA_SUMMARIZE_BUILD=1 e build -j $NUMBER_OF_NINJA_PROCESSES
if [ "${{ inputs.is-release }}" = "true" ]; then
NINJA_SUMMARIZE_BUILD=1 e build --target electron:release_build
else
NINJA_SUMMARIZE_BUILD=1 e build --target electron:testing_build
fi
cp out/Default/.ninja_log out/electron_ninja_log
node electron/script/check-symlinks.js
- name: Strip Electron Binaries ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.strip-binaries == 'true' }}
# Upload build stats to Datadog
if ! [ -z $DD_API_KEY ]; then
npx node electron/script/build-stats.mjs out/Default/siso.INFO --upload-stats || true
else
echo "Skipping build-stats.mjs upload because DD_API_KEY is not set"
fi
- name: Build Electron (Windows) ${{ inputs.step-suffix }}
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
cd src
electron/script/copy-debug-symbols.py --target-cpu="${{ inputs.target-arch }}" --out-dir=out/Default/debug --compress
electron/script/strip-binaries.py --target-cpu="${{ inputs.target-arch }}" --verbose
electron/script/add-debug-link.py --target-cpu="${{ inputs.target-arch }}" --debug-dir=out/Default/debug
- name: Build Electron dist.zip ${{ inputs.step-suffix }}
cd src\electron
git pack-refs
cd ..
$env:NINJA_SUMMARIZE_BUILD = 1
if ("${{ inputs.is-release }}" -eq "true") {
e build --target electron:release_build
} else {
e build --target electron:testing_build
}
Copy-Item out\Default\.ninja_log out\electron_ninja_log
node electron\script\check-symlinks.js
# Upload build stats to Datadog
if ($env:DD_API_KEY) {
try {
npx node electron\script\build-stats.mjs out\Default\siso.exe.INFO --upload-stats ; $LASTEXITCODE = 0
} catch {
Write-Host "Build stats upload failed, continuing..."
}
} else {
Write-Host "Skipping build-stats.mjs upload because DD_API_KEY is not set"
}
- name: Verify dist.zip ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_dist_zip -j $NUMBER_OF_NINJA_PROCESSES
cd src
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'linux' && 'linux' || 'mac'}}
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
target_os="${target_os}_mas"
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip electron/script/zip_manifests/dist_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Build Mksnapshot ${{ inputs.step-suffix }}
- name: Fixup Mksnapshot ${{ inputs.step-suffix }}
shell: bash
run: |
cd src
e build --target electron:electron_mksnapshot -j $NUMBER_OF_NINJA_PROCESSES
gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
ELECTRON_DEPOT_TOOLS_DISABLE_LOG=1 e d gn desc out/Default v8:run_mksnapshot_default args > out/Default/mksnapshot_args
# Remove unused args from mksnapshot_args
SEDOPTION="-i"
if [ "`uname`" = "Darwin" ]; then
@@ -90,23 +128,16 @@ runs:
fi
sed $SEDOPTION '/.*builtins-pgo/d' out/Default/mksnapshot_args
sed $SEDOPTION '/--turbo-profiling-input/d' out/Default/mksnapshot_args
sed $SEDOPTION '/The gn arg use_goma=true .*/d' out/Default/mksnapshot_args
if [ "`uname`" = "Linux" ]; then
if [ "${{ inputs.target-arch }}" = "arm" ]; then
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x86_v8_arm/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x86_v8_arm/v8_context_snapshot_generator
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x64_v8_arm64/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/clang_x64_v8_arm64/v8_context_snapshot_generator
else
electron/script/strip-binaries.py --file $PWD/out/Default/mksnapshot
electron/script/strip-binaries.py --file $PWD/out/Default/v8_context_snapshot_generator
fi
if [ "${{ inputs.target-platform }}" = "win" ]; then
cd out/Default
powershell Compress-Archive -update mksnapshot_args mksnapshot.zip
powershell mkdir mktmp\\gen\\v8
powershell Copy-Item gen\\v8\\embedded.S mktmp\\gen\\v8
powershell Compress-Archive -update -Path mktmp\\gen mksnapshot.zip
else
(cd out/Default; zip mksnapshot.zip mksnapshot_args gen/v8/embedded.S)
fi
e build --target electron:electron_mksnapshot_zip -j $NUMBER_OF_NINJA_PROCESSES
(cd out/Default; zip mksnapshot.zip mksnapshot_args gen/v8/embedded.S)
- name: Generate Cross-Arch Snapshot (arm/arm64) ${{ inputs.step-suffix }}
shell: bash
if: ${{ (inputs.target-arch == 'arm' || inputs.target-arch == 'arm64') && inputs.target-platform == 'linux' }}
@@ -131,24 +162,39 @@ runs:
shell: bash
run: |
cd src
e build --target electron:electron_chromedriver -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:electron_chromedriver_zip
- name: Build Node.js headers ${{ inputs.step-suffix }}
shell: bash
if [ "${{ inputs.is-asan }}" != "true" ]; then
target_os=${{ inputs.target-platform == 'macos' && 'mac' || inputs.target-platform }}
if [ "${{ inputs.artifact-platform }}" = "mas" ]; then
target_os="${target_os}_mas"
fi
electron/script/zip_manifests/check-zip-manifest.py out/Default/chromedriver.zip electron/script/zip_manifests/chromedriver_zip.$target_os.${{ inputs.target-arch }}.manifest
fi
- name: Create installed_software.json ${{ inputs.step-suffix }}
shell: powershell
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
run: |
cd src
e build --target electron:node_headers
- name: Generate & Zip Symbols ${{ inputs.step-suffix }}
Get-CimInstance -Namespace root\cimv2 -Class Win32_product | Select vendor, description, @{l='install_location';e='InstallLocation'}, @{l='install_date';e='InstallDate'}, @{l='install_date_2';e='InstallDate2'}, caption, version, name, @{l='sku_number';e='SKUNumber'} | ConvertTo-Json | Out-File -Encoding utf8 -FilePath .\installed_software.json
- name: Profile Windows Toolchain ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
run: |
cd src
python3 electron/build/profile_toolchain.py --output-json=out/Default/windows_toolchain_profile.json
- name: Add msdia140.dll to Path ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'win' }}
run: |
# Needed for msdia140.dll on 64-bit windows
cd src
export PATH="$PATH:$(pwd)/third_party/llvm-build/Release+Asserts/bin"
- name: Zip Symbols ${{ inputs.step-suffix }}
shell: bash
run: |
# Generate breakpad symbols on release builds
if [ "${{ inputs.generate-symbols }}" = "true" ]; then
e build --target electron:electron_symbols
fi
cd src
export BUILD_PATH="$(pwd)/out/Default"
e build --target electron:licenses
e build --target electron:electron_version_file
if [ "${{ inputs.is-release }}" = "true" ]; then
DELETE_DSYMS_AFTER_ZIP=1 electron/script/zip-symbols.py -b $BUILD_PATH
else
@@ -159,29 +205,21 @@ runs:
if: ${{ inputs.is-release == 'true' }}
run: |
cd src
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg -j $NUMBER_OF_NINJA_PROCESSES
- name: Generate Hunspell Dictionaries ${{ inputs.step-suffix }}
gn gen out/ffmpeg --args="import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true use_siso=true $GN_EXTRA_ARGS"
e build --target electron:electron_ffmpeg_zip -C ../../out/ffmpeg
- name: Remove Clang problem matcher
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:hunspell_dictionaries_zip -j $NUMBER_OF_NINJA_PROCESSES
- name: Generate Libcxx ${{ inputs.step-suffix }}
shell: bash
if: ${{ inputs.is-release == 'true' && inputs.target-platform == 'linux' }}
run: |
e build --target electron:libcxx_headers_zip -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:libcxxabi_headers_zip -j $NUMBER_OF_NINJA_PROCESSES
e build --target electron:libcxx_objects_zip -j $NUMBER_OF_NINJA_PROCESSES
run: echo "::remove-matcher owner=clang::"
- name: Generate TypeScript Definitions ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn.js create-typescript-definitions
- name: Publish Electron Dist ${{ inputs.step-suffix }}
if: ${{ inputs.is-release == 'true' }}
shell: bash
id: github-upload
run: |
rm -rf src/out/Default/obj
cd src/electron
@@ -192,7 +230,34 @@ runs:
echo 'Uploading Electron release distribution to GitHub releases'
script/release/uploaders/upload.py --verbose
fi
- name: Generate artifact attestation
if: ${{ inputs.is-release == 'true' }}
uses: actions/attest-build-provenance@96278af6caaf10aea03fd8d33a09a777ca52d62f # v3.2.0
with:
subject-path: ${{ steps.github-upload.outputs.UPLOADED_PATHS }}
- name: Generate siso report
if: ${{ inputs.target-platform != 'win' && !cancelled() }}
shell: bash
run: |
cd src
e d siso report -C out/Default > siso_report.txt
SISO_REPORT_PATH=$(grep -o '/.*siso-report-[^ ]*' siso_report.txt)
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH" >> $GITHUB_ENV
cat siso_report.txt
echo "SISO REPORT AT $SISO_REPORT_PATH"
- name: Generate siso report (Windows)
if: ${{ inputs.target-platform == 'win' && !cancelled() }}
shell: powershell
run: |
cd src
e d siso report -C out\Default > siso_report.txt
$SISO_REPORT_PATH = Get-Content "siso_report.txt" | Select-String "report file:\s*(.+)" | ForEach-Object {
$_.Matches.Groups[1].Value.Trim()
}
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH"
echo "SISO_REPORT_PATH=$SISO_REPORT_PATH" >> $env:GITHUB_ENV
- name: Generate Artifact Key
if: always() && !cancelled()
shell: bash
run: |
if [ "${{ inputs.is-asan }}" = "true" ]; then
@@ -204,15 +269,23 @@ runs:
# The current generated_artifacts_<< artifact.key >> name was taken from CircleCI
# to ensure we don't break anything, but we may be able to improve that.
- name: Move all Generated Artifacts to Upload Folder ${{ inputs.step-suffix }}
if: always() && !cancelled()
shell: bash
run: ./src/electron/script/actions/move-artifacts.sh
- name: Upload Generated Artifacts ${{ inputs.step-suffix }}
uses: actions/upload-artifact@65462800fd760344b1a7b4382951275a0abb4808
if: always() && !cancelled()
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
- name: Upload Src Artifacts ${{ inputs.step-suffix }}
uses: actions/upload-artifact@65462800fd760344b1a7b4382951275a0abb4808
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
path: ./src_artifacts_${{ inputs.artifact-platform }}_${{ inputs.target-arch }}
- name: Upload Out Gen Artifacts ${{ inputs.step-suffix }}
if: ${{ inputs.upload-out-gen-artifacts == 'true' }}
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: out_gen_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src/out/Default/gen

View File

@@ -0,0 +1,83 @@
name: 'Build Git Cache'
description: 'Runs a gclient sync to build the git cache for Electron'
inputs:
target-platform:
description: 'Target platform, should be linux, win, macos'
runs:
using: "composite"
steps:
- name: Set GIT_CACHE_PATH to make gclient to use the cache
shell: bash
run: |
echo "GIT_CACHE_PATH=$(pwd)/git-cache" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Set up cache drive
shell: bash
run: |
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "CACHE_DRIVE=/mnt/win-cache" >> $GITHUB_ENV
else
echo "CACHE_DRIVE=/mnt/cross-instance-cache" >> $GITHUB_ENV
fi
- name: Check cross instance cache disk space
shell: bash
run: |
# if there is less than 35 GB free space then creating the cache might fail so exit early
freespace=`df -m $CACHE_DRIVE | grep -w $CACHE_DRIVE | awk '{print $4}'`
freespace_human=`df -h $CACHE_DRIVE | grep -w $CACHE_DRIVE | awk '{print $4}'`
if [ $freespace -le 35000 ]; then
echo "The cross mount cache has $freespace_human free space which is not enough - exiting"
exit 1
else
echo "The cross mount cache has $freespace_human free space - continuing"
fi
- name: Restore gitcache
shell: bash
run: |
GIT_CACHE_TAR="$CACHE_DRIVE/gitcache.tar"
if [ ! -f "$GIT_CACHE_TAR" ]; then
echo "Git cache tar file does not exist, skipping restore"
exit 0
fi
echo "Restoring git cache from $GIT_CACHE_TAR to $GIT_CACHE_PATH"
mkdir -p $GIT_CACHE_PATH
tar -xf $GIT_CACHE_TAR -C $GIT_CACHE_PATH
- name: Gclient Sync
shell: bash
run: |
e d gclient config \
--name "src/electron" \
--unmanaged \
${GCLIENT_EXTRA_ARGS} \
"$GITHUB_SERVER_URL/$GITHUB_REPOSITORY"
if [ "$TARGET_OS" != "" ]; then
echo "target_os=['$TARGET_OS']" >> ./.gclient
fi
ELECTRON_USE_THREE_WAY_MERGE_FOR_PATCHES=1 e d gclient sync --with_branch_heads --with_tags --nohooks -vv
- name: Compress Git Cache Directory
shell: bash
run: |
echo "Uncompressed gitcache size: $(du -sh $GIT_CACHE_PATH | cut -f1 -d' ')"
cd $GIT_CACHE_PATH
tar -cf ../gitcache.tar .
cd ..
echo "Compressed gitcache to $(du -sh gitcache.tar | cut -f1 -d' ')"
# remove the old cache file if it exists
if [ -f $CACHE_DRIVE/gitcache.tar ]; then
echo "Removing old gitcache.tar from $CACHE_DRIVE"
rm $CACHE_DRIVE/gitcache.tar
fi
cp ./gitcache.tar $CACHE_DRIVE/
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done

View File

@@ -5,6 +5,12 @@ inputs:
description: 'Whether to generate and persist a SAS token for the item in the cache'
required: false
default: 'false'
use-cache:
description: 'Whether to persist the cache to the shared drive'
required: false
default: 'true'
target-platform:
description: 'Target platform, should be linux, win, macos'
runs:
using: "composite"
steps:
@@ -13,94 +19,105 @@ runs:
run: |
echo "GIT_CACHE_PATH=$(pwd)/git-cache" >> $GITHUB_ENV
- name: Install Dependencies
shell: bash
run: |
cd src/electron
node script/yarn install --frozen-lockfile
- name: Get Depot Tools
shell: bash
run: |
git clone --depth=1 https://chromium.googlesource.com/chromium/tools/depot_tools.git
sed -i '/ninjalog_uploader_wrapper.py/d' ./depot_tools/autoninja
# Remove swift-format dep from cipd on macOS until we send a patch upstream.
cd depot_tools
git apply --3way ../src/electron/.github/workflows/config/gclient.diff
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
touch .disable_auto_update
- name: Add Depot Tools to PATH
shell: bash
run: echo "$(pwd)/depot_tools" >> $GITHUB_PATH
uses: ./src/electron/.github/actions/install-dependencies
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
shell: bash
run: |
node src/electron/script/generate-deps-hash.js && cat src/electron/.depshash-target
echo "DEPSHASH=v1-src-cache-$(shasum src/electron/.depshash | cut -f1 -d' ')" >> $GITHUB_ENV
node src/electron/script/generate-deps-hash.js
DEPSHASH="v1-src-cache-$(cat src/electron/.depshash)"
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_FILE=$DEPSHASH.tar" >> $GITHUB_ENV
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "CACHE_DRIVE=/mnt/win-cache" >> $GITHUB_ENV
else
echo "CACHE_DRIVE=/mnt/cross-instance-cache" >> $GITHUB_ENV
fi
- name: Generate SAS Key
if: ${{ inputs.generate-sas-token == 'true' }}
shell: bash
run: |
curl --unix-socket /var/run/sas/sas.sock --fail "http://foo/$DEPSHASH.tar" > sas-token
curl --unix-socket /var/run/sas/sas.sock --fail "http://foo/$CACHE_FILE?platform=${{ inputs.target-platform }}&getAccountName=true" > sas-token
- name: Save SAS Key
if: ${{ inputs.generate-sas-token == 'true' }}
uses: actions/cache/save@v4
uses: actions/cache/save@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
with:
path: |
sas-token
key: sas-key-${{ github.run_number }}-${{ github.run_attempt }}
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-${{ github.run_attempt }}
enableCrossOsArchive: true
- name: Check If Cache Exists
id: check-cache
shell: bash
run: |
cache_path=/mnt/cross-instance-cache/$DEPSHASH.tar
echo "Using cache key: $DEPSHASH"
echo "Checking for cache in: $cache_path"
if [ ! -f "$cache_path" ] || [ `du $cache_path | cut -f1` = "0" ]; then
if [[ "${{ inputs.use-cache }}" == "false" ]]; then
echo "Not using cache this time..."
echo "cache_exists=false" >> $GITHUB_OUTPUT
echo "Cache Does Not Exist for $DEPSHASH"
else
echo "cache_exists=true" >> $GITHUB_OUTPUT
echo "Cache Already Exists for $DEPSHASH, Skipping.."
cache_path=$CACHE_DRIVE/$CACHE_FILE
echo "Using cache key: $DEPSHASH"
echo "Checking for cache in: $cache_path"
if [ ! -f "$cache_path" ] || [ `du $cache_path | cut -f1` = "0" ]; then
echo "cache_exists=false" >> $GITHUB_OUTPUT
echo "Cache Does Not Exist for $DEPSHASH"
else
echo "cache_exists=true" >> $GITHUB_OUTPUT
echo "Cache Already Exists for $DEPSHASH, Skipping.."
fi
fi
- name: Check cross instance cache disk space
if: steps.check-cache.outputs.cache_exists == 'false'
if: steps.check-cache.outputs.cache_exists == 'false' && inputs.use-cache == 'true'
shell: bash
run: |
# if there is less than 20 GB free space then creating the cache might fail so exit early
freespace=`df -m /mnt/cross-instance-cache | grep -w /mnt/cross-instance-cache | awk '{print $4}'`
freespace_human=`df -h /mnt/cross-instance-cache | grep -w /mnt/cross-instance-cache | awk '{print $4}'`
if [ $freespace -le 20000 ]; then
# if there is less than 35 GB free space then creating the cache might fail so exit early
freespace=`df -m $CACHE_DRIVE | grep -w $CACHE_DRIVE | awk '{print $4}'`
freespace_human=`df -h $CACHE_DRIVE | grep -w $CACHE_DRIVE | awk '{print $4}'`
if [ $freespace -le 35000 ]; then
echo "The cross mount cache has $freespace_human free space which is not enough - exiting"
exit 1
else
echo "The cross mount cache has $freespace_human free space - continuing"
fi
- name: Add patch conflict problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/patch-conflict.json"
- name: Restore gitcache
if: steps.check-cache.outputs.cache_exists == 'false'
shell: bash
run: |
GIT_CACHE_TAR="$CACHE_DRIVE/gitcache.tar"
if [ ! -f "$GIT_CACHE_TAR" ]; then
echo "Git cache tar file does not exist, skipping restore"
exit 0
fi
echo "Restoring git cache from $GIT_CACHE_TAR to $GIT_CACHE_PATH"
mkdir -p $GIT_CACHE_PATH
tar -xf $GIT_CACHE_TAR -C $GIT_CACHE_PATH
- name: Gclient Sync
if: steps.check-cache.outputs.cache_exists == 'false'
shell: bash
run: |
gclient config \
e d gclient config \
--name "src/electron" \
--unmanaged \
${GCLIENT_EXTRA_ARGS} \
"$GITHUB_SERVER_URL/$GITHUB_REPOSITORY"
ELECTRON_USE_THREE_WAY_MERGE_FOR_PATCHES=1 gclient sync --with_branch_heads --with_tags -vvvvv
if [ "${{ inputs.is-release }}" != "true" && -n "${{ env.PATCH_UP_APP_CREDS }}" ]; then
if [ "$TARGET_OS" != "" ]; then
echo "target_os=['$TARGET_OS']" >> ./.gclient
fi
ELECTRON_USE_THREE_WAY_MERGE_FOR_PATCHES=1 e d gclient sync --with_branch_heads --with_tags -vv
if [[ "${{ inputs.is-release }}" != "true" ]]; then
# Re-export all the patches to check if there were changes.
python3 src/electron/script/export_all_patches.py src/electron/patches/config.json
cd src/electron
git update-index --refresh || true
if ! git diff-index --quiet HEAD --; then
# There are changes to the patches. Make a git commit with the updated patches
git add patches
GIT_COMMITTER_NAME="PatchUp" GIT_COMMITTER_EMAIL="73610968+patchup[bot]@users.noreply.github.com" git commit -m "chore: update patches" --author="PatchUp <73610968+patchup[bot]@users.noreply.github.com>"
# Export it
mkdir -p ../../patches
git format-patch -1 --stdout --keep-subject --no-stat --full-index > ../../patches/update-patches.patch
if node ./script/push-patch.js; then
if node ./script/patch-up.js; then
echo
echo "======================================================================"
echo "Changes to the patches when applying, we have auto-pushed the diff to the current branch"
@@ -108,6 +125,11 @@ runs:
echo "======================================================================"
exit 1
else
git add patches
GIT_COMMITTER_NAME="PatchUp" GIT_COMMITTER_EMAIL="73610968+patchup[bot]@users.noreply.github.com" git commit -m "chore: update patches" --author="PatchUp <73610968+patchup[bot]@users.noreply.github.com>"
# Export it
mkdir -p ../../patches
git format-patch -1 --stdout --keep-subject --no-stat --full-index > ../../patches/update-patches.patch
echo
echo "======================================================================"
echo "There were changes to the patches when applying."
@@ -117,9 +139,21 @@ runs:
cat ../../patches/update-patches.patch
exit 1
fi
else
echo "No changes to patches detected"
fi
fi
- name: Remove patch conflict problem matchers
shell: bash
run: |
echo "::remove-matcher owner=merge-conflict::"
echo "::remove-matcher owner=patch-conflict::"
echo "::remove-matcher owner=patch-needs-update::"
- name: Upload patches stats
if: ${{ inputs.target-platform == 'linux' && github.ref == 'refs/heads/main' }}
shell: bash
run: |
node src/electron/script/patches-stats.mjs --upload-stats || true
# delete all .git directories under src/ except for
# third_party/angle/ and third_party/dawn/ because of build time generation of files
# gen/angle/commit.h depends on third_party/angle/.git/HEAD
@@ -128,37 +162,39 @@ runs:
# https://dawn-review.googlesource.com/c/dawn/+/83901
# TODO: maybe better to always leave out */.git/HEAD file for all targets ?
- name: Delete .git directories under src to free space
if: steps.check-cache.outputs.cache_exists == 'false'
if: ${{ steps.check-cache.outputs.cache_exists == 'false' && inputs.use-cache == 'true' }}
shell: bash
run: |
cd src
( find . -type d -name ".git" -not -path "./third_party/angle/*" -not -path "./third_party/dawn/*" -not -path "./electron/*" ) | xargs rm -rf
- name: Minimize Cache Size for Upload
if: steps.check-cache.outputs.cache_exists == 'false'
if: ${{ steps.check-cache.outputs.cache_exists == 'false' && inputs.use-cache == 'true' }}
shell: bash
run: |
rm -rf src/android_webview
rm -rf src/ios/chrome
rm -rf src/third_party/blink/web_tests
rm -rf src/third_party/blink/perf_tests
rm -rf src/chrome/test/data/xr/webvr_info
rm -rf src/third_party/angle/third_party/VK-GL-CTS/src
rm -rf src/third_party/swift-toolchain
rm -rf src/third_party/swiftshader/tests/regres/testlists
cp src/electron/.github/actions/checkout/action.yml ./
rm -rf src/electron
mkdir -p src/electron/.github/actions/checkout
mv action.yml src/electron/.github/actions/checkout
- name: Compress Src Directory
if: steps.check-cache.outputs.cache_exists == 'false'
if: ${{ steps.check-cache.outputs.cache_exists == 'false' && inputs.use-cache == 'true' }}
shell: bash
run: |
echo "Uncompressed src size: $(du -sh src | cut -f1 -d' ')"
tar -cf $DEPSHASH.tar src
echo "Compressed src to $(du -sh $DEPSHASH.tar | cut -f1 -d' ')"
cp ./$DEPSHASH.tar /mnt/cross-instance-cache/
tar -cf $CACHE_FILE src
echo "Compressed src to $(du -sh $CACHE_FILE | cut -f1 -d' ')"
cp ./$CACHE_FILE $CACHE_DRIVE/
- name: Persist Src Cache
if: steps.check-cache.outputs.cache_exists == 'false'
if: ${{ steps.check-cache.outputs.cache_exists == 'false' && inputs.use-cache == 'true' }}
shell: bash
run: |
final_cache_path=/mnt/cross-instance-cache/$DEPSHASH.tar
final_cache_path=$CACHE_DRIVE/$CACHE_FILE
echo "Using cache key: $DEPSHASH"
echo "Checking path: $final_cache_path"
if [ ! -f "$final_cache_path" ]; then
@@ -167,3 +203,11 @@ runs:
else
echo "Cache key persisted in $final_cache_path"
fi
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done

51
.github/actions/cipd-install/action.yml vendored Normal file
View File

@@ -0,0 +1,51 @@
name: 'CIPD install'
description: 'Installs the specified CIPD package'
inputs:
cipd-root-prefix-path:
description: 'Path to prepend to installation directory'
default: ''
dependency:
description: 'Name of dependency to install'
deps-file:
description: 'Location of DEPS file that defines the dependency'
installation-dir:
description: 'Location to install dependency'
target-platform:
description: 'Target platform, should be linux, win, macos'
package:
description: 'Package to install'
dependency-version:
description: 'Version of the dependency to install'
default: ''
runs:
using: "composite"
steps:
- name: Delete wrong ${{ inputs.dependency }}
shell: bash
run : |
rm -rf ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }}
- name: Create ensure file for ${{ inputs.dependency }}
if: ${{ inputs.dependency-version == '' }}
shell: bash
run: |
echo '${{ inputs.package }}' `e d gclient getdep --deps-file=${{ inputs.deps-file }} -r '${{ inputs.installation-dir }}:${{ inputs.package }}'` > ${{ inputs.dependency }}_ensure_file
cat ${{ inputs.dependency }}_ensure_file
- name: Create ensure file for ${{ inputs.dependency }} from dependency-version
if: ${{ inputs.dependency-version != '' }}
shell: bash
run: |
echo '${{ inputs.package }} ${{ inputs.dependency-version }}' > ${{ inputs.dependency }}_ensure_file
cat ${{ inputs.dependency }}_ensure_file
- name: CIPD installation of ${{ inputs.dependency }} (macOS)
if: ${{ inputs.target-platform != 'win' }}
shell: bash
run: |
echo "ensuring ${{ inputs.dependency }}"
e d cipd ensure --root ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }} -ensure-file ${{ inputs.dependency }}_ensure_file
- name: CIPD installation of ${{ inputs.dependency }} (Windows)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
echo "ensuring ${{ inputs.dependency }} on Windows"
e d cipd ensure --root ${{ inputs.cipd-root-prefix-path }}${{ inputs.installation-dir }} -ensure-file ${{ inputs.dependency }}_ensure_file

View File

@@ -1,61 +0,0 @@
name: 'Fix Sync macOS'
description: 'Checks out Electron and stores it in the AKS Cache'
runs:
using: "composite"
steps:
- name: Fix Sync
shell: bash
# This step is required to correct for differences between "gclient sync"
# on Linux and the expected state on macOS. This requires:
# 1. Fixing Clang Install (wrong binary)
# 2. Fixing esbuild (wrong binary)
# 3. Fixing rustc (wrong binary)
# 4. Fixing gn (wrong binary)
# 5. Fix reclient (wrong binary)
# 6. Fixing dsymutil (wrong binary)
# 7. Ensuring we are using the correct ninja and adding it to PATH
# 8. Fixing angle (wrong remote)
run : |
SEDOPTION="-i ''"
rm -rf src/third_party/llvm-build
python3 src/tools/clang/scripts/update.py
echo 'infra/3pp/tools/esbuild/${platform}' `gclient getdep --deps-file=src/third_party/devtools-frontend/src/DEPS -r 'third_party/esbuild:infra/3pp/tools/esbuild/${platform}'` > esbuild_ensure_file
# Remove extra output from calling gclient getdep which always calls update_depot_tools
sed -i '' "s/Updating depot_tools... //g" esbuild_ensure_file
cipd ensure --root src/third_party/devtools-frontend/src/third_party/esbuild -ensure-file esbuild_ensure_file
rm -rf src/third_party/rust-toolchain
python3 src/tools/rust/update_rust.py
# Prevent calling gclient getdep which always calls update_depot_tools
echo 'gn/gn/mac-${arch}' `gclient getdep --deps-file=src/DEPS -r 'src/buildtools/mac:gn/gn/mac-${arch}'` > gn_ensure_file
sed -i '' "s/Updating depot_tools... //g" gn_ensure_file
cipd ensure --root src/buildtools/mac -ensure-file gn_ensure_file
# Prevent calling gclient getdep which always calls update_depot_tools
echo 'infra/rbe/client/${platform}' `gclient getdep --deps-file=src/DEPS -r 'src/buildtools/reclient:infra/rbe/client/${platform}'` > gn_ensure_file
sed -i '' "s/Updating depot_tools... //g" gn_ensure_file
cipd ensure --root src/buildtools/reclient -ensure-file gn_ensure_file
python3 src/buildtools/reclient_cfgs/configure_reclient_cfgs.py --rbe_instance "projects/rbe-chrome-untrusted/instances/default_instance" --reproxy_cfg_template reproxy.cfg.template --rewrapper_cfg_project "" --skip_remoteexec_cfg_fetch
if [ "${{ env.TARGET_ARCH }}" == "arm64" ]; then
DSYM_SHA_FILE=src/tools/clang/dsymutil/bin/dsymutil.arm64.sha1
else
DSYM_SHA_FILE=src/tools/clang/dsymutil/bin/dsymutil.x64.sha1
fi
python3 src/third_party/depot_tools/download_from_google_storage.py --no_resume --no_auth --bucket chromium-browser-clang -s $DSYM_SHA_FILE -o src/tools/clang/dsymutil/bin/dsymutil
echo 'infra/3pp/build_support/ninja-1_11_1/${platform}' `gclient getdep --deps-file=src/DEPS -r 'src/third_party/ninja:infra/3pp/build_support/ninja-1_11_1/${platform}'` > ninja_ensure_file
sed $SEDOPTION "s/Updating depot_tools... //g" ninja_ensure_file
cipd ensure --root src/third_party/ninja -ensure-file ninja_ensure_file
echo "$(pwd)/src/third_party/ninja" >> $GITHUB_PATH
cd src/third_party/angle
rm -f .git/objects/info/alternates
git remote set-url origin https://chromium.googlesource.com/angle/angle.git
cp .git/config .git/config.backup
git remote remove origin
mv .git/config.backup .git/config
git fetch

154
.github/actions/fix-sync/action.yml vendored Normal file
View File

@@ -0,0 +1,154 @@
name: 'Fix Sync'
description: 'Ensures proper binaries are in place'
# This action is required to correct for differences between "gclient sync"
# on Linux and the expected state on macOS/windows. This requires:
# 1. Fixing Clang Install (wrong binary)
# 2. Fixing esbuild (wrong binary)
# 3. Fixing rustc (wrong binary)
# 4. Fixing gn (wrong binary)
# 5. Fix reclient (wrong binary)
# 6. Fixing dsymutil (wrong binary)
# 7. Ensuring we are using the correct ninja and adding it to PATH
# 8. Fixing angle (wrong remote)
# 9. Install windows toolchain on Windows
# 10. Fix node binary on Windows
# 11. Fix rc binary on Windows
inputs:
target-platform:
description: 'Target platform, should be linux, win, macos'
runs:
using: "composite"
steps:
- name: Fix llvm toolchain
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
rm -rf src/third_party/llvm-build
python3 src/tools/clang/scripts/update.py
# Refs https://chromium-review.googlesource.com/c/chromium/src/+/6667681
python3 src/tools/clang/scripts/update.py --package objdump
- name: Fix esbuild
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
dependency: esbuild
deps-file: src/third_party/devtools-frontend/src/DEPS
installation-dir: third_party/esbuild
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/esbuild/${platform}
- name: Fix rollup
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
cipd-root-prefix-path: src/third_party/devtools-frontend/src/
dependency: rollup_libs
deps-file: src/third_party/devtools-frontend/src/DEPS
installation-dir: third_party/rollup_libs
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/rollup_libs/${platform}
- name: Sync native rollup libs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/devtools-frontend/src
python3 scripts/deps/sync_rollup_libs.py
- name: Fix rustc
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
rm -rf src/third_party/rust-toolchain
python3 src/tools/rust/update_rust.py
- name: Fix gn (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: gn
deps-file: src/DEPS
installation-dir: src/buildtools/mac
target-platform: ${{ inputs.target-platform }}
package: gn/gn/mac-${arch}
- name: Fix gn (Windows)
if: ${{ inputs.target-platform == 'win' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: gn
deps-file: src/DEPS
installation-dir: src/buildtools/win
target-platform: ${{ inputs.target-platform }}
package: gn/gn/windows-amd64
- name: Fix reclient
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: reclient
deps-file: src/DEPS
installation-dir: src/buildtools/reclient
target-platform: ${{ inputs.target-platform }}
package: infra/rbe/client/${platform}
- name: Configure reclient configs
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
python3 src/buildtools/reclient_cfgs/configure_reclient_cfgs.py --rbe_instance "projects/rbe-chrome-untrusted/instances/default_instance" --reproxy_cfg_template reproxy.cfg.template --rewrapper_cfg_project "" --skip_remoteexec_cfg_fetch
- name: Fix dsymutil (macOS)
if: ${{ inputs.target-platform == 'macos' }}
shell: bash
run : |
# Fix dsymutil
if [ "${{ inputs.target-platform }}" = "macos" ]; then
if [ "${{ env.TARGET_ARCH }}" == "arm64" ]; then
DSYM_SHA_FILE=src/tools/clang/dsymutil/bin/dsymutil.arm64.sha1
else
DSYM_SHA_FILE=src/tools/clang/dsymutil/bin/dsymutil.x64.sha1
fi
python3 src/third_party/depot_tools/download_from_google_storage.py --no_resume --no_auth --bucket chromium-browser-clang -s $DSYM_SHA_FILE -o src/tools/clang/dsymutil/bin/dsymutil
fi
- name: Fix ninja
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: ninja
deps-file: src/DEPS
installation-dir: src/third_party/ninja
target-platform: ${{ inputs.target-platform }}
package: infra/3pp/tools/ninja/${platform}
- name: Set ninja in path
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
echo "$(pwd)/src/third_party/ninja" >> $GITHUB_PATH
- name: Fix siso
uses: ./src/electron/.github/actions/cipd-install
with:
dependency: siso
deps-file: src/DEPS
installation-dir: src/third_party/siso/cipd
target-platform: ${{ inputs.target-platform }}
package: build/siso/${platform}
- name: Fixup angle git
if: ${{ inputs.target-platform != 'linux' }}
shell: bash
run : |
cd src/third_party/angle
rm -f .git/objects/info/alternates
git remote set-url origin https://chromium.googlesource.com/angle/angle.git
cp .git/config .git/config.backup
git remote remove origin
mv .git/config.backup .git/config
git fetch
- name: Get Windows toolchain
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: e d vpython3 src\build\vs_toolchain.py update --force
- name: Download nodejs
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
$nodedeps = e d gclient getdep --deps-file=src/DEPS -r src/third_party/node/win | ConvertFrom-JSON
python3 src\third_party\depot_tools\download_from_google_storage.py --no_resume --no_auth --bucket chromium-nodejs -o src\third_party\node\win\node.exe $nodedeps.object_name
- name: Install rc
if: ${{ inputs.target-platform == 'win' }}
shell: bash
run: |
python3 src/third_party/depot_tools/download_from_google_storage.py --no_resume --no_auth --bucket chromium-browser-clang/rc -s src/build/toolchain/win/rc/win/rc.exe.sha1

View File

@@ -6,6 +6,8 @@ runs:
- name: Free Space on MacOS
shell: bash
run: |
echo "Disk usage before cleanup:"
df -h
sudo mkdir -p $TMPDIR/del-target
tmpify() {
@@ -15,28 +17,30 @@ runs:
}
strip_universal_deep() {
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
if [ -d "$1" ]; then
opwd=$(pwd)
cd $1
f=$(find . -perm +111 -type f)
for fp in $f
do
if [[ $(file "$fp") == *"universal binary"* ]]; then
if [ "`arch`" == "arm64" ]; then
if [[ $(file "$fp") == *"x86_64"* ]]; then
sudo lipo -remove x86_64 "$fp" -o "$fp" || true
fi
else
if [[ $(file "$fp") == *"arm64e)"* ]]; then
sudo lipo -remove arm64e "$fp" -o "$fp" || true
fi
if [[ $(file "$fp") == *"arm64)"* ]]; then
sudo lipo -remove arm64 "$fp" -o "$fp" || true
fi
fi
fi
fi
done
done
cd $opwd
cd $opwd
fi
}
tmpify /Library/Developer/CoreSimulator
@@ -57,9 +61,31 @@ runs:
sudo rm -rf $TMPDIR/del-target
sudo rm -rf /Applications/Safari.app
sudo rm -rf /Applications/Xcode_16.1.app
sudo rm -rf /Applications/Xcode_16.2.app
sudo rm -rf /Applications/Xcode_16.3.app
sudo rm -rf /Applications/Xcode_26*
sudo rm -rf /Applications/Google Chrome.app
sudo rm -rf /Applications/Google Chrome for Testing.app
sudo rm -rf /Applications/Firefox.app
sudo rm -rf /Applications/Microsoft Edge.app
sudo rm -rf ~/project/src/third_party/catapult/tracing/test_data
sudo rm -rf ~/project/src/third_party/angle/third_party/VK-GL-CTS
sudo rm -rf /Users/runner/Library/Android
sudo rm -rf $JAVA_HOME_11_arm64
sudo rm -rf $JAVA_HOME_17_arm64
sudo rm -rf $JAVA_HOME_21_arm64
sudo rm -rf $JAVA_HOME_25_arm64
sudo rm -rf /Users/runner/.dotnet/
sudo rm -rf /Users/runner/.rustup
# remove homebrew packages we don't need
if command -v brew &> /dev/null; then
brew uninstall -f --zap aws-sam-cli session-manager-plugin gcc gcc@13 gcc@14 llvm@18 gradle maven ant azure-cli
brew autoremove
fi
# lipo off some huge binaries arm64 versions to save space
strip_universal_deep $(xcode-select -p)/../SharedFrameworks
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
# strip_arm_deep /System/Volumes/Data/Library/Developer/CommandLineTools/usr
sudo mdutil -a -i off

View File

@@ -13,12 +13,16 @@ runs:
- name: Generating Types for SHA in ${{ inputs.sha-file }}
shell: bash
run: |
git checkout $(cat ${{ inputs.sha-file }})
rm -rf node_modules
yarn install --frozen-lockfile --ignore-scripts
export ELECTRON_DIR=$(pwd)
if [ "${{ inputs.sha-file }}" == ".dig-old" ]; then
cd /tmp
git clone https://github.com/electron/electron.git
cd electron
fi
git checkout $(cat $ELECTRON_DIR/${{ inputs.sha-file }})
node script/yarn.js install --immutable
echo "#!/usr/bin/env node\nglobal.x=1" > node_modules/typescript/bin/tsc
node node_modules/.bin/electron-docs-parser --dir=./ --outDir=./ --moduleVersion=0.0.0-development
node node_modules/.bin/electron-typescript-definitions --api=electron-api.json --outDir=artifacts
mv artifacts/electron.d.ts artifacts/${{ inputs.filename }}
git checkout .
mv artifacts/electron.d.ts $ELECTRON_DIR/artifacts/${{ inputs.filename }}
working-directory: ./electron

View File

@@ -6,6 +6,27 @@ runs:
- name: Install Build Tools
shell: bash
run: |
export BUILD_TOOLS_SHA=eeb1a11392e4cec08fd926c93b31ab556dc0c23b
if [ "$(expr substr $(uname -s) 1 10)" == "MSYS_NT-10" ]; then
git config --global core.filemode false
git config --global core.autocrlf false
git config --global branch.autosetuprebase always
git config --global core.fscache true
git config --global core.longpaths true
git config --global core.preloadindex true
git config --global core.longpaths true
fi
export BUILD_TOOLS_SHA=a0cc95a1884a631559bcca0c948465b725d9295a
npm i -g @electron/build-tools
e auto-update disable
# Update depot_tools to ensure python
e d update_depot_tools
e auto-update disable
# Disable further updates of depot_tools
e d auto-update disable
if [ "$(expr substr $(uname -s) 1 10)" == "MSYS_NT-10" ]; then
e d cipd.bat --version
cp "C:\Python311\python.exe" "C:\Python311\python3.exe"
echo "C:\Users\ContainerAdministrator\.electron_build_tools\third_party\depot_tools" >> $GITHUB_PATH
else
echo "$HOME/.electron_build_tools/third_party/depot_tools" >> $GITHUB_PATH
echo "$HOME/.electron_build_tools/third_party/depot_tools/python-bin" >> $GITHUB_PATH
fi

View File

@@ -0,0 +1,31 @@
name: 'Install Dependencies'
description: 'Installs yarn depdencies using cache when available'
runs:
using: "composite"
steps:
- name: Get yarn cache directory path
shell: bash
id: yarn-cache-dir-path
run: echo "dir=$(node src/electron/script/yarn.js config get cacheFolder)" >> $GITHUB_OUTPUT
- uses: actions/cache@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
id: yarn-cache
with:
path: ${{ steps.yarn-cache-dir-path.outputs.dir }}
key: ${{ runner.os }}-yarn-${{ hashFiles('src/electron/yarn.lock') }}
restore-keys: |
${{ runner.os }}-yarn-
- name: Install Dependencies
shell: bash
run: |
cd src/electron
if [ "$TARGET_ARCH" = "x86" ]; then
export npm_config_arch="ia32"
fi
# if running on linux arm skip yarn Builds
ARCH=$(uname -m)
if [ "$ARCH" = "armv7l" ]; then
echo "Skipping yarn build on linux arm"
node script/yarn.js install --immutable --mode=skip-build
else
node script/yarn.js install --immutable
fi

View File

@@ -1,12 +1,20 @@
name: 'Restore Cache AKS'
description: 'Restores Electron src cache via AKS'
inputs:
target-platform:
description: 'Target platform, should be linux, win, macos'
runs:
using: "composite"
steps:
- name: Restore and Ensure Src Cache
shell: bash
run: |
cache_path=/mnt/cross-instance-cache/$DEPSHASH.tar
if [ "${{ inputs.target-platform }}" = "win" ]; then
cache_path=/mnt/win-cache/$DEPSHASH.tar
else
cache_path=/mnt/cross-instance-cache/$DEPSHASH.tar
fi
echo "Using cache key: $DEPSHASH"
echo "Checking for cache in: $cache_path"
if [ ! -f "$cache_path" ]; then
@@ -38,4 +46,4 @@ runs:
fi
echo "Wiping Electron Directory"
rm -rf src/electron
rm -rf src/electron

View File

@@ -1,22 +1,25 @@
name: 'Restore Cache AZCopy'
description: 'Restores Electron src cache via AZCopy'
inputs:
target-platform:
description: 'Target platform, should be linux, win, macos'
runs:
using: "composite"
steps:
- name: Obtain SAS Key
continue-on-error: true
uses: actions/cache/restore@0c45773b623bea8c8e75f6c82b208c3cf94ea4f9
uses: actions/cache/restore@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
with:
path: |
sas-token
key: sas-key-${{ github.run_number }}-1
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-1
enableCrossOsArchive: true
- name: Obtain SAS Key
continue-on-error: true
uses: actions/cache/restore@0c45773b623bea8c8e75f6c82b208c3cf94ea4f9
uses: actions/cache/restore@668228422ae6a00e4ad889ee87cd7109ec5666a7 # v5.0.4
with:
path: |
sas-token
key: sas-key-${{ github.run_number }}-${{ github.run_attempt }}
path: sas-token
key: sas-key-${{ inputs.target-platform }}-${{ github.run_number }}-${{ github.run_attempt }}
enableCrossOsArchive: true
- name: Download Src Cache from AKS
# The cache will always exist here as a result of the checkout job
# Either it was uploaded to Azure in the checkout job for this commit
@@ -26,21 +29,31 @@ runs:
timeout_minutes: 30
max_attempts: 3
retry_on: error
shell: bash
command: |
sas_token=$(cat sas-token)
if [ -z $sas-token ]; then
if [ -z "$sas_token" ]; then
echo "SAS Token not found; exiting src cache download early..."
exit 1
else
sas_token=$(jq -r '.sasToken' sas-token)
account_name=$(jq -r '.accountName' sas-token)
if [ "${{ inputs.target-platform }}" = "win" ]; then
azcopy copy --log-level=ERROR \
"https://$account_name.file.core.windows.net/${{ env.AZURE_AKS_WIN_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
else
azcopy copy --log-level=ERROR \
"https://$account_name.file.core.windows.net/${{ env.AZURE_AKS_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
fi
fi
azcopy copy --log-level=ERROR \
"https://${{ env.AZURE_AKS_CACHE_STORAGE_ACCOUNT }}.file.core.windows.net/${{ env.AZURE_AKS_CACHE_SHARE_NAME }}/${{ env.CACHE_PATH }}?$sas_token" $DEPSHASH.tar
env:
AZURE_AKS_CACHE_STORAGE_ACCOUNT: f723719aa87a34622b5f7f3
AZURE_AKS_CACHE_SHARE_NAME: pvc-f6a4089f-b082-4bee-a3f9-c3e1c0c02d8f
AZURE_AKS_CACHE_SHARE_NAME: linux-cache
AZURE_AKS_WIN_CACHE_SHARE_NAME: windows-cache
- name: Clean SAS Key
shell: bash
run: rm -f sas-token
- name: Unzip and Ensure Src Cache
if: ${{ inputs.target-platform == 'macos' }}
shell: bash
run: |
echo "Downloaded cache is $(du -sh $DEPSHASH.tar | cut -f1)"
@@ -68,4 +81,45 @@ runs:
fi
echo "Wiping Electron Directory"
rm -rf src/electron
rm -rf src/electron
- name: Unzip and Ensure Src Cache (Windows)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
$src_cache = "$env:DEPSHASH.tar"
$cache_size = $(Get-Item $src_cache).length
Write-Host "Downloaded cache is $cache_size"
if ($cache_size -eq 0) {
Write-Host "Cache is empty - exiting"
exit 1
}
$TEMP_DIR=New-Item -ItemType Directory -Path temp-cache
$TEMP_DIR_PATH = $TEMP_DIR.FullName
C:\ProgramData\Chocolatey\bin\7z.exe -y -snld20 x $src_cache -o"$TEMP_DIR_PATH"
- name: Move Src Cache (Windows)
if: ${{ inputs.target-platform == 'win' }}
uses: nick-fields/retry@7152eba30c6575329ac0576536151aca5a72780e # v3.0.0
with:
timeout_minutes: 30
max_attempts: 3
retry_on: error
shell: powershell
command: |
if (Test-Path "temp-cache\src") {
Write-Host "Relocating Cache"
Remove-Item -Recurse -Force src
Move-Item temp-cache\src src
Write-Host "Deleting zip file"
Remove-Item -Force $src_cache
}
if (-Not (Test-Path "src\third_party\blink")) {
Write-Host "Cache was not correctly restored - exiting"
exit 1
}
Write-Host "Wiping Electron Directory"
Remove-Item -Recurse -Force src\electron

View File

@@ -0,0 +1,58 @@
name: 'Set Chromium Git Cookie'
description: 'Sets an authenticated cookie from Chromium to allow for a higher request limit'
runs:
using: "composite"
steps:
- name: Set the git cookie from chromium.googlesource.com (Unix)
if: ${{ runner.os != 'Windows' }}
shell: bash
run: |
if [[ -z "${{ env.CHROMIUM_GIT_COOKIE }}" ]]; then
echo "CHROMIUM_GIT_COOKIE is not set - cannot authenticate."
exit 0
fi
eval 'set +o history' 2>/dev/null || setopt HIST_IGNORE_SPACE 2>/dev/null
touch ~/.gitcookies
chmod 0600 ~/.gitcookies
git config --global http.cookiefile ~/.gitcookies
tr , \\t <<\__END__ >>~/.gitcookies
${{ env.CHROMIUM_GIT_COOKIE }}
__END__
eval 'set -o history' 2>/dev/null || unsetopt HIST_IGNORE_SPACE 2>/dev/null
RESPONSE=$(curl -s -b ~/.gitcookies https://chromium-review.googlesource.com/a/accounts/self)
if [[ $RESPONSE == ")]}'"* ]]; then
# Extract account email for verification
EMAIL=$(echo "$RESPONSE" | tail -c +5 | jq -r '.email // "No email found"')
echo "Cookie authentication successful - authenticated as: $EMAIL"
else
echo "Cookie authentication failed - ensure CHROMIUM_GIT_COOKIE is set correctly"
echo $RESPONSE
fi
- name: Set the git cookie from chromium.googlesource.com (Windows)
if: ${{ runner.os == 'Windows' }}
shell: cmd
run: |
if "%CHROMIUM_GIT_COOKIE_WINDOWS_STRING%"=="" (
echo CHROMIUM_GIT_COOKIE_WINDOWS_STRING is not set - cannot authenticate.
exit /b 0
)
git config --global http.cookiefile "%USERPROFILE%\.gitcookies"
powershell -noprofile -nologo -command Write-Output "${{ env.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}" >>"%USERPROFILE%\.gitcookies"
curl -s -b "%USERPROFILE%\.gitcookies" https://chromium-review.googlesource.com/a/accounts/self > response.txt
findstr /B /C:")]}'" response.txt > nul
if %ERRORLEVEL% EQU 0 (
echo Cookie authentication successful
powershell -NoProfile -Command "& {$content = Get-Content -Raw response.txt; $content = $content.Substring(4); try { $json = ConvertFrom-Json $content; if($json.email) { Write-Host 'Authenticated as:' $json.email } else { Write-Host 'No email found in response' } } catch { Write-Host 'Error parsing JSON:' $_ }}"
) else (
echo Cookie authentication failed - ensure CHROMIUM_GIT_COOKIE_WINDOWS_STRING is set correctly
type response.txt
)
del response.txt

20
.github/actions/ssh-debug/action.yml vendored Normal file
View File

@@ -0,0 +1,20 @@
name: Debug via SSH
description: Setup a SSH server with a tunnel to access it to debug via SSH.
inputs:
tunnel:
description: 'Enable SSH tunneling via cloudflared'
required: true
default: 'false'
timeout:
description: 'SSH session timeout in seconds'
required: false
type: number
default: 3600
runs:
using: composite
steps:
- run: $GITHUB_ACTION_PATH/setup-ssh.sh
shell: bash
env:
TUNNEL: ${{ inputs.tunnel }}
TIMEOUT: ${{ inputs.timeout }}

4
.github/actions/ssh-debug/bashrc vendored Normal file
View File

@@ -0,0 +1,4 @@
# If we're in an interactive SSH session and we're not already in tmux and there's no explicit SSH command, auto attach tmux
if [ -n "$SSH_TTY" ] && [ -z "$TMUX" ] && [ -z "$SSH_ORIGINAL_COMMAND" ]; then
exec tmux attach || exec tmux
fi

146
.github/actions/ssh-debug/setup-ssh.sh vendored Executable file
View File

@@ -0,0 +1,146 @@
#!/bin/bash -e
if [ "${TUNNEL}" != "true" ]; then
echo "SSH tunneling is disabled. Set enable-tunnel: true to enable remote access."
echo "Local SSH server would be available on localhost:2222 if this were a local environment."
exit 0
fi
echo ::group::Configuring Tunnel
echo "SSH tunneling enabled. Setting up remote access..."
EXTERNAL_DEPS="curl jq ssh-keygen"
for dep in $EXTERNAL_DEPS; do
if ! command -v "${dep}" > /dev/null 2>&1; then
echo "Command ${dep} not installed on the system!" >&2
exit 1
fi
done
cd "$GITHUB_ACTION_PATH"
bashrc_path=$(pwd)/bashrc
# Source `bashrc` to auto start tmux on SSH login.
if ! grep -q "${bashrc_path}" ~/.bash_profile; then
echo >> ~/.bash_profile # On macOS runner there's no newline at the end of the file
echo "source \"${bashrc_path}\"" >> ~/.bash_profile
fi
OS=$(uname -s | tr '[:upper:]' '[:lower:]')
ARCH=$(uname -m)
if [ "${ARCH}" = "x86_64" ]; then
ARCH="amd64"
elif [ "${ARCH}" = "aarch64" ]; then
ARCH="arm64"
fi
if [ "${OS}" = "darwin" ] && ! command -v tmux > /dev/null 2>&1; then
echo "Installing tmux..."
brew install tmux
fi
if [ "$OS" = "darwin" ]; then
cloudflared_url="https://github.com/cloudflare/cloudflared/releases/latest/download/cloudflared-${OS}-${ARCH}.tgz"
echo "Downloading \`cloudflared\` from <$cloudflared_url>..."
curl --location --silent --output cloudflared.tgz "${cloudflared_url}"
tar xf cloudflared.tgz
rm cloudflared.tgz
fi
chmod +x cloudflared
echo 'Creating SSH server key...'
ssh-keygen -q -f ssh_host_rsa_key -N ''
echo 'Creating SSH server config...'
sed "s,\$PWD,${PWD},;s,\$USER,${USER}," sshd_config.template > sshd_config
echo 'Starting SSH server...'
sudo /usr/sbin/sshd -f sshd_config -D &
sshd_pid=$!
echo "SSH server started successfully (PID: ${sshd_pid})"
echo 'Starting tmux session...'
(cd "${GITHUB_WORKSPACE}" && tmux new-session -d -s debug)
mkdir ~/.cloudflared
CLEAN_TUNNEL_CERT=$(printf '%s\n' "${CLOUDFLARE_TUNNEL_CERT}" | tr -d '\r' | sed '/^[[:space:]]*$/d')
echo "${CLEAN_TUNNEL_CERT}" > ~/.cloudflared/cert.pem
CLEAN_USER_CA_CERT=$(printf '%s\n' "${CLOUDFLARE_USER_CA_CERT}" | tr -d '\r' | sed '/^[[:space:]]*$/d')
echo "${CLEAN_USER_CA_CERT}" | sudo tee /etc/ssh/ca.pub > /dev/null
sudo chmod 644 /etc/ssh/ca.pub
random_suffix=$(openssl rand -hex 5 | cut -c1-10)
tunnel_name="${GITHUB_SHA}-${GITHUB_RUN_ID}-${random_suffix}"
tunnel_url="${tunnel_name}.${CLOUDFLARE_TUNNEL_HOSTNAME}"
if ./cloudflared tunnel list | grep -q "${tunnel_name}"; then
echo "Deleting existing tunnel: ${tunnel_name}"
./cloudflared tunnel delete ${tunnel_name}
fi
echo "Creating new cloudflare tunnel: ${tunnel_name}"
./cloudflared tunnel create ${tunnel_name}
credentials_file=$(find ~/.cloudflared -name "*.json" | head -n 1)
if [ -z "${credentials_file}" ]; then
echo "Error: Could not find tunnel credentials file"
exit 1
fi
echo "Found credentials file: ${credentials_file}"
echo 'Creating tunnel configuration...'
cat > tunnel_config.yml << EOF
tunnel: ${tunnel_name}
credentials-file: ${credentials_file}
ingress:
- hostname: ${tunnel_url}
service: ssh://localhost:2222
- service: http_status:404
EOF
echo 'Setting up DNS routing for tunnel...'
./cloudflared tunnel route dns ${tunnel_name} ${tunnel_url}
echo 'Running cloudflare tunnel...'
./cloudflared tunnel --no-autoupdate --config tunnel_config.yml run 2>&1 | tee cloudflared.log | sed -u 's/^/cloudflared: /' &
cloudflared_pid=$!
echo ::endgroup::
echo ::notice title=SSH Debug Session Ready::ssh ${tunnel_url}
(
echo ' '
echo ' '
echo '🔗 SSH Debug Session Ready!'
echo '━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━'
echo ' '
echo '📋 Infra WG can copy and run this command to connect:'
echo ' '
echo "ssh ${tunnel_url}"
echo ' '
echo "⏰ Session expires automatically in ${TIMEOUT} seconds"
echo '━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━━'
echo ' '
echo ' '
) | cat
echo ::group::Starting Background Session
echo 'Starting SSH session in background...'
./ssh-session.sh "${sshd_pid}" "${cloudflared_pid}" "${TIMEOUT}" "${tunnel_name}" &
echo 'SSH session is running in background. GitHub Action will continue.'
echo 'Session will auto-cleanup after timeout or when processes end.'
echo ::endgroup::

52
.github/actions/ssh-debug/ssh-session.sh vendored Executable file
View File

@@ -0,0 +1,52 @@
#!/bin/bash
SSHD_PID=$1
CLOUDFLARED_PID=$2
SESSION_TIMEOUT=${3:-10000}
TUNNEL_NAME=$4
cleanup() {
# Kill processes.
for pid in "$SLEEP_PID" "$SSHD_PID" "$CLOUDFLARED_PID"; do
if [ -n "$pid" ] && kill -0 "$pid" 2>/dev/null; then
kill "$pid" 2>/dev/null || true
fi
done
# Clean up tunnel.
if [ -n "$TUNNEL_NAME" ]; then
cd "$GITHUB_ACTION_PATH"
./cloudflared tunnel delete "$TUNNEL_NAME" 2>/dev/null || {
echo "Failed to delete tunnel"
}
fi
echo "Session ended at $(date)"
exit 0
}
# Trap signals to ensure cleanup.
trap cleanup SIGTERM SIGINT SIGQUIT SIGHUP EXIT
# Wait for timeout or until processes die.
sleep "$SESSION_TIMEOUT" &
SLEEP_PID=$!
# Monitor processes
while kill -0 "$SLEEP_PID" 2>/dev/null; do
# Check SSH daemon.
if ! kill -0 "$SSHD_PID" 2>/dev/null; then
echo "SSH daemon died at $(date)"
break
fi
# Check cloudflared,
if ! kill -0 "$CLOUDFLARED_PID" 2>/dev/null; then
echo "Cloudflared died at $(date)"
break
fi
sleep 10
done
cleanup

View File

@@ -0,0 +1,25 @@
Port 2222
HostKey $PWD/ssh_host_rsa_key
PidFile $PWD/sshd.pid
# Connection settings
ClientAliveInterval 30
ClientAliveCountMax 10
MaxStartups 10
LoginGraceTime 120
# Allow TCP forwarding for tunneling
AllowTcpForwarding yes
# Try to prevent timeouts
TCPKeepAlive yes
# Security
TrustedUserCAKeys /etc/ssh/ca.pub
PubkeyAuthentication yes
PasswordAuthentication no
AuthorizedPrincipalsCommand /bin/bash -c "echo '%t %k' | ssh-keygen -L -f - | grep -A1 Principals"
AuthorizedPrincipalsCommandUser nobody
PubkeyAcceptedKeyTypes ssh-rsa,ssh-ed25519,ecdsa-sha2-nistp256,ecdsa-sha2-nistp384,ecdsa-sha2-nistp521,ssh-ed25519-cert-v01@openssh.com,ecdsa-sha2-nistp256-cert-v01@openssh.com,ecdsa-sha2-nistp384-cert-v01@openssh.com,ecdsa-sha2-nistp521-cert-v01@openssh.com,rsa-sha2-256-cert-v01@openssh.com,rsa-sha2-512-cert-v01@openssh.com

9
.github/config.yml vendored
View File

@@ -2,6 +2,8 @@
newPRWelcomeComment: |
💖 Thanks for opening this pull request! 💖
### Semantic PR titles
We use [semantic commit messages](https://github.com/electron/electron/blob/main/docs/development/pull-requests.md#commit-message-guidelines) to streamline the release process. Before your pull request can be merged, you should **update your pull request title** to start with a semantic prefix.
Examples of commit messages with semantic prefixes:
@@ -10,6 +12,13 @@ newPRWelcomeComment: |
- `feat: add app.isPackaged() method`
- `docs: app.isDefaultProtocolClient is now available on Linux`
### Commit signing
This repo enforces [commit signatures](https://docs.github.com/en/authentication/managing-commit-signature-verification/signing-commits) for all incoming PRs.
To sign your commits, see GitHub's documentation on [Telling Git about your signing key](https://docs.github.com/en/authentication/managing-commit-signature-verification/telling-git-about-your-signing-key).
### PR tips
Things that will help get your PR across the finish line:
- Follow the JavaScript, C++, and Python [coding style](https://github.com/electron/electron/blob/main/docs/development/coding-style.md).

122
.github/copilot-instructions.md vendored Normal file
View File

@@ -0,0 +1,122 @@
# Copilot Instructions for Electron
## Build System
Electron uses `@electron/build-tools` (`e` CLI). Install with `npm i -g @electron/build-tools`.
```bash
e sync # Fetch sources and apply patches
e build # Build Electron (GN + Ninja)
e build -k 999 # Build, continuing through errors
e start # Run built Electron
e start --version # Verify Electron launches
e test # Run full test suite
e debug # Run in debugger (lldb on macOS, gdb on Linux)
```
### Linting
```bash
npm run lint # Run all linters (JS, C++, Python, GN, docs)
npm run lint:js # JavaScript/TypeScript only
npm run lint:clang-format # C++ formatting only
npm run lint:cpp # C++ linting only
npm run lint:docs # Documentation only
```
### Running a Single Test
```bash
npm run test -- -g "pattern" # Run tests matching a regex pattern
# Example: npm run test -- -g "ipc"
```
### Running a Single Node.js Test
```bash
node script/node-spec-runner.js parallel/test-crypto-keygen
```
## Architecture
Electron embeds Chromium (rendering) and Node.js (backend) to enable desktop apps with web technologies. The parent directory (`../`) is the Chromium source tree.
### Process Model
Electron has two primary process types, mirroring Chromium:
- **Main process** (`shell/browser/` + `lib/browser/`): Controls app lifecycle, creates windows, system APIs
- **Renderer process** (`shell/renderer/` + `lib/renderer/`): Runs web content in BrowserWindows
### Native ↔ JavaScript Bridge
Each API is implemented as a C++/JS pair:
- C++ side: `shell/browser/api/electron_api_{name}.cc/.h` — uses `gin::Wrappable` and `ObjectTemplateBuilder`
- JS side: `lib/browser/api/{name}.ts` — exports the module, registered in `lib/browser/api/module-list.ts`
- Binding: `NODE_LINKED_BINDING_CONTEXT_AWARE(electron_browser_{name}, Initialize)` in C++ and registered in `shell/common/node_bindings.cc`
- Type declaration: `typings/internal-ambient.d.ts` maps `process._linkedBinding('electron_browser_{name}')`
### Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) rather than forking them. Patches live in `patches/` organized by target, with `patches/config.json` mapping directories to repos.
```text
patches/{target}/*.patch → [e sync] → target repo commits
← [e patches] ←
```
Key rules:
- Fix existing patches rather than creating new ones
- Preserve original authorship in TODO comments — never change `TODO(name)` assignees
- Each patch commit message must explain why the patch exists
- After modifying patches, run `e patches {target}` to export
When working on the `roller/chromium/main` branch for Chromium upgrades, use `e sync --3` for 3-way merge conflict resolution.
## Conventions
### File Naming
- JS/TS files: kebab-case (`file-name.ts`)
- C++ files: snake_case with `electron_api_` prefix (`electron_api_safe_storage.cc`)
- Test files: `api-{module-name}-spec.ts` in `spec/`
- Source file lists are maintained in `filenames.gni` (with platform-specific sections)
### JavaScript/TypeScript
- Semicolons required (`"semi": ["error", "always"]`)
- `const` and `let` only (no `var`)
- Arrow functions preferred
- Import order enforced: `@electron/internal``@electron``electron` → external → builtin → relative
- API naming: `PascalCase` for classes (`BrowserWindow`), `camelCase` for module APIs (`globalShortcut`)
- Prefer getters/setters over jQuery-style `.text([text])` patterns
### C++
- Follows Chromium coding style, enforced by `clang-format` and `clang-tidy`
- Uses Chromium abstractions (`base::`, `content::`, etc.)
- Header guards: `#ifndef ELECTRON_SHELL_BROWSER_API_ELECTRON_API_{NAME}_H_`
- Platform-specific files: `_mac.mm`, `_win.cc`, `_linux.cc`
### Testing
- Framework: Mocha + Chai + Sinon
- Test helpers in `spec/lib/` (e.g., `spec-helpers.ts`, `window-helpers.ts`)
- Use `defer()` from spec-helpers for cleanup, `closeAllWindows()` for window teardown
- Tests import from `electron/main` or `electron/renderer`
### Documentation
- API docs in `docs/api/` as Markdown, parsed by `@electron/docs-parser` to generate `electron.d.ts`
- API history tracked via YAML blocks in HTML comments within doc files
- Docs must pass `npm run lint:docs`
### Build Configuration
- `BUILD.gn`: Main GN build config
- `buildflags/buildflags.gni`: Feature flags (PDF viewer, extensions, spellchecker)
- `build/args/`: Build argument profiles (`testing.gn`, `release.gn`, `all.gn`)
- `DEPS`: Dependency versions and checkout paths
- `chromium_src/`: Chromium source file overrides (compiled instead of originals)

View File

@@ -7,3 +7,62 @@ updates:
directory: /
schedule:
interval: weekly
labels:
- "no-backport"
- "semver/none"
target-branch: main
- package-ecosystem: npm
directories:
- /
- /spec
- /npm
schedule:
interval: daily
labels:
- "no-backport"
open-pull-requests-limit: 2
target-branch: main
- package-ecosystem: npm
directories:
- /
- /spec
- /npm
schedule:
interval: daily
labels:
- "backport-check-skip"
open-pull-requests-limit: 0
target-branch: 33-x-y
- package-ecosystem: npm
directories:
- /
- /spec
- /npm
schedule:
interval: daily
labels:
- "backport-check-skip"
open-pull-requests-limit: 0
target-branch: 32-x-y
- package-ecosystem: npm
directories:
- /
- /spec
- /npm
schedule:
interval: daily
labels:
- "backport-check-skip"
open-pull-requests-limit: 0
target-branch: 31-x-y
- package-ecosystem: npm
directories:
- /
- /spec
- /npm
schedule:
interval: daily
labels:
- "backport-check-skip"
open-pull-requests-limit: 0
target-branch: 30-x-y

18
.github/problem-matchers/clang.json vendored Normal file
View File

@@ -0,0 +1,18 @@
{
"problemMatcher": [
{
"owner": "clang",
"fromPath": "src/out/Default/args.gn",
"pattern": [
{
"regexp": "^(.+)[(:](\\d+)[:,](\\d+)\\)?:\\s+(warning|error):\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"severity": 4,
"message": 5
}
]
}
]
}

View File

@@ -0,0 +1,22 @@
{
"problemMatcher": [
{
"owner": "eslint-stylish",
"pattern": [
{
"regexp": "^\\s*([^\\s].*)$",
"file": 1
},
{
"regexp": "^\\s+(\\d+):(\\d+)\\s+(error|warning|info)\\s+(.*)\\s\\s+(.*)$",
"line": 1,
"column": 2,
"severity": 3,
"message": 4,
"code": 5,
"loop": true
}
]
}
]
}

View File

@@ -0,0 +1,16 @@
{
"problemMatcher": [
{
"owner": "markdownlint",
"pattern": [
{
"regexp": "^(.+):(\\d+):(\\d+)\\s+(.*)$",
"file": 1,
"line": 2,
"column": 3,
"message": 4
}
]
}
]
}

View File

@@ -0,0 +1,34 @@
{
"problemMatcher": [
{
"owner": "merge-conflict",
"pattern": [
{
"regexp": "^CONFLICT\\s\\(\\S+\\): (Merge conflict in \\S+)$",
"message": 1
}
]
},
{
"owner": "patch-conflict",
"pattern": [
{
"regexp": "^error: (patch failed: (\\S+):(\\d+))$",
"message": 1,
"file": 2,
"line": 3
}
]
},
{
"owner": "patch-needs-update",
"pattern": [
{
"regexp": "^((patches\/.*): needs update)$",
"message": 1,
"file": 2
}
]
}
]
}

81
.github/workflows/apply-patches.yml vendored Normal file
View File

@@ -0,0 +1,81 @@
name: Apply Patches
on:
pull_request:
permissions: {}
concurrency:
group: apply-patches-${{ github.ref }}
cancel-in-progress: true
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: read
outputs:
has-patches: ${{ steps.filter.outputs.patches }}
steps:
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
persist-credentials: false
ref: ${{ github.event.pull_request.head.sha }}
# Use dorny/paths-filter instead of the path filter under the on: pull_request: block
# so that the output can be used to conditionally run the apply-patches job, which lets
# the job be marked as a required status check (conditional skip counts as a success).
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
id: filter
with:
filters: |
patches:
- DEPS
- 'patches/**'
apply-patches:
needs: setup
if: ${{ needs.setup.outputs.has-patches == 'true' }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:eac3529546ea8f3aa356d31e345715eef342233b
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
persist-credentials: false
ref: ${{ github.event.pull_request.base.ref }}
- name: Merge PR HEAD
working-directory: src/electron
env:
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
git config user.email "electron@github.com"
git config user.name "Electron Bot"
git fetch origin refs/pull/${PR_NUMBER}/head
git merge --squash FETCH_HEAD
git commit -n -m "Squashed commits"
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux
- name: Upload Patch Conflict Fix
if: ${{ failure() }}
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f # v7.0.0
with:
name: update-patches
path: patches/update-patches.patch
if-no-files-found: ignore
archive: false

View File

@@ -3,15 +3,23 @@ name: Archaeologist
on:
pull_request:
permissions: {}
jobs:
archaeologist-dig:
name: Archaeologist Dig
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332 #v4.0.2
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
fetch-depth: 0
- name: Setup Node.js/npm
uses: actions/setup-node@53b83947a5a98c8d113130e565377fae1a50d02f
with:
node-version: 24.12.x
- name: Setting Up Dig Site
run: |
echo "remote: ${{ github.event.pull_request.head.repo.clone_url }}"
@@ -37,7 +45,7 @@ jobs:
sha-file: .dig-old
filename: electron.old.d.ts
- name: Upload artifacts
uses: actions/upload-artifact@50769540e7f4bd5e21e526ee35c689e35e0d6874 #v4.4.0
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: artifacts
path: electron/artifacts

162
.github/workflows/audit-branch-ci.yml vendored Normal file
View File

@@ -0,0 +1,162 @@
name: Audit CI on Branches
on:
workflow_dispatch:
schedule:
# Run every 2 hours
- cron: '0 */2 * * *'
permissions: {}
jobs:
audit_branch_ci:
name: Audit CI on Branches
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Setup Node.js
uses: actions/setup-node@53b83947a5a98c8d113130e565377fae1a50d02f # v6.3.0
with:
node-version: 22.17.x
- name: Sparse checkout repository
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: audit-errors
with:
github-token: ${{ secrets.GITHUB_TOKEN }}
script: |
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const cache = require('@actions/cache');
const { ElectronVersions } = require('@electron/fiddle-core');
const runsWithErrors = [];
// Only want the most recent workflow run that wasn't skipped or cancelled
const isValidWorkflowRun = (run) => !['skipped', 'cancelled'].includes(run.conclusion);
const versions = await ElectronVersions.create({ ignoreCache: true });
const branches = versions.supportedMajors.map((branch) => `${branch}-x-y`);
for (const branch of ["main", ...branches]) {
const latestCheckRuns = new Map();
const allCheckRuns = await github.paginate(github.rest.checks.listForRef, {
owner: "electron",
repo: "electron",
ref: branch,
status: 'completed',
});
// Sort the check runs by completed_at so that multiple check runs on the
// same ref (like a scheduled workflow) only looks at the most recent one
for (const checkRun of allCheckRuns.filter(
(run) => !['skipped', 'cancelled'].includes(run.conclusion),
).sort((a, b) => new Date(b.completed_at) - new Date(a.completed_at))) {
if (!latestCheckRuns.has(checkRun.name)) {
latestCheckRuns.set(checkRun.name, checkRun);
}
}
// Check for runs which had error annotations
for (const checkRun of Array.from(latestCheckRuns.values())) {
if (checkRun.name === "Audit CI on Branches") {
continue; // Skip the audit workflow itself
}
const annotations = (await github.rest.checks.listAnnotations({
owner: "electron",
repo: "electron",
check_run_id: checkRun.id,
})).data ?? [];
if (
annotations.find(
({ annotation_level, message }) =>
annotation_level === "failure" &&
!message.startsWith("Process completed with exit code") &&
!message.startsWith("Response status code does not indicate success") &&
!message.startsWith("The hosted runner lost communication with the server") &&
!message.startsWith("Dependabot encountered an error performing the update") &&
!/Unable to make request/.test(message) &&
!/The requested URL returned error/.test(message),
)
) {
checkRun.hasErrorAnnotations = true;
} else {
continue;
}
// Check if this is a known failure from a previous audit run
const cacheKey = `check-run-error-annotations-${checkRun.id}`;
const cacheHit =
(await cache.restoreCache(['/dev/null'], cacheKey, undefined, {
lookupOnly: true,
})) !== undefined;
if (cacheHit) {
checkRun.isStale = true;
}
checkRun.branch = branch;
runsWithErrors.push(checkRun);
// Create a cache entry (only the name matters) to keep track of
// failures we've seen from previous runs to mark them as stale
if (!cacheHit) {
await cache.saveCache(['/dev/null'], cacheKey);
}
}
}
if (runsWithErrors.length > 0) {
core.summary.addHeading('⚠️ Runs with Errors');
core.summary.addTable([
[
{ data: 'Branch', header: true },
{ data: 'Workflow Run', header: true },
{ data: 'Status', header: true },
],
...runsWithErrors
.sort(
(a, b) =>
a.branch.localeCompare(b.branch) ||
a.name.localeCompare(b.name),
)
.map((run) => [
run.branch,
`<a href="${run.html_url}">${run.name}</a>`,
run.isStale
? '📅 Stale'
: run.hasErrorAnnotations
? '⚠️ Errors'
: '✅ Succeeded',
]),
]);
// Set this as failed so it's easy to scan runs to find failures
if (runsWithErrors.find((run) => !run.isStale)) {
core.setOutput('errorsFound', true);
process.exitCode = 1;
}
} else {
core.summary.addRaw('🎉 No runs with errors');
}
await core.summary.write();
- name: Send Slack message if errors
if: ${{ always() && steps.audit-errors.outputs.errorsFound && github.ref == 'refs/heads/main' }}
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
with:
payload: |
link: "https://github.com/${{ github.repository }}/actions/runs/${{ github.run_id }}"
webhook: ${{ secrets.CI_ERRORS_SLACK_WEBHOOK_URL }}
webhook-type: webhook-trigger

View File

@@ -14,7 +14,7 @@ permissions: {}
jobs:
release-branch-created:
name: Release Branch Created
if: ${{ github.event_name == 'workflow_dispatch' || (github.event.ref_type == 'branch' && endsWith(github.event.ref, '-x-y') && !startsWith(github.event.ref, 'roller')) }}
if: ${{ github.repository == 'electron/electron' && (github.event_name == 'workflow_dispatch' || (github.event.ref_type == 'branch' && endsWith(github.event.ref, '-x-y') && !startsWith(github.event.ref, 'roller'))) }}
permissions:
contents: read
pull-requests: write
@@ -23,22 +23,53 @@ jobs:
steps:
- name: Determine Major Version
id: check-major-version
env:
BRANCH_NAME: ${{ github.event.inputs.branch-name || github.event.ref }}
run: |
if [[ ${{ github.event.inputs.branch-name || github.event.ref }} =~ ^([0-9]+)-x-y$ ]]; then
if [[ "$BRANCH_NAME" =~ ^([0-9]+)-x-y$ ]]; then
echo "MAJOR=${BASH_REMATCH[1]}" >> "$GITHUB_OUTPUT"
else
echo "Not a release branch: ${{ github.event.inputs.branch-name || github.event.ref }}"
echo "Not a release branch: $BRANCH_NAME"
fi
- name: Determine Unsupported Major Version
id: determine-unsupported-major
if: ${{ steps.check-major-version.outputs.MAJOR }}
env:
MAJOR: ${{ steps.check-major-version.outputs.MAJOR }}
run: |
# Fetch the release schedule
SCHEDULE=$(curl -s https://releases.electronjs.org/schedule.json)
# Get the stableDate for the current major version
STABLE_DATE=$(echo "$SCHEDULE" | jq -r --arg major "${MAJOR}.0.0" '.[] | select(.version == $major) | .stableDate')
if [[ -z "$STABLE_DATE" || "$STABLE_DATE" == "null" ]]; then
echo "Could not find stableDate for version $MAJOR"
exit 1
fi
# Find the oldest version where eolDate >= stableDate of the new major
# This gives us the oldest supported version when the new major goes stable
UNSUPPORTED_MAJOR=$(echo "$SCHEDULE" | jq -r --arg stableDate "$STABLE_DATE" '
[.[] | select(.eolDate != null and .eolDate >= $stableDate)] | sort_by(.version | split(".")[0] | tonumber) | first | .version | split(".")[0]
')
if [[ -z "$UNSUPPORTED_MAJOR" || "$UNSUPPORTED_MAJOR" == "null" ]]; then
echo "Could not determine oldest supported version"
exit 1
fi
echo "SCHEDULE=$SCHEDULE" >> "$GITHUB_OUTPUT"
echo "UNSUPPORTED_MAJOR=$UNSUPPORTED_MAJOR" >> "$GITHUB_OUTPUT"
- name: New Release Branch Tasks
if: ${{ steps.check-major-version.outputs.MAJOR }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
GH_REPO: electron/electron
MAJOR: ${{ steps.check-major-version.outputs.MAJOR }}
NUM_SUPPORTED_VERSIONS: 3
UNSUPPORTED_MAJOR: ${{ steps.determine-unsupported-major.outputs.UNSUPPORTED_MAJOR }}
run: |
PREVIOUS_MAJOR=$((MAJOR - 1))
UNSUPPORTED_MAJOR=$((MAJOR - NUM_SUPPORTED_VERSIONS - 1))
# Create new labels
gh label create $MAJOR-x-y --color 8d9ee8 || true
@@ -66,21 +97,45 @@ jobs:
done
- name: Generate GitHub App token
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
org: electron
- name: Generate Release Project Board Metadata
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: generate-project-metadata
env:
MAJOR: ${{ steps.check-major-version.outputs.MAJOR }}
UNSUPPORTED_MAJOR: ${{ steps.determine-unsupported-major.outputs.UNSUPPORTED_MAJOR }}
SCHEDULE: ${{ steps.determine-unsupported-major.outputs.SCHEDULE }}
with:
script: |
const major = ${{ steps.check-major-version.outputs.MAJOR }}
const schedule = JSON.parse(process.env.SCHEDULE)
const major = parseInt(process.env.MAJOR)
const nextMajor = major + 1
const prevMajor = major - 1
const { betaDate, stableDate } = schedule.find(v => v.version === `${major}.0.0`)
const betaPrepWeek = new Date(betaDate)
betaPrepWeek.setDate(betaPrepWeek.getDate() - 8)
const betaPrepWeekEnd = new Date(betaPrepWeek)
betaPrepWeekEnd.setDate(betaPrepWeekEnd.getDate() + 4)
const stablePrepWeek = new Date(stableDate)
stablePrepWeek.setDate(stablePrepWeek.getDate() - 8)
const stablePrepWeekEnd = new Date(stablePrepWeek)
stablePrepWeekEnd.setDate(stablePrepWeekEnd.getDate() + 4)
const stableWeek = new Date(stableDate)
stableWeek.setDate(stableWeek.getDate() - 1)
const nextAlphaDate = new Date(stableDate)
nextAlphaDate.setDate(nextAlphaDate.getDate() + 2)
core.setOutput("major", major)
core.setOutput("next-major", nextMajor)
core.setOutput("prev-major", prevMajor)
@@ -89,10 +144,19 @@ jobs:
major,
"next-major": nextMajor,
"prev-major": prevMajor,
"ending-support-major": parseInt(process.env.UNSUPPORTED_MAJOR),
"beta-date": betaDate,
"beta-prep-week": betaPrepWeek.toISOString().split('T')[0],
"beta-prep-week-end": betaPrepWeekEnd.toISOString().split('T')[0],
"stable-week": stableWeek.toISOString().split('T')[0],
"stable-prep-week": stablePrepWeek.toISOString().split('T')[0],
"stable-prep-week-end": stablePrepWeekEnd.toISOString().split('T')[0],
"stable-date": stableDate,
"next-alpha-date": nextAlphaDate.toISOString().split('T')[0],
}))
- name: Create Release Project Board
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: dsanders11/project-actions/copy-project@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/copy-project@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
id: create-release-board
with:
drafts: true
@@ -112,14 +176,15 @@ jobs:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
- name: Find Previous Release Project Board
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: dsanders11/project-actions/find-project@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/find-project@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
id: find-prev-release-board
with:
fail-if-project-not-found: false
title: ${{ steps.generate-project-metadata.outputs.prev-prev-major }}-x-y
token: ${{ steps.generate-token.outputs.token }}
- name: Close Previous Release Project Board
if: ${{ steps.check-major-version.outputs.MAJOR }}
uses: dsanders11/project-actions/close-project@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
if: ${{ steps.find-prev-release-board.outputs.number }}
uses: dsanders11/project-actions/close-project@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
project-number: ${{ steps.find-prev-release-board.outputs.number }}
token: ${{ steps.generate-token.outputs.token }}

85
.github/workflows/build-git-cache.yml vendored Normal file
View File

@@ -0,0 +1,85 @@
name: Build Git Cache
# This workflow updates git cache on the cross-instance cache volumes
# It runs daily at midnight.
on:
schedule:
- cron: "0 0 * * *"
permissions: {}
jobs:
build-git-cache-linux:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:eac3529546ea8f3aa356d31e345715eef342233b
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Build Git Cache
uses: ./src/electron/.github/actions/build-git-cache
with:
target-platform: linux
build-git-cache-windows:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:eac3529546ea8f3aa356d31e345715eef342233b
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_win=True'
TARGET_OS: 'win'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Build Git Cache
uses: ./src/electron/.github/actions/build-git-cache
with:
target-platform: win
build-git-cache-macos:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
# This job updates the same git cache as linux, so it needs to run after the linux one.
needs: build-git-cache-linux
container:
image: ghcr.io/electron/build:eac3529546ea8f3aa356d31e345715eef342233b
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Build Git Cache
uses: ./src/electron/.github/actions/build-git-cache
with:
target-platform: macos

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'bc2f48b2415a670de18d13605b1cf0eb5fdbaae1'
default: 'eac3529546ea8f3aa356d31e345715eef342233b'
required: true
skip-macos:
type: boolean
@@ -18,21 +18,39 @@ on:
description: 'Skip Linux builds'
default: false
required: false
skip-windows:
type: boolean
description: 'Skip Windows builds'
default: false
required: false
skip-lint:
type: boolean
description: 'Skip lint check'
default: false
required: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
push:
branches:
- main
- '[1-9][0-9]-x-y'
pull_request:
defaults:
run:
shell: bash
permissions: {}
jobs:
setup:
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
contents: read
pull-requests: read
outputs:
docs: ${{ steps.filter.outputs.docs }}
@@ -40,20 +58,26 @@ jobs:
build-image-sha: ${{ steps.set-output.outputs.build-image-sha }}
docs-only: ${{ steps.set-output.outputs.docs-only }}
steps:
- uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332 #v4.0.2
- uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
ref: ${{ github.event.pull_request.head.sha }}
- uses: dorny/paths-filter@de90cc6fb38fc0963ad72b210f1f284cd68cea36 # v3.0.2
id: filter
with:
filters: |
docs:
- 'docs/**'
- README.md
- SECURITY.md
- CONTRIBUTING.md
- CODE_OF_CONDUCT.md
src:
- '!docs/**'
- name: Set Outputs for Build Image SHA & Docs Only
id: set-output
run: |
if [ -z "${{ inputs.build-image-sha }}" ]; then
echo "build-image-sha=bc2f48b2415a670de18d13605b1cf0eb5fdbaae1" >> "$GITHUB_OUTPUT"
echo "build-image-sha=eac3529546ea8f3aa356d31e345715eef342233b" >> "$GITHUB_OUTPUT"
else
echo "build-image-sha=${{ inputs.build-image-sha }}" >> "$GITHUB_OUTPUT"
fi
@@ -64,24 +88,30 @@ jobs:
needs: setup
if: ${{ !inputs.skip-lint }}
uses: ./.github/workflows/pipeline-electron-lint.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
secrets: inherit
# Docs Only Jobs
docs-only:
needs: setup
needs: [setup, checkout-linux]
if: ${{ needs.setup.outputs.docs-only == 'true' }}
uses: ./.github/workflows/pipeline-electron-docs-only.yml
permissions:
contents: read
with:
container: '{"image":"ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}","options":"--user root"}'
container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
secrets: inherit
# Checkout Jobs
checkout-macos:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-macos}}
runs-on: electron-arc-linux-amd64-32core
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -89,24 +119,29 @@ jobs:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
outputs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
generate-sas-token: 'true'
target-platform: macos
checkout-linux:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-linux}}
runs-on: electron-arc-linux-amd64-32core
if: ${{ !inputs.skip-linux}}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root
@@ -114,18 +149,96 @@ jobs:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
PATCH_UP_APP_CREDS: ${{ secrets.PATCH_UP_APP_CREDS }}
outputs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
target-platform: linux
checkout-windows:
needs: setup
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ needs.setup.outputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_win=True'
TARGET_OS: 'win'
ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN: '1'
outputs:
build-image-sha: ${{ needs.setup.outputs.build-image-sha}}
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
generate-sas-token: 'true'
target-platform: win
# GN Check Jobs
macos-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-macos
with:
target-platform: macos
target-archs: x64 arm64
check-runs-on: macos-15
gn-build-type: testing
secrets: inherit
linux-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
target-platform: linux
target-archs: x64 arm arm64
check-runs-on: electron-arc-centralus-linux-amd64-8core
check-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
gn-build-type: testing
secrets: inherit
windows-gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
permissions:
contents: read
needs: checkout-windows
with:
target-platform: win
target-archs: x64 x86 arm64
check-runs-on: electron-arc-centralus-linux-amd64-8core
check-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-windows.outputs.build-image-sha }}","options":"--user root --device /dev/fuse --cap-add SYS_ADMIN","volumes":["/mnt/win-cache:/mnt/win-cache"]}'
gn-build-type: testing
secrets: inherit
# Build Jobs - These cascade into testing jobs
macos-x64:
@@ -136,15 +249,15 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
check-runs-on: macos-14
test-runs-on: macos-13
build-runs-on: macos-15-xlarge
test-runs-on: macos-15-large
target-platform: macos
target-arch: x64
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
enable-ssh: ${{ inputs.enable-ssh || false }}
secrets: inherit
macos-arm64:
@@ -155,15 +268,15 @@ jobs:
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-macos
with:
build-runs-on: macos-14-xlarge
check-runs-on: macos-14
test-runs-on: macos-14
build-runs-on: macos-15-xlarge
test-runs-on: macos-15
target-platform: macos
target-arch: arm64
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
enable-ssh: ${{ inputs.enable-ssh || false }}
secrets: inherit
linux-x64:
@@ -171,13 +284,15 @@ jobs:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test-and-nan.yml
uses: ./.github/workflows/pipeline-electron-build-and-tidy-and-test-and-nan.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
check-runs-on: electron-arc-linux-amd64-8core
test-runs-on: electron-arc-linux-amd64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
clang-tidy-runs-on: electron-arc-centralus-linux-amd64-8core
test-runs-on: electron-arc-centralus-linux-amd64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
clang-tidy-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
target-arch: x64
@@ -194,10 +309,10 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
check-runs-on: electron-arc-linux-amd64-8core
test-runs-on: electron-arc-linux-amd64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-amd64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
@@ -216,12 +331,12 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
check-runs-on: electron-arc-linux-amd64-8core
test-runs-on: electron-arc-linux-arm64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: electron-arc-centralus-linux-arm64-4core
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
test-container: '{"image":"ghcr.io/electron/test:arm32v7-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init --memory=12g","volumes":["/home/runner/externals:/mnt/runner-externals"]}'
target-platform: linux
target-arch: arm
is-release: false
@@ -237,10 +352,10 @@ jobs:
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-linux
if: ${{ needs.setup.outputs.src == 'true' }}
with:
build-runs-on: electron-arc-linux-amd64-32core
check-runs-on: electron-arc-linux-amd64-8core
test-runs-on: electron-arc-linux-arm64-4core
build-runs-on: electron-arc-centralus-linux-amd64-32core
test-runs-on: ubuntu-22.04-arm
build-container: '{"image":"ghcr.io/electron/build:${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
test-container: '{"image":"ghcr.io/electron/test:arm64v8-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
target-platform: linux
@@ -250,13 +365,111 @@ jobs:
generate-symbols: false
upload-to-storage: '0'
secrets: inherit
test-linux-arm64-64k:
uses: ./.github/workflows/pipeline-segment-electron-test-64k.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: [checkout-linux, linux-arm64]
with:
test-runs-on: ubuntu-22.04-arm
test-container: '{"image":"ghcr.io/electron/test:arm64v8-${{ needs.checkout-linux.outputs.build-image-sha }}","options":"--user root --privileged --init"}'
secrets: inherit
windows-x64:
permissions:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-windows
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-centralus-windows-amd64-16core
test-runs-on: windows-latest
target-platform: win
target-arch: x64
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
secrets: inherit
windows-x86:
permissions:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-windows
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-centralus-windows-amd64-16core
test-runs-on: windows-latest
target-platform: win
target-arch: x86
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
secrets: inherit
windows-arm64:
permissions:
contents: read
issues: read
pull-requests: read
uses: ./.github/workflows/pipeline-electron-build-and-test.yml
needs: checkout-windows
if: ${{ needs.setup.outputs.src == 'true' && !inputs.skip-windows }}
with:
build-runs-on: electron-arc-centralus-windows-amd64-16core
test-runs-on: windows-11-arm
target-platform: win
target-arch: arm64
is-release: false
gn-build-type: testing
generate-symbols: false
upload-to-storage: '0'
secrets: inherit
gha-done:
name: GitHub Actions Completed
runs-on: ubuntu-latest
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64]
if: always() && !contains(needs.*.result, 'failure')
permissions:
contents: read
needs: [docs-only, macos-x64, macos-arm64, linux-x64, linux-x64-asan, linux-arm, linux-arm64, windows-x64, windows-x86, windows-arm64]
if: always() && github.repository == 'electron/electron' && !contains(needs.*.result, 'failure')
steps:
- name: GitHub Actions Jobs Done
run: |
echo "All GitHub Actions Jobs are done"
check-signed-commits:
name: Check signed commits in green PR
needs: gha-done
if: ${{ contains(github.event.pull_request.labels.*.name, 'needs-signed-commits')}}
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: write
steps:
- name: Check signed commits in PR
uses: 1Password/check-signed-commits-action@ed2885f3ed2577a4f5d3c3fe895432a557d23d52 # v1
with:
comment: |
⚠️ This PR contains unsigned commits. This repository enforces [commit signatures](https://docs.github.com/en/authentication/managing-commit-signature-verification)
for all incoming PRs. To get your PR merged, please sign those commits
(`git rebase --exec 'git commit -S --amend --no-edit -n' @{upstream}`) and force push them to this branch
(`git push --force-with-lease`)
For more information on signing commits, see GitHub's documentation on [Telling Git about your signing key](https://docs.github.com/en/authentication/managing-commit-signature-verification/telling-git-about-your-signing-key).
- name: Remove needs-signed-commits label
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
gh pr edit $PR_URL --remove-label needs-signed-commits

View File

@@ -1,21 +1,34 @@
name: Clean Source Cache
# Description:
# This workflow cleans up the source cache on the cross-instance cache volume
# to free up space. It runs daily at midnight and clears files older than 15 days.
on:
schedule:
- cron: "0 0 * * SUN" # Run at midnight every Sunday
- cron: "0 0 * * *"
permissions: {}
jobs:
clean-src-cache:
runs-on: electron-arc-linux-amd64-32core
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:bc2f48b2415a670de18d13605b1cf0eb5fdbaae1
options: --user root
volumes:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /mnt/win-cache:/mnt/win-cache
steps:
- name: Cleanup Source Cache
shell: bash
run: |
df -h /mnt/cross-instance-cache
find /mnt/cross-instance-cache -type f -mtime +30 -delete
find /mnt/cross-instance-cache -type f -mtime +15 -delete
df -h /mnt/cross-instance-cache
df -h /mnt/win-cache
find /mnt/win-cache -type f -mtime +15 -delete
df -h /mnt/win-cache

View File

@@ -1,14 +0,0 @@
diff --git a/gclient.py b/gclient.py
index 59e2b4c5197928bdba1ef69bdbe637d7dfe471c1..b4bae5e48c83c84bd867187afaf40eed16e69851 100755
--- a/gclient.py
+++ b/gclient.py
@@ -783,7 +783,8 @@ class Dependency(gclient_utils.WorkItem, DependencySettings):
not condition or "non_git_source" not in condition):
continue
cipd_root = self.GetCipdRoot()
- for package in dep_value.get('packages', []):
+ packages = dep_value.get('packages', [])
+ for package in (x for x in packages if "infra/3pp/tools/swift-format" not in x.get('package')):
deps_to_add.append(
CipdDependency(parent=self,
name=name,

View File

@@ -1,4 +1,4 @@
name: Issue Commented
name: Issue / Pull Request Commented
on:
issue_comment:
@@ -8,19 +8,81 @@ on:
permissions: {}
jobs:
issue-commented:
name: Remove blocked/need-repro on comment
if: ${{ contains(github.event.issue.labels.*.name, 'blocked/need-repro') && !contains(fromJSON('["MEMBER", "OWNER"]'), github.event.comment.author_association) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-latest
blocked-issue-commented:
name: Remove blocked/{need-info,need-repro} on comment
if: ${{ !github.event.issue.pull_request && (contains(github.event.issue.labels.*.name, 'blocked/need-repro') || contains(github.event.issue.labels.*.name, 'blocked/need-info ❌')) && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-slim
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: &get-author-association |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/issues/comments/${{ github.event.comment.id }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Remove label
if: ${{ !contains(fromJSON('["MEMBER", "OWNER", "COLLABORATOR"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
ISSUE_URL: ${{ github.event.issue.html_url }}
run: |
gh issue edit $ISSUE_URL --remove-label 'blocked/need-repro'
gh issue edit $ISSUE_URL --remove-label 'blocked/need-repro','blocked/need-info ❌'
pr-reviewer-requested:
name: Maintainer requested reviewer on PR
if: ${{ github.event.issue.pull_request && startsWith(github.event.comment.body, '/request-review') && github.event.comment.user.type != 'Bot' }}
runs-on: ubuntu-slim
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: *get-author-association
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
if: ${{ contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Request reviewer
if: ${{ contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
PR_URL: ${{ github.event.issue.html_url }}
COMMENT_BODY: ${{ github.event.comment.body }}
run: |
RAW=$(echo "$COMMENT_BODY" | head -n 1 | sed 's|/request-review\s*||' | xargs)
if [ -z "$RAW" ]; then
echo "::warning::No username provided. Usage: /request-review <username>[,<username>,...]"
exit 0
fi
IFS=',' read -ra USERS <<< "$RAW"
for USER in "${USERS[@]}"; do
NAME=$(echo "$USER" | sed 's/@//g' | xargs)
if [ -z "$NAME" ]; then
continue
fi
# Strip "electron/" prefix if present to get the bare name
BARE_NAME=$(echo "$NAME" | sed 's|^electron/||')
# If the original name contained "electron/" or looks like a team slug, treat as team
if [ "$NAME" != "$BARE_NAME" ]; then
gh pr edit $PR_URL --add-reviewer "electron/$BARE_NAME"
else
if ! gh api /orgs/electron/public_members/$BARE_NAME --silent > /dev/null 2>&1; then
echo "::warning::$BARE_NAME is not a public member of the electron organization."
continue
fi
gh pr edit $PR_URL --add-reviewer "$BARE_NAME"
fi
done

View File

@@ -4,46 +4,51 @@ on:
issues:
types: [labeled]
permissions: # added using https://github.com/step-security/secure-workflows
contents: read
permissions: {}
jobs:
issue-labeled-with-status:
name: status/{confirmed,reviewed} label added
if: github.event.label.name == 'status/confirmed' || github.event.label.name == 'status/reviewed'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Set status
uses: dsanders11/project-actions/edit-item@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90
field: Status
field-value: ✅ Triaged
fail-if-item-not-found: false
issue-labeled-blocked:
name: blocked/* label added
if: startsWith(github.event.label.name, 'blocked/')
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Set status
uses: dsanders11/project-actions/edit-item@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90
field: Status
field-value: 🛑 Blocked
fail-if-item-not-found: false
issue-labeled-blocked-need-repro:
name: blocked/need-repro label added
if: github.event.label.name == 'blocked/need-repro'
@@ -64,13 +69,13 @@ jobs:
fi
- name: Generate GitHub App token
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
if: ${{ steps.check-for-comment.outputs.SHOULD_COMMENT }}
uses: actions-cool/issues-helper@a610082f8ac0cf03e357eb8dd0d5e2ba075e017e # v3.6.0
uses: actions-cool/issues-helper@71b62d7da76e59ff7b193904feb6e77d4dbb2777 # v3.7.6
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}

View File

@@ -11,15 +11,16 @@ jobs:
add-to-issue-triage:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Add to Issue Triage
uses: dsanders11/project-actions/add-item@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/add-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
field: Reporter
field-value: ${{ github.event.issue.user.login }}
@@ -28,24 +29,37 @@ jobs:
set-labels:
if: ${{ contains(github.event.issue.labels.*.name, 'bug :beetle:') }}
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- run: npm install mdast-util-from-markdown@2.0.0 unist-util-select@5.1.0 semver@7.6.0
- name: Sparse checkout repository
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.
.github
.yarn
- run: yarn workspaces focus @electron/gha-workflows
- name: Add labels
uses: actions/github-script@60a0d83039c74a4aee543508d2ffcb1c3799cdea # v7.0.1
uses: actions/github-script@ed597411d8f924073f98dfc5c65a23a2325f34cd # v8.0.0
id: add-labels
env:
ISSUE_BODY: ${{ github.event.issue.body }}
with:
github-token: ${{ steps.generate-token.outputs.token }}
script: |
const { fromMarkdown } = await import('${{ github.workspace }}/node_modules/mdast-util-from-markdown/index.js');
const { select } = await import('${{ github.workspace }}/node_modules/unist-util-select/index.js');
const semver = await import('${{ github.workspace }}/node_modules/semver/index.js');
const { chdir } = require('node:process');
chdir('${{ github.workspace }}/.github/workflows');
const { ElectronVersions } = require('@electron/fiddle-core');
const { fromMarkdown } = require('mdast-util-from-markdown');
const { select } = require('unist-util-select');
const semver = require('semver');
const [ owner, repo ] = '${{ github.repository }}'.split('/');
const issue_number = ${{ github.event.issue.number }};
@@ -56,24 +70,65 @@ jobs:
const electronVersion = select('heading:has(> text[value="Electron Version"]) + paragraph > text', tree)?.value.trim();
if (electronVersion !== undefined) {
const major = semver.parse(electronVersion)?.major;
if (major) {
const versionLabel = `${major}-x-y`;
let labelExists = false;
// It's possible for multiple versions to be listed -
// for now check for comma or space separated version.
const versions = electronVersion.split(/, | /);
let hasSupportedVersion = false;
try {
await github.rest.issues.getLabel({
owner,
repo,
name: versionLabel,
});
labelExists = true;
} catch {}
for (const version of versions) {
const major = semver.coerce(version, { loose: true })?.major;
if (major) {
const versionLabel = `${major}-x-y`;
let labelExists = false;
if (labelExists) {
labels.push(versionLabel);
try {
await github.rest.issues.getLabel({
owner,
repo,
name: versionLabel,
});
labelExists = true;
} catch {}
const electronVersions = await ElectronVersions.create(undefined, { ignoreCache: true });
const validVersions = [...electronVersions.supportedMajors, ...electronVersions.prereleaseMajors];
if (validVersions.includes(major)) {
hasSupportedVersion = true;
if (labelExists) {
labels.push(versionLabel);
}
}
}
}
if (!hasSupportedVersion) {
core.setOutput('unsupportedMajor', true);
labels.push('blocked/need-info ❌');
}
}
const operatingSystems = select('heading:has(> text[value="What operating system(s) are you using?"]) + paragraph > text', tree)?.value.trim().split(', ');
const platformLabels = new Set();
for (const operatingSystem of (operatingSystems ?? [])) {
switch (operatingSystem) {
case 'Windows':
platformLabels.add('platform/windows');
break;
case 'macOS':
platformLabels.add('platform/macOS');
break;
case 'Ubuntu':
case 'Other Linux':
platformLabels.add('platform/linux');
break;
}
}
if (platformLabels.size === 3) {
labels.push('platform/all');
} else {
labels.push(...platformLabels);
}
const gistUrl = select('heading:has(> text[value="Testcase Gist URL"]) + paragraph > text', tree)?.value.trim();
@@ -89,3 +144,17 @@ jobs:
labels,
});
}
- name: Create unsupported major comment
if: ${{ steps.add-labels.outputs.unsupportedMajor }}
uses: actions-cool/issues-helper@71b62d7da76e59ff7b193904feb6e77d4dbb2777 # v3.7.6
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}
body: |
<!-- end-of-life -->
Hello @${{ github.event.issue.user.login }}. Thanks for reporting this and helping to make Electron better!
The version of Electron reported in this issue has reached end-of-life and is [no longer supported](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline). If you're still experiencing this issue on a [supported version](https://www.electronjs.org/releases/stable) of Electron, please update this issue to reflect that version of Electron.
Now adding the https://github.com/electron/electron/labels/blocked%2Fneed-info%20%E2%9D%8C label for this reason. This issue will be closed in 10 days if the above is not addressed.

28
.github/workflows/issue-transferred.yml vendored Normal file
View File

@@ -0,0 +1,28 @@
name: Issue Transferred
on:
issues:
types: [transferred]
permissions: {}
jobs:
issue-transferred:
name: Issue Transferred
runs-on: ubuntu-latest
permissions: {}
if: ${{ !github.event.changes.new_repository.private }}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Remove from issue triage
uses: dsanders11/project-actions/delete-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90
item: ${{ github.event.changes.new_issue.html_url }}
fail-if-item-not-found: false

View File

@@ -4,14 +4,15 @@ on:
issues:
types: [unlabeled]
permissions:
contents: read
permissions: {}
jobs:
issue-unlabeled-blocked:
name: All blocked/* labels removed
if: startsWith(github.event.label.name, 'blocked/') && github.event.issue.state == 'open'
runs-on: ubuntu-latest
permissions:
contents: read
steps:
- name: Check for any blocked labels
id: check-for-blocked-labels
@@ -23,16 +24,17 @@ jobs:
fi
- name: Generate GitHub App token
if: ${{ steps.check-for-blocked-labels.outputs.NOT_BLOCKED }}
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
org: electron
- name: Set status
if: ${{ steps.check-for-blocked-labels.outputs.NOT_BLOCKED }}
uses: dsanders11/project-actions/edit-item@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 90
field: Status
field-value: 📥 Was Blocked
fail-if-item-not-found: false

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'bc2f48b2415a670de18d13605b1cf0eb5fdbaae1'
default: 'eac3529546ea8f3aa356d31e345715eef342233b'
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
@@ -17,9 +17,14 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-linux:
runs-on: electron-arc-linux-amd64-32core
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -27,10 +32,11 @@ jobs:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True'
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -38,49 +44,61 @@ jobs:
uses: ./src/electron/.github/actions/checkout
publish-x64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
build-runs-on: electron-arc-linux-amd64-32core
build-runs-on: electron-arc-centralus-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ inputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
target-platform: linux
target-arch: x64
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
publish-arm:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
build-runs-on: electron-arc-linux-amd64-32core
build-runs-on: electron-arc-centralus-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ inputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
target-platform: linux
target-arch: arm
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
publish-arm64:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-linux
with:
environment: production-release
build-runs-on: electron-arc-linux-amd64-32core
build-runs-on: electron-arc-centralus-linux-amd64-32core
build-container: '{"image":"ghcr.io/electron/build:${{ inputs.build-image-sha }}","options":"--user root","volumes":["/mnt/cross-instance-cache:/mnt/cross-instance-cache"]}'
target-platform: linux
target-arch: arm64
is-release: true
gn-build-type: release
generate-symbols: true
strip-binaries: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
secrets: inherit

105
.github/workflows/macos-disk-cleanup.yml vendored Normal file
View File

@@ -0,0 +1,105 @@
name: macOS Disk Space Cleanup
# Description:
# This workflow runs the disk space reclaimer on macOS runners every night
# and logs disk space metrics to Datadog for monitoring.
on:
schedule:
- cron: "0 0 * * *"
workflow_dispatch:
permissions: {}
jobs:
macos-disk-cleanup:
if: github.repository == 'electron/electron'
strategy:
fail-fast: false
matrix:
runner:
- macos-15
- macos-15-large
- macos-15-xlarge
runs-on: ${{ matrix.runner }}
permissions:
contents: read
steps:
- name: Checkout
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
sparse-checkout: |
.github/actions/free-space-macos
sparse-checkout-cone-mode: false
- name: Get Disk Space Before Cleanup
id: disk-before
shell: bash
run: |
echo "Disk space before cleanup:"
df -h /
FREE_SPACE_BEFORE=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_BEFORE" >> $GITHUB_OUTPUT
- name: Free Space on macOS
uses: ./.github/actions/free-space-macos
- name: Get Disk Space After Cleanup
id: disk-after
shell: bash
run: |
echo "Disk space after cleanup:"
df -h /
FREE_SPACE_AFTER=$(df -k / | tail -1 | awk '{print $4}')
echo "free_kb=$FREE_SPACE_AFTER" >> $GITHUB_OUTPUT
- name: Log Disk Space to Datadog
if: ${{ env.DD_API_KEY != '' }}
shell: bash
env:
DD_API_KEY: ${{ secrets.DD_API_KEY }}
FREE_BEFORE: ${{ steps.disk-before.outputs.free_kb }}
FREE_AFTER: ${{ steps.disk-after.outputs.free_kb }}
MATRIX_RUNNER: ${{ matrix.runner }}
run: |
TIMESTAMP=$(date +%s)
FREE_BEFORE_GB=$(echo "scale=2; $FREE_BEFORE / 1024 / 1024" | bc)
FREE_AFTER_GB=$(echo "scale=2; $FREE_AFTER / 1024 / 1024" | bc)
SPACE_FREED_GB=$(echo "scale=2; ($FREE_AFTER - $FREE_BEFORE) / 1024 / 1024" | bc)
echo "Free space before: ${FREE_BEFORE_GB}GB"
echo "Free space after: ${FREE_AFTER_GB}GB"
echo "Space freed: ${SPACE_FREED_GB}GB"
curl -s -X POST "https://api.datadoghq.com/api/v2/series" \
-H "Content-Type: application/json" \
-H "DD-API-KEY: ${DD_API_KEY}" \
-d @- << EOF
{
"series": [
{
"metric": "electron.macos.disk.free_space_before_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_BEFORE_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.free_space_after_cleanup_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${FREE_AFTER_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
},
{
"metric": "electron.macos.disk.space_freed_gb",
"points": [{"timestamp": ${TIMESTAMP}, "value": ${SPACE_FREED_GB}}],
"type": 3,
"unit": "gigabyte",
"tags": ["runner:${MATRIX_RUNNER}", "platform:macos"]
}
]
}
EOF
echo "Disk space metrics logged to Datadog"

View File

@@ -6,7 +6,7 @@ on:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'bc2f48b2415a670de18d13605b1cf0eb5fdbaae1'
default: 'eac3529546ea8f3aa356d31e345715eef342233b'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
@@ -18,9 +18,14 @@ on:
type: boolean
default: false
permissions: {}
jobs:
checkout-macos:
runs-on: electron-arc-linux-amd64-32core
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root
@@ -28,10 +33,11 @@ jobs:
- /mnt/cross-instance-cache:/mnt/cross-instance-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_mac=True --custom-var=host_os=mac'
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
@@ -39,13 +45,19 @@ jobs:
uses: ./src/electron/.github/actions/checkout
with:
generate-sas-token: 'true'
target-platform: macos
publish-x64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: darwin
@@ -56,11 +68,16 @@ jobs:
secrets: inherit
publish-x64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: x64
target-variant: mas
@@ -71,11 +88,16 @@ jobs:
secrets: inherit
publish-arm64-darwin:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: darwin
@@ -86,11 +108,16 @@ jobs:
secrets: inherit
publish-arm64-mas:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-macos
with:
environment: production-release
build-runs-on: macos-14-xlarge
build-runs-on: macos-15-xlarge
target-platform: macos
target-arch: arm64
target-variant: mas
@@ -98,4 +125,4 @@ jobs:
gn-build-type: release
generate-symbols: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
secrets: inherit

View File

@@ -0,0 +1,49 @@
name: Check for Disallowed Non-Maintainer Change
on:
pull_request_target:
paths:
- 'yarn.lock'
- 'spec/yarn.lock'
- '.github/workflows/**'
- '.github/actions/**'
- '.yarn/**'
- '.yarnrc.yml'
permissions: {}
jobs:
check-for-non-maintainer-dependency-change:
name: Check for disallowed non-maintainer change
if: ${{ github.event.pull_request.user.type != 'Bot' && !github.event.pull_request.draft }}
permissions:
contents: read
pull-requests: write
runs-on: ubuntu-latest
steps:
- name: Get author association
id: get-author-association
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
AUTHOR_ASSOCIATION=$(gh api /repos/electron/electron/pulls/${{ github.event.pull_request.number }} --jq '.author_association')
echo "author_association=$AUTHOR_ASSOCIATION" >> "$GITHUB_OUTPUT"
- name: Check for existing review
id: check-for-review
if: ${{ !contains(fromJSON('["MEMBER", "OWNER"]'), steps.get-author-association.outputs.author_association) }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
set -eo pipefail
REVIEW_COUNT=$(gh pr view $PR_URL --json reviews | jq '[ .reviews[] | select(.author.login == "github-actions") | select(.body | startswith("<!-- disallowed-non-maintainer-change -->")) ] | length')
if [[ $REVIEW_COUNT -eq 0 ]]; then
echo "SHOULD_REVIEW=1" >> "$GITHUB_OUTPUT"
fi
- name: Request changes
if: ${{ steps.check-for-review.outputs.SHOULD_REVIEW }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
printf "<!-- disallowed-non-maintainer-change -->\n\nHello @${{ github.event.pull_request.user.login }}! It looks like this pull request touches one of our dependency or CI files, and per [our contribution policy](https://github.com/electron/electron/blob/main/CONTRIBUTING.md#dependencies-upgrades-policy) we do not accept these types of changes in PRs." | gh pr review $PR_URL -r --body-file=-

13
.github/workflows/package.json vendored Normal file
View File

@@ -0,0 +1,13 @@
{
"name": "@electron/gha-workflows",
"version": "0.0.0-development",
"private": true,
"type": "module",
"dependencies": {
"@actions/cache": "^4.0.3",
"@electron/fiddle-core": "^2.0.1",
"mdast-util-from-markdown": "^2.0.0",
"semver": "^7.7.2",
"unist-util-select": "^5.1.0"
}
}

View File

@@ -5,7 +5,7 @@ on:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos or linux'
description: 'Platform to run on, can be macos, win or linux.'
required: true
target-arch:
type: string
@@ -15,10 +15,6 @@ on:
type: string
description: 'What host to run the build'
required: true
check-runs-on:
type: string
description: 'What host to run the gn-check'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
@@ -59,13 +55,17 @@ on:
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref }}
cancel-in-progress: ${{ github.ref != 'refs/heads/main' && !endsWith(github.ref, '-x-y') }}
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -76,18 +76,12 @@ jobs:
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
with:
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
check-runs-on: ${{ inputs.check-runs-on }}
check-container: ${{ inputs.build-container }}
gn-build-type: ${{ inputs.gn-build-type }}
is-asan: ${{ inputs.is-asan }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -97,6 +91,8 @@ jobs:
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
@@ -104,4 +100,4 @@ jobs:
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
gn-build-type: ${{ inputs.gn-build-type }}
secrets: inherit
secrets: inherit

View File

@@ -5,7 +5,7 @@ on:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos or linux'
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
@@ -15,10 +15,6 @@ on:
type: string
description: 'What host to run the build'
required: true
check-runs-on:
type: string
description: 'What host to run the gn-check'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
@@ -58,19 +54,23 @@ on:
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
concurrency:
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref }}
cancel-in-progress: ${{ github.ref != 'refs/heads/main' && !endsWith(github.ref, '-x-y') }}
group: electron-build-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
@@ -80,25 +80,21 @@ jobs:
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan}}
secrets: inherit
gn-check:
uses: ./.github/workflows/pipeline-segment-electron-gn-check.yml
with:
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
check-runs-on: ${{ inputs.check-runs-on }}
check-container: ${{ inputs.build-container }}
gn-build-type: ${{ inputs.gn-build-type }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
is-asan: ${{ inputs.is-asan}}
secrets: inherit
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit

View File

@@ -0,0 +1,139 @@
name: Electron Build & Clang Tidy & Test (+ Node + NaN) Pipeline
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux.'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
build-runs-on:
type: string
description: 'What host to run the build'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
build-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
clang-tidy-container:
type: string
description: 'JSON container information to run clang-tidy on'
required: false
default: '{"image":null}'
test-container:
type: string
description: 'JSON container information for testing'
required: false
default: '{"image":null}'
is-release:
description: 'Whether this build job is a release job'
required: true
type: boolean
default: false
gn-build-type:
description: 'The gn build type - testing or release'
required: true
type: string
default: testing
generate-symbols:
description: 'Whether or not to generate symbols'
required: true
type: boolean
default: false
upload-to-storage:
description: 'Whether or not to upload build artifacts to external storage'
required: true
type: string
default: '0'
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-and-test-and-nan-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
is-release: ${{ inputs.is-release }}
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
upload-out-gen-artifacts: true
secrets: inherit
clang-tidy:
uses: ./.github/workflows/pipeline-segment-electron-clang-tidy.yml
permissions:
contents: read
needs: build
with:
clang-tidy-runs-on: ${{ inputs.clang-tidy-runs-on }}
clang-tidy-container: ${{ inputs.clang-tidy-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
secrets: inherit
test-wayland:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
if: ${{ inputs.target-platform == 'linux' && inputs.target-arch == 'x64' && !inputs.is-asan }}
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
display-server: wayland
secrets: inherit
nn-test:
uses: ./.github/workflows/pipeline-segment-node-nan-test.yml
permissions:
contents: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
gn-build-type: ${{ inputs.gn-build-type }}
secrets: inherit

View File

@@ -0,0 +1,121 @@
name: Electron Build & Clang Tidy & Test Pipeline
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
build-runs-on:
type: string
description: 'What host to run the build'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
build-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
clang-tidy-container:
type: string
description: 'JSON container information to run clang-tidy on'
required: false
default: '{"image":null}'
test-container:
type: string
description: 'JSON container information for testing'
required: false
default: '{"image":null}'
is-release:
description: 'Whether this build job is a release job'
required: true
type: boolean
default: false
gn-build-type:
description: 'The gn build type - testing or release'
required: true
type: string
default: testing
generate-symbols:
description: 'Whether or not to generate symbols'
required: true
type: boolean
default: false
upload-to-storage:
description: 'Whether or not to upload build artifacts to external storage'
required: true
type: string
default: '0'
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
concurrency:
group: electron-build-and-tidy-and-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions: {}
jobs:
build:
uses: ./.github/workflows/pipeline-segment-electron-build.yml
permissions:
contents: read
with:
build-runs-on: ${{ inputs.build-runs-on }}
build-container: ${{ inputs.build-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
is-release: ${{ inputs.is-release }}
gn-build-type: ${{ inputs.gn-build-type }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
upload-out-gen-artifacts: true
secrets: inherit
clang-tidy:
uses: ./.github/workflows/pipeline-segment-electron-clang-tidy.yml
permissions:
contents: read
needs: build
with:
clang-tidy-runs-on: ${{ inputs.clang-tidy-runs-on }}
clang-tidy-container: ${{ inputs.clang-tidy-container }}
target-platform: ${{ inputs.target-platform }}
target-arch: ${{ inputs.target-arch }}
secrets: inherit
test:
uses: ./.github/workflows/pipeline-segment-electron-test.yml
permissions:
contents: read
issues: read
pull-requests: read
needs: build
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
test-runs-on: ${{ inputs.test-runs-on }}
test-container: ${{ inputs.test-container }}
is-asan: ${{ inputs.is-asan }}
enable-ssh: ${{ inputs.enable-ssh }}
secrets: inherit

View File

@@ -8,36 +8,58 @@ on:
description: 'Container to run the docs-only ts compile in'
type: string
permissions: {}
concurrency:
group: electron-docs-only-${{ github.ref }}
cancel-in-progress: true
env:
GCLIENT_EXTRA_ARGS: --custom-var=checkout_arm=True --custom-var=checkout_arm64=True
jobs:
docs-only:
name: Docs Only Compile
runs-on: electron-arc-linux-amd64-4core
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Install Dependencies
ref: ${{ github.event.pull_request.head.sha }}
- name: Generate DEPS Hash
run: |
cd src/electron
node script/yarn install --frozen-lockfile
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AKS
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: linux
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Run TS/JS compile
shell: bash
run: |
cd src/electron
node script/yarn create-typescript-definitions
node script/yarn tsc -p tsconfig.default_app.json --noEmit
node script/yarn.js create-typescript-definitions
node script/yarn.js tsc -p tsconfig.default_app.json --noEmit
for f in build/webpack/*.js
do
out="${f:29}"
if [ "$out" != "base.js" ]; then
node script/yarn webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
node script/yarn.js webpack --config $f --output-filename=$out --output-path=./.tmp --env mode=development
fi
done
done

View File

@@ -8,26 +8,34 @@ on:
description: 'Container to run lint in'
type: string
permissions: {}
concurrency:
group: electron-lint-${{ github.ref }}
cancel-in-progress: ${{ github.ref != 'refs/heads/main' && !endsWith(github.ref, '-x-y') }}
group: electron-lint-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
jobs:
lint:
name: Lint
runs-on: electron-arc-linux-amd64-4core
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 20
container: ${{ fromJSON(inputs.container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Install Dependencies
run: |
cd src/electron
node script/yarn install --frozen-lockfile
uses: ./src/electron/.github/actions/install-dependencies
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Setup third_party Depot Tools
shell: bash
run: |
@@ -38,7 +46,7 @@ jobs:
shell: bash
run: |
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
gn_version="$(curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
gn_version="$(curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/DEPS?format=TEXT" | base64 -d | grep gn_version | head -n1 | cut -d\' -f4)"
cipd ensure -ensure-file - -root . <<-CIPD
\$ServiceURL https://chrome-infra-packages.appspot.com/
@@ -54,9 +62,14 @@ jobs:
chromium_revision="$(grep -A1 chromium_version src/electron/DEPS | tr -d '\n' | cut -d\' -f4)"
mkdir -p src/buildtools
curl -sL "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
curl -sL -b ~/.gitcookies "https://chromium.googlesource.com/chromium/src/+/${chromium_revision}/buildtools/DEPS?format=TEXT" | base64 -d > src/buildtools/DEPS
gclient sync --spec="solutions=[{'name':'src/buildtools','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':True},'managed':False}]"
- name: Add problem matchers
shell: bash
run: |
echo "::add-matcher::src/electron/.github/problem-matchers/eslint-stylish.json"
echo "::add-matcher::src/electron/.github/problem-matchers/markdownlint.json"
- name: Run Lint
shell: bash
run: |
@@ -67,11 +80,15 @@ jobs:
# but then we would lint its contents (at least gn format), and it doesn't pass it.
cd src/electron
node script/yarn install --frozen-lockfile
node script/yarn lint
node script/yarn.js install --immutable
node script/yarn.js lint
- name: Run Script Typechecker
shell: bash
run: |
cd src/electron
node script/yarn tsc -p tsconfig.script.json
node script/yarn.js tsc -p tsconfig.script.json
- name: Check GHA Workflows
shell: bash
run: |
cd src/electron
node script/copy-pipeline-segment-publish.js --check

View File

@@ -9,11 +9,11 @@ on:
type: string
target-platform:
type: string
description: 'Platform to run on, can be macos or linux'
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
description: 'Arch to build for, can be x64, arm64, ia32 or arm'
required: true
target-variant:
type: string
@@ -48,45 +48,74 @@ on:
required: true
type: string
default: '0'
strip-binaries:
description: 'Strip the binaries before release (Linux only)'
required: false
type: boolean
default: false
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
upload-out-gen-artifacts:
description: 'Whether to upload the src/gen artifacts'
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref }}
cancel-in-progress: ${{ github.ref != 'refs/heads/main' && !endsWith(github.ref, '-x-y') }}
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || inputs.target-platform == 'win' && '--custom-var=checkout_win=True' || '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: mkdir src
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: 'true'
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
@@ -95,15 +124,13 @@ jobs:
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@0a44ba7841725637a19e28fa30b79a866c81b0a6
uses: actions/setup-node@53b83947a5a98c8d113130e565377fae1a50d02f
with:
node-version: 20.11.x
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
run: |
cd src/electron
node script/yarn install --frozen-lockfile
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
@@ -122,64 +149,49 @@ jobs:
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Get Depot Tools
timeout-minutes: 5
run: |
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
SEDOPTION="-i"
if [ "`uname`" = "Darwin" ]; then
SEDOPTION="-i ''"
fi
# remove ninjalog_uploader_wrapper.py from autoninja since we don't use it and it causes problems
sed $SEDOPTION '/ninjalog_uploader_wrapper.py/d' ./depot_tools/autoninja
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
if [ "`uname`" = "Linux" ]; then
git apply --3way ../src/electron/.github/workflows/config/gclient.diff
fi
touch .disable_auto_update
- name: Add Depot Tools to PATH
run: echo "$(pwd)/depot_tools" >> $GITHUB_PATH
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js && cat src/electron/.depshash-target
DEPSHASH=v1-src-cache-$(shasum src/electron/.depshash | cut -f1 -d' ')
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform == 'macos' }}
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: |
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }}
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: |
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js && cat src/electron/.depshash-target
echo "DEPSHASH=$(shasum src/electron/.depshash | cut -f1 -d' ')" >> $GITHUB_ENV
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Fix Sync (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/fix-sync-macos
- name: Setup Number of Ninja Processes
run: |
echo "NUMBER_OF_NINJA_PROCESSES=${{ inputs.target-platform == 'linux' && '300' || '200' }}" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
@@ -189,12 +201,12 @@ jobs:
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'linux' && 'linux' || 'darwin' }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}
is-release: '${{ inputs.is-release }}'
generate-symbols: '${{ inputs.generate-symbols }}'
strip-binaries: '${{ inputs.strip-binaries }}'
upload-to-storage: '${{ inputs.upload-to-storage }}'
is-asan: '${{ inputs.is-asan }}'
upload-out-gen-artifacts: '${{ inputs.upload-out-gen-artifacts }}'
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' || inputs.target-variant == 'mas') }}
run: |
@@ -211,4 +223,4 @@ jobs:
is-release: '${{ inputs.is-release }}'
generate-symbols: '${{ inputs.generate-symbols }}'
upload-to-storage: '${{ inputs.upload-to-storage }}'
step-suffix: '(mas)'
step-suffix: '(mas)'

View File

@@ -0,0 +1,159 @@
name: Pipeline Segment - Electron Clang-Tidy
on:
workflow_call:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
required: true
clang-tidy-runs-on:
type: string
description: 'What host to run clang-tidy on'
required: true
clang-tidy-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
permissions: {}
concurrency:
group: electron-clang-tidy-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref }}
cancel-in-progress: true
env:
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || (inputs.target-platform == 'linux' && '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' || '--custom-var=checkout_win=True') }}
ELECTRON_OUT_DIR: Default
jobs:
clang-tidy:
defaults:
run:
shell: bash
runs-on: ${{ inputs.clang-tidy-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.clang-tidy-container) }}
env:
BUILD_TYPE: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
ARTIFACT_KEY: ${{ inputs.target-platform == 'macos' && 'darwin' || inputs.target-platform }}_${{ inputs.target-arch }}
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Cleanup disk space on macOS
if: ${{ inputs.target-platform == 'macos' }}
shell: bash
run: |
sudo mkdir -p $TMPDIR/del-target
tmpify() {
if [ -d "$1" ]; then
sudo mv "$1" $TMPDIR/del-target/$(echo $1|shasum -a 256|head -n1|cut -d " " -f1)
fi
}
tmpify /Library/Developer/CoreSimulator
tmpify ~/Library/Developer/CoreSimulator
sudo rm -rf $TMPDIR/del-target
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Enable windows toolchain
if: ${{ inputs.target-platform == 'win' }}
run: |
echo "ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=1" >> $GITHUB_ENV
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' || inputs.target-platform == 'win' }}
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: ${{ inputs.target-platform }}
- name: Run Electron Only Hooks
run: |
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]" > tmpgclient
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False,'install_sysroot':False,'checkout_win':True},'managed':False}]" > tmpgclient
echo "target_os=['win']" >> tmpgclient
fi
e d gclient runhooks --gclientfile=tmpgclient
# Fix VS Toolchain
if [ "${{ inputs.target-platform }}" = "win" ]; then
rm -rf src/third_party/depot_tools/win_toolchain/vs_files
e d python3 src/build/vs_toolchain.py update --force
fi
- name: Regenerate DEPS Hash
run: |
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Default GN gen
run: |
cd src/electron
git pack-refs
- name: Download Out Gen Artifacts
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: out_gen_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src/out/${{ env.ELECTRON_OUT_DIR }}/gen
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Clang-Tidy
run: |
e init -f --root=$(pwd) --out=${ELECTRON_OUT_DIR} testing --target-cpu ${TARGET_ARCH}
export GN_EXTRA_ARGS="target_cpu=\"${TARGET_ARCH}\""
if [ "${{ inputs.target-platform }}" = "win" ]; then
export GN_EXTRA_ARGS="$GN_EXTRA_ARGS use_v8_context_snapshot=true target_os=\"win\""
fi
e build --only-gen
cd src/electron
node script/yarn.js lint:clang-tidy --jobs 8 --out-dir ../out/${ELECTRON_OUT_DIR}
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
if: always() && !cancelled()
shell: bash
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done

View File

@@ -5,11 +5,11 @@ on:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos or linux'
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
target-archs:
type: string
description: 'Arch to build for, can be x64, arm64 or arm'
description: 'Archs to check for, can be x64, x86, arm64 or arm space separated'
required: true
check-runs-on:
type: string
@@ -25,35 +25,34 @@ on:
required: true
type: string
default: testing
is-asan:
description: 'Building the Address Sanitizer (ASan) Linux build'
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-gn-check-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref }}
group: electron-gn-check-${{ inputs.target-platform }}-${{ github.ref }}
cancel-in-progress: true
env:
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' && '--custom-var=checkout_mac=True --custom-var=host_os=mac' || (inputs.target-platform == 'linux' && '--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' || '--custom-var=checkout_win=True') }}
ELECTRON_OUT_DIR: Default
TARGET_ARCH: ${{ inputs.target-arch }}
jobs:
gn-check:
# TODO(codebytere): Change this to medium VM
defaults:
run:
shell: bash
runs-on: ${{ inputs.check-runs-on }}
permissions:
contents: read
container: ${{ fromJSON(inputs.check-container) }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Cleanup disk space on macOS
if: ${{ inputs.target-platform == 'macos' }}
shell: bash
@@ -70,93 +69,98 @@ jobs:
sudo rm -rf $TMPDIR/del-target
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
run: df -h
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Init Build Tools
- name: Enable windows toolchain
if: ${{ inputs.target-platform == 'win' }}
run: |
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }}
- name: Get Depot Tools
timeout-minutes: 5
run: |
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
SEDOPTION="-i"
if [ "`uname`" = "Darwin" ]; then
SEDOPTION="-i ''"
fi
# remove ninjalog_uploader_wrapper.py from autoninja since we don't use it and it causes problems
sed $SEDOPTION '/ninjalog_uploader_wrapper.py/d' ./depot_tools/autoninja
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
if [ "`uname`" = "Linux" ]; then
git apply --3way ../src/electron/.github/workflows/config/gclient.diff
fi
touch .disable_auto_update
- name: Add Depot Tools to PATH
run: echo "$(pwd)/depot_tools" >> $GITHUB_PATH
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: |
if [ "${{ inputs.target-arch }}" = "arm" ]; then
GN_EXTRA_ARGS='build_tflite_with_xnnpack=false'
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='fatal_linker_warnings=false enable_linux_installer=false'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
echo "ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN=1" >> $GITHUB_ENV
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js && cat src/electron/.depshash-target
DEPSHASH=v1-src-cache-$(shasum src/electron/.depshash | cut -f1 -d' ')
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
if: ${{ inputs.target-platform == 'linux' || inputs.target-platform == 'win' }}
uses: ./src/electron/.github/actions/restore-cache-aks
with:
target-platform: ${{ inputs.target-platform }}
- name: Run Electron Only Hooks
run: |
gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]" > tmpgclient
if [ "${{ inputs.target-platform }}" = "win" ]; then
echo "solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False,'install_sysroot':False,'checkout_win':True},'managed':False}]" > tmpgclient
echo "target_os=['win']" >> tmpgclient
fi
e d gclient runhooks --gclientfile=tmpgclient
# Fix VS Toolchain
if [ "${{ inputs.target-platform }}" = "win" ]; then
rm -rf src/third_party/depot_tools/win_toolchain/vs_files
e d python3 src/build/vs_toolchain.py update --force
fi
- name: Regenerate DEPS Hash
run: |
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js && cat src/electron/.depshash-target
echo "DEPSHASH=$(shasum src/electron/.depshash | cut -f1 -d' ')" >> $GITHUB_ENV
(cd src/electron && git checkout .) && node src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Install Dependencies
run: |
cd src/electron
node script/yarn install --frozen-lockfile
uses: ./src/electron/.github/actions/install-dependencies
- name: Default GN gen
run: |
cd src/electron
git pack-refs
cd ..
e build --only-gen
- name: Run GN Check
- name: Run GN Check for ${{ inputs.target-archs }}
run: |
cd src
gn check out/Default //electron:electron_lib
gn check out/Default //electron:electron_app
gn check out/Default //electron/shell/common/api:mojo
for target_cpu in ${{ inputs.target-archs }}
do
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu $target_cpu
cd src
export GN_EXTRA_ARGS="target_cpu=\"$target_cpu\""
if [ "${{ inputs.target-platform }}" = "linux" ]; then
if [ "$target_cpu" = "arm" ]; then
export GN_EXTRA_ARGS="$GN_EXTRA_ARGS build_tflite_with_xnnpack=false"
elif [ "$target_cpu" = "arm64" ]; then
export GN_EXTRA_ARGS="$GN_EXTRA_ARGS fatal_linker_warnings=false enable_linux_installer=false"
fi
fi
if [ "${{ inputs.target-platform }}" = "win" ]; then
export GN_EXTRA_ARGS="$GN_EXTRA_ARGS use_v8_context_snapshot=true target_os=\"win\""
fi
# Check the hunspell filenames
node electron/script/gen-hunspell-filenames.js --check
node electron/script/gen-libc++-filenames.js --check
e build --only-gen
e d gn check out/Default //electron:electron_lib
e d gn check out/Default //electron:electron_app
e d gn check out/Default //electron/shell/common:mojo
e d gn check out/Default //electron/shell/common:plugin
# Check the hunspell filenames
node electron/script/gen-hunspell-filenames.js --check
node electron/script/gen-libc++-filenames.js --check
cd ..
done
- name: Wait for active SSH sessions
if: always() && !cancelled()
shell: bash
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done
done

View File

@@ -0,0 +1,243 @@
# AUTOGENERATED FILE - DO NOT EDIT MANUALLY
# ONLY EDIT .github/workflows/pipeline-segment-electron-build.yml
name: Pipeline Segment - Electron Build
on:
workflow_call:
inputs:
environment:
description: using the production or testing environment
required: false
type: string
target-platform:
type: string
description: Platform to run on, can be macos, win or linux
required: true
target-arch:
type: string
description: Arch to build for, can be x64, arm64, ia32 or arm
required: true
target-variant:
type: string
description: Variant to build for, no effect on non-macOS target platforms. Can
be darwin, mas or all.
default: all
build-runs-on:
type: string
description: What host to run the build
required: true
build-container:
type: string
description: JSON container information for aks runs-on
required: false
default: '{"image":null}'
is-release:
description: Whether this build job is a release job
required: true
type: boolean
default: false
gn-build-type:
description: The gn build type - testing or release
required: true
type: string
default: testing
generate-symbols:
description: Whether or not to generate symbols
required: true
type: boolean
default: false
upload-to-storage:
description: Whether or not to upload build artifacts to external storage
required: true
type: string
default: "0"
is-asan:
description: Building the Address Sanitizer (ASan) Linux build
required: false
type: boolean
default: false
upload-out-gen-artifacts:
description: Whether to upload the src/gen artifacts
required: false
type: boolean
default: false
enable-ssh:
description: Enable SSH debugging
required: false
type: boolean
default: false
permissions: {}
concurrency:
group: electron-build-${{ inputs.target-platform }}-${{ inputs.target-arch
}}-${{ inputs.target-variant }}-${{ inputs.is-asan }}-${{
github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
DD_API_KEY: ${{ secrets.DD_API_KEY }}
ELECTRON_ARTIFACTS_BLOB_STORAGE: ${{ secrets.ELECTRON_ARTIFACTS_BLOB_STORAGE }}
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
SUDOWOODO_EXCHANGE_URL: ${{ secrets.SUDOWOODO_EXCHANGE_URL }}
SUDOWOODO_EXCHANGE_TOKEN: ${{ secrets.SUDOWOODO_EXCHANGE_TOKEN }}
GCLIENT_EXTRA_ARGS: ${{ inputs.target-platform == 'macos' &&
'--custom-var=checkout_mac=True --custom-var=host_os=mac' ||
inputs.target-platform == 'win' && '--custom-var=checkout_win=True' ||
'--custom-var=checkout_arm=True --custom-var=checkout_arm64=True' }}
ELECTRON_OUT_DIR: Default
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
build:
defaults:
run:
shell: bash
runs-on: ${{ inputs.build-runs-on }}
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
container: ${{ fromJSON(inputs.build-container) }}
environment: ${{ inputs.environment }}
env:
TARGET_ARCH: ${{ inputs.target-arch }}
TARGET_PLATFORM: ${{ inputs.target-platform }}
steps:
- name: Create src dir
run: |
mkdir src
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh ||
env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: "true"
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Check disk space after freeing up space
if: ${{ inputs.target-platform == 'macos' }}
run: df -h
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'macos' }}
uses: actions/setup-node@53b83947a5a98c8d113130e565377fae1a50d02f
with:
node-version: 22.21.x
cache: yarn
cache-dependency-path: src/electron/yarn.lock
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Install AZCopy
if: ${{ inputs.target-platform == 'macos' }}
run: brew install azcopy
- name: Set GN_EXTRA_ARGS for Linux
if: ${{ inputs.target-platform == 'linux' }}
run: >
if [ "${{ inputs.target-arch }}" = "arm" ]; then
if [ "${{ inputs.is-release }}" = true ]; then
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false symbol_level=1'
else
GN_EXTRA_ARGS='target_cpu="arm" build_tflite_with_xnnpack=false'
fi
elif [ "${{ inputs.target-arch }}" = "arm64" ]; then
GN_EXTRA_ARGS='target_cpu="arm64" fatal_linker_warnings=false enable_linux_installer=false'
elif [ "${{ inputs.is-asan }}" = true ]; then
GN_EXTRA_ARGS='is_asan=true'
fi
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Generate DEPS Hash
run: |
node src/electron/script/generate-deps-hash.js
DEPSHASH=v1-src-cache-$(cat src/electron/.depshash)
echo "DEPSHASH=$DEPSHASH" >> $GITHUB_ENV
echo "CACHE_PATH=$DEPSHASH.tar" >> $GITHUB_ENV
- name: Restore src cache via AZCopy
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-azcopy
with:
target-platform: ${{ inputs.target-platform }}
- name: Restore src cache via AKS
if: ${{ inputs.target-platform == 'linux' }}
uses: ./src/electron/.github/actions/restore-cache-aks
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Fix Sync
if: ${{ inputs.target-platform != 'linux' }}
uses: ./src/electron/.github/actions/fix-sync
with:
target-platform: ${{ inputs.target-platform }}
env:
ELECTRON_DEPOT_TOOLS_DISABLE_LOG: true
- name: Init Build Tools
run: >
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
--import ${{ inputs.gn-build-type }} --target-cpu ${{
inputs.target-arch }} --remote-build siso
- name: Run Electron Only Hooks
run: |
e d gclient runhooks --spec="solutions=[{'name':'src/electron','url':None,'deps_file':'DEPS','custom_vars':{'process_deps':False},'managed':False}]"
- name: Regenerate DEPS Hash
run: >
(cd src/electron && git checkout .) && node
src/electron/script/generate-deps-hash.js
echo "DEPSHASH=$(cat src/electron/.depshash)" >> $GITHUB_ENV
- name: Add CHROMIUM_BUILDTOOLS_PATH to env
run: echo "CHROMIUM_BUILDTOOLS_PATH=$(pwd)/src/buildtools" >> $GITHUB_ENV
- name: Free up space (macOS)
if: ${{ inputs.target-platform == 'macos' }}
uses: ./src/electron/.github/actions/free-space-macos
- name: Build Electron
if: ${{ inputs.target-platform != 'macos' || (inputs.target-variant == 'all' ||
inputs.target-variant == 'darwin') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: ${{ inputs.target-platform == 'macos' && 'darwin' ||
inputs.target-platform }}
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
is-asan: ${{ inputs.is-asan }}
upload-out-gen-artifacts: ${{ inputs.upload-out-gen-artifacts }}
- name: Set GN_EXTRA_ARGS for MAS Build
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
run: |
echo "MAS_BUILD=true" >> $GITHUB_ENV
GN_EXTRA_ARGS='is_mas_build=true'
echo "GN_EXTRA_ARGS=$GN_EXTRA_ARGS" >> $GITHUB_ENV
- name: Build Electron (MAS)
if: ${{ inputs.target-platform == 'macos' && (inputs.target-variant == 'all' ||
inputs.target-variant == 'mas') }}
uses: ./src/electron/.github/actions/build-electron
with:
target-arch: ${{ inputs.target-arch }}
target-platform: ${{ inputs.target-platform }}
artifact-platform: mas
is-release: ${{ inputs.is-release }}
generate-symbols: ${{ inputs.generate-symbols }}
upload-to-storage: ${{ inputs.upload-to-storage }}
step-suffix: (mas)

View File

@@ -0,0 +1,67 @@
name: Pipeline Segment - Electron Test on Linux ARM64 64k
on:
workflow_call:
inputs:
test-runs-on:
type: string
description: 'What host to run the tests on'
required: true
test-container:
type: string
description: 'JSON container information for aks runs-on'
required: false
default: '{"image":null}'
concurrency:
group: electron-test-linux-64k-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions: {}
env:
ELECTRON_OUT_DIR: Default
jobs:
test-linux-arm64-64k:
env:
BUILD_TYPE: linux
TARGET_ARCH: arm64
defaults:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Download Generated Artifacts
uses: actions/download-artifact@37930b1c2abaa49bbe596cd826c3c89aef350131
with:
name: generated_artifacts_linux_arm64
path: ./generated_artifacts_linux_arm64
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist
run: |
cd src/out/Default
unzip -:o dist.zip
- name: Run Electron Tests in QEMU 64k Container
shell: bash
env:
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: mocha-junit-reporter, tap
ELECTRON_DISABLE_SECURITY_WARNINGS: 1
DISPLAY: ':99.0'
run: |
container=$(echo '${{ inputs.test-container }}' | jq -r '.image')
src/electron/script/run-qemu-64k.sh --container $container --testfiles "`pwd`/src"

View File

@@ -5,7 +5,7 @@ on:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos or linux'
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
@@ -25,41 +25,65 @@ on:
required: false
type: boolean
default: false
enable-ssh:
description: 'Enable SSH debugging'
required: false
type: boolean
default: false
display-server:
description: 'Display backend for Linux tests: x11 or wayland'
required: false
type: string
default: x11
concurrency:
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ github.ref }}
cancel-in-progress: ${{ github.ref != 'refs/heads/main' && !endsWith(github.ref, '-x-y') }}
group: electron-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ inputs.is-asan }}-${{ inputs.display-server }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
permissions:
contents: read
issues: read
pull-requests: read
permissions: {}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
ELECTRON_OUT_DIR: Default
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
ACTIONS_STEP_DEBUG: ${{ secrets.ACTIONS_STEP_DEBUG }}
jobs:
test:
defaults:
run:
shell: bash
runs-on: ${{ inputs.test-runs-on }}
permissions:
contents: read
issues: read
pull-requests: read
container: ${{ fromJSON(inputs.test-container) }}
strategy:
fail-fast: false
matrix:
build-type: ${{ inputs.target-platform == 'macos' && fromJSON('["darwin","mas"]') || fromJSON('["linux"]') }}
shard: ${{ inputs.target-platform == 'macos' && fromJSON('[1, 2]') || fromJSON('[1, 2, 3]') }}
build-type: ${{ inputs.target-platform == 'macos' && fromJSON('["darwin","mas"]') || (inputs.target-platform == 'win' && fromJSON('["win"]') || fromJSON('["linux"]')) }}
shard: ${{ case(inputs.display-server == 'wayland', fromJSON('[1]'), inputs.target-platform == 'linux', fromJSON('[1, 2, 3]'), fromJSON('[1, 2]')) }}
env:
BUILD_TYPE: ${{ matrix.build-type }}
TARGET_ARCH: ${{ inputs.target-arch }}
ARTIFACT_KEY: ${{ matrix.build-type }}_${{ inputs.target-arch }}
steps:
- name: Fix node20 on arm32 runners
if: ${{ inputs.target-arch == 'arm' }}
if: ${{ inputs.target-arch == 'arm' && inputs.target-platform == 'linux' }}
run: |
cp $(which node) /mnt/runner-externals/node20/bin/
cp $(which node) /mnt/runner-externals/node24/bin/
- name: Setup Node.js/npm
if: ${{ inputs.target-platform == 'win' }}
uses: actions/setup-node@53b83947a5a98c8d113130e565377fae1a50d02f
with:
node-version: 22.21.x
- name: Add TCC permissions on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
epochdate=$(($(date +'%s * 1000 + %-N / 1000000')))
configure_user_tccdb () {
local values=$1
local dbPath="$HOME/Library/Application Support/com.apple.TCC/TCC.db"
@@ -75,14 +99,17 @@ jobs:
}
userValuesArray=(
"'kTCCServiceMicrophone','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceAppleEvents','/usr/local/opt/runner/provisioner/provisioner',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceCamera','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceBluetoothAlways','/opt/hca/hosted-compute-agent',1,2,4,1,NULL,NULL,0,'UNUSED',NULL,0,1687786159"
"'kTCCServiceScreenCapture','/bin/bash',1,2,3,1,NULL,NULL,NULL,'UNUSED',NULL,0,$epochdate"
)
for values in "${userValuesArray[@]}"; do
# Sonoma and higher have a few extra values
# Ref: https://github.com/actions/runner-images/blob/main/images/macos/scripts/build/configure-tccdb-macos.sh
if [ "$OSTYPE" = "darwin23" ]; then
if [ "$OSTYPE" = "darwin23" ] || [ "$OSTYPE" = "darwin24" ]; then
configure_user_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
configure_sys_tccdb "$values,NULL,NULL,'UNUSED',${values##*,}"
else
@@ -90,29 +117,52 @@ jobs:
configure_sys_tccdb "$values"
fi
done
- name: Turn off the unexpectedly quit dialog on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: defaults write com.apple.CrashReporter DialogType server
- name: Set xcode to 16.4
if: ${{ inputs.target-platform == 'macos' }}
run: sudo xcode-select --switch /Applications/Xcode_16.4.app
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Install Dependencies
ref: ${{ github.event.pull_request.head.sha }}
- name: Turn off screenshot nag on macOS
if: ${{ inputs.target-platform == 'macos' }}
run: |
cd src/electron
node script/yarn install --frozen-lockfile
defaults write ~/Library/Group\ Containers/group.com.apple.replayd/ScreenCaptureApprovals.plist "/bin/bash" -date "3024-09-23 12:00:00 +0000"
src/electron/script/actions/screencapture-nag-remover.sh -a $(which bash)
src/electron/script/actions/screencapture-nag-remover.sh -a /opt/hca/hosted-compute-agent
- name: Setup SSH Debugging
if: ${{ inputs.target-platform == 'macos' && (inputs.enable-ssh || env.ACTIONS_STEP_DEBUG == 'true') }}
uses: ./src/electron/.github/actions/ssh-debug
with:
tunnel: 'true'
env:
CLOUDFLARE_TUNNEL_CERT: ${{ secrets.CLOUDFLARE_TUNNEL_CERT }}
CLOUDFLARE_TUNNEL_HOSTNAME: ${{ vars.CLOUDFLARE_TUNNEL_HOSTNAME }}
CLOUDFLARE_USER_CA_CERT: ${{ secrets.CLOUDFLARE_USER_CA_CERT }}
AUTHORIZED_USERS: ${{ secrets.SSH_DEBUG_AUTHORIZED_USERS }}
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
- name: Install Dependencies
uses: ./src/electron/.github/actions/install-dependencies
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Get Depot Tools
timeout-minutes: 5
run: |
git config --global core.filemode false
git config --global core.autocrlf false
git config --global branch.autosetuprebase always
git config --global core.fscache true
git config --global core.longpaths true
git config --global core.preloadindex true
git config --global core.longpaths true
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
if [ "`uname`" = "Darwin" ]; then
# remove ninjalog_uploader_wrapper.py from autoninja since we don't use it and it causes problems
sed -i '' '/ninjalog_uploader_wrapper.py/d' ./autoninja
else
sed -i '/ninjalog_uploader_wrapper.py/d' ./autoninja
# Remove swift-format dep from cipd on macOS until we send a patch upstream.
git apply --3way ../src/electron/.github/workflows/config/gclient.diff
fi
touch .disable_auto_update
- name: Add Depot Tools to PATH
run: echo "$(pwd)/depot_tools" >> $GITHUB_PATH
@@ -123,51 +173,87 @@ jobs:
echo "DISABLE_CRASH_REPORTER_TESTS=true" >> $GITHUB_ENV
echo "IS_ASAN=true" >> $GITHUB_ENV
- name: Download Generated Artifacts
uses: actions/download-artifact@fa0a91b85d4f404e444e00e005971372dc801d16
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: generated_artifacts_${{ env.ARTIFACT_KEY }}
path: ./generated_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Download Src Artifacts
uses: actions/download-artifact@fa0a91b85d4f404e444e00e005971372dc801d16
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: src_artifacts_${{ env.ARTIFACT_KEY }}
path: ./src_artifacts_${{ matrix.build-type }}_${{ inputs.target-arch }}
- name: Restore Generated Artifacts
run: ./src/electron/script/actions/restore-artifacts.sh
- name: Unzip Dist, Mksnapshot & Chromedriver
- name: Unzip Dist (win)
if: ${{ inputs.target-platform == 'win' }}
shell: powershell
run: |
Set-ExecutionPolicy Bypass -Scope Process -Force
cd src/out/Default
Expand-Archive -Force dist.zip -DestinationPath ./
- name: Unzip Dist (unix)
if: ${{ inputs.target-platform != 'win' }}
run: |
cd src/out/Default
unzip -:o dist.zip
unzip -:o chromedriver.zip
unzip -:o mksnapshot.zip
- name: Import & Trust Self-Signed Codesigning Cert on MacOS
if: ${{ inputs.target-platform == 'macos' && inputs.target-arch == 'x64' }}
if: ${{ inputs.target-platform == 'macos' }}
run: |
sudo security authorizationdb write com.apple.trust-settings.admin allow
cd src/electron
./script/codesign/generate-identity.sh
- name: Install Datadog CLI
# Sign with our self-signed cert so that macOS system integrations
# (UNNotifications, dock bounce, etc.) work in tests on both architectures.
# Autoupdater tests sign their own fixture copies via signApp().
- name: Sign Electron.app for macOS tests
if: ${{ inputs.target-platform == 'macos' }}
run: |
cd src/electron
node script/yarn global add @datadog/datadog-ci
identity=$(src/electron/script/codesign/get-trusted-identity.sh)
if [ -n "$identity" ]; then
codesign -s "$identity" --deep --force src/out/Default/Electron.app
fi
- name: Run Electron Tests
shell: bash
timeout-minutes: 60
env:
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: mocha-junit-reporter, tap
ELECTRON_DISABLE_SECURITY_WARNINGS: 1
ELECTRON_SKIP_NATIVE_MODULE_TESTS: true
DISPLAY: ':99.0'
NPM_CONFIG_MSVS_VERSION: '2022'
run: |
cd src/electron
export ELECTRON_TEST_RESULTS_DIR=`pwd`/junit
# Get which tests are on this shard
tests_files=$(node script/split-tests ${{ matrix.shard }} ${{ inputs.target-platform == 'macos' && 2 || 3 }})
tests_files=$(node script/split-tests ${{ matrix.shard }} ${{ case(inputs.display-server == 'wayland', 1, inputs.target-platform == 'linux', 3, 2) }})
if [ "${{ inputs.display-server }}" = "wayland" ]; then
allowlist_file=script/wayland-test-allowlist.txt
filtered_tests=""
for test_file in $tests_files; do
if grep -Fxq "$test_file" "$allowlist_file"; then
filtered_tests="$filtered_tests $test_file"
fi
done
tests_files="${filtered_tests# }"
if [ -z "$tests_files" ]; then
echo "No tests matched Wayland filter, skipping."
exit 0
fi
fi
# Run tests
if [ "`uname`" = "Darwin" ]; then
if [ "${{ inputs.target-platform }}" != "linux" ]; then
echo "About to start tests"
node script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-platform }}" = "win" ]; then
if [ "${{ inputs.target-arch }}" = "x86" ]; then
export npm_config_arch="ia32"
fi
if [ "${{ inputs.target-arch }}" = "arm64" ]; then
export ELECTRON_FORCE_TEST_SUITE_EXIT="true"
fi
fi
node script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
chown :builduser .. && chmod g+w ..
chown -R :builduser . && chmod -R g+w .
@@ -184,11 +270,33 @@ jobs:
export MOCHA_TIMEOUT=180000
echo "Piping output to ASAN_SYMBOLIZE ($ASAN_SYMBOLIZE)"
cd electron
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --trace-uncaught --enable-logging --files $tests_files | $ASAN_SYMBOLIZE
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn test --runners=main --trace-uncaught --enable-logging --files $tests_files
if [ "${{ inputs.target-arch }}" = "arm" ]; then
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --skipYarnInstall --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
if [ "${{ inputs.display-server }}" = "wayland" ]; then
runuser -u builduser -- script/actions/run-tests-wayland.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
else
runuser -u builduser -- xvfb-run script/actions/run-tests.sh script/yarn.js test --runners=main --enableRerun=3 --trace-uncaught --enable-logging --files $tests_files
fi
fi
fi
fi
- name: Take screenshot on timeout or cancellation
if: ${{ inputs.target-platform != 'linux' && (cancelled() || failure()) }}
shell: bash
run: |
screenshot_dir="src/electron/spec/artifacts"
mkdir -p "$screenshot_dir"
screenshot_file="$screenshot_dir/screenshot-timeout-$(date +%Y%m%d%H%M%S).png"
if [ "${{ inputs.target-platform }}" = "macos" ]; then
screencapture -x "$screenshot_file" || true
elif [ "${{ inputs.target-platform }}" = "win" ]; then
powershell -command "Add-Type -AssemblyName System.Windows.Forms; \$screen = [System.Windows.Forms.Screen]::PrimaryScreen.Bounds; \$bitmap = New-Object System.Drawing.Bitmap(\$screen.Width, \$screen.Height); \$graphics = [System.Drawing.Graphics]::FromImage(\$bitmap); \$graphics.CopyFromScreen(\$screen.Location, [System.Drawing.Point]::Empty, \$screen.Size); \$bitmap.Save('$screenshot_file')" || true
fi
- name: Upload Test results to Datadog
env:
DD_ENV: ci
@@ -197,14 +305,24 @@ jobs:
DD_CIVISIBILITY_LOGS_ENABLED: true
DD_TAGS: "os.architecture:${{ inputs.target-arch }},os.family:${{ inputs.target-platform }},os.platform:${{ inputs.target-platform }},asan:${{ inputs.is-asan }}"
run: |
if ! [ -z $DD_API_KEY ]; then
datadog-ci junit upload src/electron/junit/test-results-main.xml
fi
if ! [ -z $DD_API_KEY ] && [ -f src/electron/junit/test-results-main.xml ]; then
cd src/electron
export DATADOG_PATH=`node script/yarn.js bin datadog-ci`
$DATADOG_PATH junit upload junit/test-results-main.xml
fi
if: always() && !cancelled()
- name: Upload Test Artifacts
if: always()
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f #v7.0.0
with:
name: ${{ inputs.target-platform == 'linux' && format('test_artifacts_{0}_{1}_{2}', env.ARTIFACT_KEY, inputs.display-server, matrix.shard) || format('test_artifacts_{0}_{1}', env.ARTIFACT_KEY, matrix.shard) }}
path: src/electron/spec/artifacts
if-no-files-found: ignore
- name: Wait for active SSH sessions
if: always() && !cancelled()
shell: bash
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done
done

View File

@@ -5,7 +5,7 @@ on:
inputs:
target-platform:
type: string
description: 'Platform to run on, can be macos or linux'
description: 'Platform to run on, can be macos, win or linux'
required: true
target-arch:
type: string
@@ -26,56 +26,51 @@ on:
type: string
default: testing
permissions: {}
concurrency:
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref }}
cancel-in-progress: ${{ github.ref != 'refs/heads/main' && !endsWith(github.ref, '-x-y') }}
group: electron-node-nan-test-${{ inputs.target-platform }}-${{ inputs.target-arch }}-${{ github.ref_protected == true && github.run_id || github.ref }}
cancel-in-progress: ${{ github.ref_protected != true }}
env:
CHROMIUM_GIT_COOKIE: ${{ secrets.CHROMIUM_GIT_COOKIE }}
ELECTRON_OUT_DIR: Default
ELECTRON_RBE_JWT: ${{ secrets.ELECTRON_RBE_JWT }}
jobs:
node-tests:
name: Run Node.js Tests
runs-on: electron-arc-linux-amd64-8core
timeout-minutes: 20
runs-on: electron-arc-centralus-linux-amd64-8core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
BUILD_TYPE: linux
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Init Build Tools
run: |
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }} --import ${{ inputs.gn-build-type }} --target-cpu ${{ inputs.target-arch }}
- name: Install Dependencies
run: |
cd src/electron
node script/yarn install --frozen-lockfile
- name: Get Depot Tools
timeout-minutes: 5
run: |
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
sed -i '/ninjalog_uploader_wrapper.py/d' ./depot_tools/autoninja
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
git apply --3way ../src/electron/.github/workflows/config/gclient.diff
touch .disable_auto_update
- name: Add Depot Tools to PATH
run: echo "$(pwd)/depot_tools" >> $GITHUB_PATH
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@fa0a91b85d4f404e444e00e005971372dc801d16
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@fa0a91b85d4f404e444e00e005971372dc801d16
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -93,6 +88,7 @@ jobs:
node electron/script/node-spec-runner.js --default --jUnitDir=junit
- name: Wait for active SSH sessions
if: always() && !cancelled()
shell: bash
run: |
while [ -f /var/.ssh-lock ]
do
@@ -100,45 +96,37 @@ jobs:
done
nan-tests:
name: Run Nan Tests
runs-on: electron-arc-linux-amd64-4core
timeout-minutes: 20
runs-on: electron-arc-centralus-linux-amd64-4core
permissions:
contents: read
timeout-minutes: 30
env:
TARGET_ARCH: ${{ inputs.target-arch }}
BUILD_TYPE: linux
container: ${{ fromJSON(inputs.test-container) }}
steps:
- name: Checkout Electron
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
ref: ${{ github.event.pull_request.head.sha }}
- name: Set Chromium Git Cookie
uses: ./src/electron/.github/actions/set-chromium-cookie
- name: Install Build Tools
uses: ./src/electron/.github/actions/install-build-tools
- name: Init Build Tools
run: |
e init -f --root=$(pwd) --out=Default ${{ inputs.gn-build-type }}
- name: Install Dependencies
run: |
cd src/electron
node script/yarn install --frozen-lockfile
- name: Get Depot Tools
timeout-minutes: 5
run: |
git clone --filter=tree:0 https://chromium.googlesource.com/chromium/tools/depot_tools.git
sed -i '/ninjalog_uploader_wrapper.py/d' ./depot_tools/autoninja
# Ensure depot_tools does not update.
test -d depot_tools && cd depot_tools
git apply --3way ../src/electron/.github/workflows/config/gclient.diff
touch .disable_auto_update
- name: Add Depot Tools to PATH
run: echo "$(pwd)/depot_tools" >> $GITHUB_PATH
uses: ./src/electron/.github/actions/install-dependencies
- name: Download Generated Artifacts
uses: actions/download-artifact@fa0a91b85d4f404e444e00e005971372dc801d16
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
path: ./generated_artifacts_${{ env.BUILD_TYPE }}_${{ env.TARGET_ARCH }}
- name: Download Src Artifacts
uses: actions/download-artifact@fa0a91b85d4f404e444e00e005971372dc801d16
uses: actions/download-artifact@70fc10c6e5e1ce46ad2ea6f2b72d43f7d47b13c3
with:
name: src_artifacts_linux_${{ env.TARGET_ARCH }}
path: ./src_artifacts_linux_${{ env.TARGET_ARCH }}
@@ -150,14 +138,21 @@ jobs:
unzip -:o dist.zip
- name: Setup Linux for Headless Testing
run: sh -e /etc/init.d/xvfb start
- name: Run Node.js Tests
- name: Add Clang problem matcher
shell: bash
run: echo "::add-matcher::src/electron/.github/problem-matchers/clang.json"
- name: Run Nan Tests
run: |
cd src
node electron/script/nan-spec-runner.js
- name: Remove Clang problem matcher
shell: bash
run: echo "::remove-matcher owner=clang::"
- name: Wait for active SSH sessions
shell: bash
if: always() && !cancelled()
run: |
while [ -f /var/.ssh-lock ]
do
sleep 60
done
done

View File

@@ -11,31 +11,68 @@ jobs:
name: backport/requested label added
if: github.event.label.name == 'backport/requested 🗳'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Trigger Slack workflow
uses: slackapi/slack-github-action@37ebaef184d7626c5f204ab8d3baff4262dd30f0 # v1.27.0
uses: slackapi/slack-github-action@91efab103c0de0a537f72a35f6b8cda0ee76bf0a # v2.1.1
with:
webhook: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
webhook-type: webhook-trigger
payload: |
{
"url": "${{ github.event.pull_request.html_url }}"
"base_ref": ${{ toJSON(github.event.pull_request.base.ref) }},
"title": ${{ toJSON(github.event.pull_request.title) }},
"url": ${{ toJSON(github.event.pull_request.html_url) }},
"user": ${{ toJSON(github.event.pull_request.user.login) }}
}
env:
SLACK_WEBHOOK_URL: ${{ secrets.BACKPORT_REQUESTED_SLACK_WEBHOOK_URL }}
pull-request-labeled-deprecation-review-complete:
name: deprecation-review/complete label added
if: github.event.label.name == 'deprecation-review/complete ✅'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
org: electron
- name: Set status
uses: dsanders11/project-actions/edit-item@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/edit-item@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
token: ${{ steps.generate-token.outputs.token }}
project-number: 94
field: Status
field-value: ✅ Reviewed
pull-request-labeled-ai-pr:
name: ai-pr label added
if: github.event.label.name == 'ai-pr'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- name: Create comment
uses: actions-cool/issues-helper@71b62d7da76e59ff7b193904feb6e77d4dbb2777 # v3.7.6
with:
actions: 'create-comment'
token: ${{ steps.generate-token.outputs.token }}
issue-number: ${{ github.event.pull_request.number }}
body: |
<!-- ai-pr -->
*AI PR Detected*
Hello @${{ github.event.pull_request.user.login }}. Due to the high amount of AI spam PRs we receive, if a PR is detected to be majority AI-generated without disclosure and untested, we will automatically close the PR.
We welcome the use of AI tools, as long as the PR meets our quality standards and has clearly been built and tested. If you believe your PR was closed in error, we welcome you to resubmit. However, please read our [CONTRIBUTING.md](http://contributing.md/) carefully before reopening. Thanks for your contribution.
- name: Close the pull request
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}
GH_REPO: electron/electron
PR_NUMBER: ${{ github.event.pull_request.number }}
run: |
gh pr close "$PR_NUMBER"

View File

@@ -0,0 +1,35 @@
name: Pull Request Opened/Synchronized
on:
pull_request_target:
types: [opened, synchronize]
permissions: {}
jobs:
check-signed-commits:
name: Check signed commits in PR
if: ${{ !contains(github.event.pull_request.labels.*.name, 'needs-signed-commits')}}
runs-on: ubuntu-slim
permissions:
contents: read
pull-requests: write
steps:
- name: Check signed commits in PR
uses: 1Password/check-signed-commits-action@ed2885f3ed2577a4f5d3c3fe895432a557d23d52 # v1
with:
comment: |
⚠️ This PR contains unsigned commits. This repository enforces [commit signatures](https://docs.github.com/en/authentication/managing-commit-signature-verification)
for all incoming PRs. To get your PR merged, please sign those commits
(`git rebase --exec 'git commit -S --amend --no-edit -n' @{upstream}`) and force push them to this branch
(`git push --force-with-lease`)
For more information on signing commits, see GitHub's documentation on [Telling Git about your signing key](https://docs.github.com/en/authentication/managing-commit-signature-verification/telling-git-about-your-signing-key).
- name: Add needs-signed-commits label
if: ${{ failure() }}
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
PR_URL: ${{ github.event.pull_request.html_url }}
run: |
gh pr edit $PR_URL --add-label needs-signed-commits

View File

@@ -0,0 +1,71 @@
name: Rerun PR Apply Patches
on:
push:
branches:
- main
- '[1-9][0-9]-x-y'
paths:
- 'DEPS'
- 'patches/**'
permissions: {}
jobs:
rerun-apply-patches:
runs-on: ubuntu-latest
permissions:
actions: write
checks: read
contents: read
pull-requests: read
steps:
- name: Find PRs and Rerun Apply Patches
env:
GH_REPO: ${{ github.repository }}
GH_TOKEN: ${{ github.token }}
run: |
BRANCH="${GITHUB_REF#refs/heads/}"
# Find all open PRs targeting this branch
PRS=$(gh pr list --base "$BRANCH" --state open --limit 250 --json number)
echo "$PRS" | jq -c '.[]' | while read -r pr; do
PR_NUMBER=$(echo "$pr" | jq -r '.number')
echo "Processing PR #${PR_NUMBER}"
# Find the Apply Patches workflow check for this PR
CHECK=$(gh pr view "$PR_NUMBER" --json statusCheckRollup --jq '[.statusCheckRollup[] | select(.workflowName == "Apply Patches" and .name == "apply-patches")] | first')
if [ -z "$CHECK" ] || [ "$CHECK" = "null" ]; then
echo " No Apply Patches workflow found for PR #${PR_NUMBER}"
continue
fi
CONCLUSION=$(echo "$CHECK" | jq -r '.conclusion')
if [ "$CONCLUSION" = "SKIPPED" ]; then
echo " apply-patches job was skipped for PR #${PR_NUMBER} (no patches)"
continue
fi
LINK=$(echo "$CHECK" | jq -r '.detailsUrl')
# Extract the run ID from the link (format: .../runs/RUN_ID/job/JOB_ID)
RUN_ID=$(echo "$LINK" | grep -oE 'runs/[0-9]+' | cut -d'/' -f2)
if [ -z "$RUN_ID" ]; then
echo " Could not extract run ID from link: ${LINK}"
continue
fi
# Check if the workflow is currently in progress
RUN_STATUS=$(gh run view "$RUN_ID" --json status --jq '.status')
if [ "$RUN_STATUS" = "in_progress" ] || [ "$RUN_STATUS" = "queued" ] || [ "$RUN_STATUS" = "waiting" ]; then
echo " Workflow run ${RUN_ID} is ${RUN_STATUS}, cancelling..."
gh run cancel "$RUN_ID" --force
gh run watch "$RUN_ID"
fi
gh run rerun "$RUN_ID"
done

View File

@@ -13,6 +13,7 @@ permissions: read-all
jobs:
analysis:
name: Scorecards analysis
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions:
# Needed to upload the results to code-scanning dashboard.
@@ -22,13 +23,13 @@ jobs:
steps:
- name: "Checkout code"
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332 # v4.1.7
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd # v6.0.2
with:
persist-credentials: false
# This is a pre-submit / pre-release.
- name: "Run analysis"
uses: ossf/scorecard-action@62b2cac7ed8198b15735ed49ab1e5cf35480ba46 # v2.4.0
uses: ossf/scorecard-action@4eaacf0543bb3f2c246792bd56e8cdeffafb205a # v2.4.3
with:
results_file: results.sarif
results_format: sarif
@@ -42,7 +43,7 @@ jobs:
# Upload the results as artifacts (optional). Commenting out will disable uploads of run results in SARIF
# format to the repository Actions tab.
- name: "Upload artifact"
uses: actions/upload-artifact@50769540e7f4bd5e21e526ee35c689e35e0d6874 # v4.4.0
uses: actions/upload-artifact@bbbca2ddaa5d8feaa63e36b76fdaad77386f024f # v7.0.0
with:
name: SARIF file
path: results.sarif
@@ -50,6 +51,6 @@ jobs:
# Upload the results to GitHub's code scanning dashboard.
- name: "Upload to code-scanning"
uses: github/codeql-action/upload-sarif@294a9d92911152fe08befb9ec03e240add280cb3 # v3.26.8
uses: github/codeql-action/upload-sarif@0d579ffd059c29b07949a3cce3983f0780820c98 # v3.29.5
with:
sarif_file: results.sarif

View File

@@ -7,8 +7,7 @@ on:
- edited
- synchronize
permissions:
contents: read
permissions: {}
jobs:
main:
@@ -19,7 +18,7 @@ jobs:
runs-on: ubuntu-latest
steps:
- name: semantic-pull-request
uses: amannn/action-semantic-pull-request@0723387faaf9b38adef4775cd42cfd5155ed6017 # v5.5.3
uses: amannn/action-semantic-pull-request@48f256284bd46cdaab1048c3721360e808335d50 # v6.1.1
env:
GITHUB_TOKEN: ${{ secrets.GITHUB_TOKEN }}
with:

View File

@@ -10,10 +10,12 @@ permissions: {}
jobs:
check-stable-prep-items:
name: Check Stable Prep Items
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.RELEASE_BOARD_GH_APP_CREDS }}
@@ -27,7 +29,7 @@ jobs:
PROJECT_NUMBER=$(gh project list --owner electron --format json | jq -r '.projects | map(select(.title | test("^[0-9]+-x-y$"))) | max_by(.number) | .number')
echo "PROJECT_NUMBER=$PROJECT_NUMBER" >> "$GITHUB_OUTPUT"
- name: Update Completed Stable Prep Items
uses: dsanders11/project-actions/completed-by@eb760c48894b5702398529cbb8f6e98378e315d0 # v1.3.0
uses: dsanders11/project-actions/completed-by@2134fe7cc71c58b7ae259c82a8e63c6058255678 # v1.7.0
with:
field: Prep Status
field-value: ✅ Complete

View File

@@ -9,14 +9,16 @@ permissions: {}
jobs:
stale:
if: github.repository == 'electron/electron'
runs-on: ubuntu-latest
permissions: {}
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@28ca1036281a5e5922ead5184a1bbf96e5fc984e # tag: v9.0.0
- uses: actions/stale@b5d41d4e1d5dceea10e7104786b73624c18a190f # tag: v10.2.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: 90
@@ -27,19 +29,20 @@ jobs:
This issue has been automatically marked as stale. **If this issue is still affecting you, please leave any comment** (for example, "bump"), and we'll keep it open. If you have any new additional information—in particular, if this is still reproducible in the [latest version of Electron](https://www.electronjs.org/releases/stable) or in the [beta](https://www.electronjs.org/releases/beta)—please include it with your comment!
close-issue-message: >
This issue has been closed due to inactivity, and will not be monitored. If this is a bug and you can reproduce this issue on a [supported version of Electron](https://www.electronjs.org/docs/latest/tutorial/electron-timelines#timeline) please open a new issue and include instructions for reproducing the issue.
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt"
exempt-issue-labels: "discussion,security \U0001F512,enhancement :sparkles:,status/confirmed,stale-exempt,upgrade-follow-up,tracking-upstream"
only-pr-labels: not-a-real-label
pending-repro:
runs-on: ubuntu-latest
if: ${{ always() }}
permissions: {}
if: ${{ always() && github.repository == 'electron/electron' }}
needs: stale
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
uses: electron/github-app-auth-action@e14e47722ed120360649d0789e25b9baece12725 # v2.0.0
id: generate-token
with:
creds: ${{ secrets.ISSUE_TRIAGE_GH_APP_CREDS }}
- uses: actions/stale@28ca1036281a5e5922ead5184a1bbf96e5fc984e # tag: v9.0.0
- uses: actions/stale@b5d41d4e1d5dceea10e7104786b73624c18a190f # tag: v10.2.0
with:
repo-token: ${{ steps.generate-token.outputs.token }}
days-before-stale: -1

View File

@@ -0,0 +1,39 @@
name: Update Website Docs
on:
release:
types: [published]
permissions: {}
jobs:
update-website-docs:
name: Update Website Docs
runs-on: ubuntu-latest
environment: website-docs-updater
permissions:
contents: read
id-token: write # needed for secret-service-action
steps:
- name: Get GitHub App token
id: secret-service
uses: electron/secret-service-action@3476425e8b30555aac15b1b7096938e254b0e155 # v1.0.0
- name: Check if this release is the latest
id: check-if-latest-release
env:
GH_REPO: electron/electron
GH_TOKEN: ${{ secrets.GITHUB_TOKEN }}
run: |
LATEST_RELEASE_TAG="$(gh release view --json tagName --jq '.tagName')"
if [ "$LATEST_RELEASE_TAG" = "${GITHUB_REF#refs/tags/}" ]; then
echo "isLatestRelease=true" >> $GITHUB_OUTPUT
else
echo "isLatestRelease=false" >> $GITHUB_OUTPUT
fi
- name: Trigger website docs update
if: ${{ steps.check-if-latest-release.outputs.isLatestRelease == 'true' }}
env:
GH_REPO: electron/website
GH_TOKEN: ${{ fromJSON(steps.secret-service.outputs.secrets).WEBSITE_DOCS_UPDATER_APP_TOKEN }}
run: |
gh workflow run update-docs.yml -f sha=$GITHUB_SHA

View File

@@ -1,73 +0,0 @@
name: Update AppVeyor Image
# Run chron daily Mon-Fri
on:
workflow_dispatch:
schedule:
- cron: '0 8 * * 1-5' # runs 8:00 every business day (see https://crontab.guru)
permissions: {}
jobs:
bake-appveyor-image:
name: Bake AppVeyor Image
runs-on: ubuntu-latest
steps:
- name: Generate GitHub App token
uses: electron/github-app-auth-action@384fd19694fe7b6dcc9a684746c6976ad78228ae # v1.1.1
id: generate-token
with:
creds: ${{ secrets.APPVEYOR_UPDATER_GH_APP_CREDS }}
- name: Checkout
uses: actions/checkout@692973e3d937129bcbf40652eb9f2f61becf3332 # v4.1.7
with:
fetch-depth: 0
token: ${{ steps.generate-token.outputs.token }}
- name: Yarn install
run: |
node script/yarn.js install --frozen-lockfile
- name: Set Repo for Commit
run: git config --global --add safe.directory $GITHUB_WORKSPACE
- name: Check AppVeyor Image
env:
APPVEYOR_TOKEN: ${{ secrets.APPVEYOR_TOKEN }}
run: |
node ./script/prepare-appveyor
if [ -f ./image_version.txt ]; then
echo "APPVEYOR_IMAGE_VERSION="$(cat image_version.txt)"" >> $GITHUB_ENV
rm image_version.txt
fi
- name: (Optionally) Update Appveyor Image
if: ${{ env.APPVEYOR_IMAGE_VERSION }}
uses: mikefarah/yq@bbdd97482f2d439126582a59689eb1c855944955 # v4.44.3
with:
cmd: |
yq '.image = "${{ env.APPVEYOR_IMAGE_VERSION }}"' "appveyor.yml" > "appveyor2.yml"
yq '.image = "${{ env.APPVEYOR_IMAGE_VERSION }}"' "appveyor-woa.yml" > "appveyor-woa2.yml"
- name: (Optionally) Generate Commit Diff
if: ${{ env.APPVEYOR_IMAGE_VERSION }}
run: |
diff -w -B appveyor.yml appveyor2.yml > appveyor.diff || true
patch -f appveyor.yml < appveyor.diff
rm appveyor2.yml appveyor.diff
git add appveyor.yml
- name: (Optionally) Generate Commit Diff for WOA
if: ${{ env.APPVEYOR_IMAGE_VERSION }}
run: |
diff -w -B appveyor-woa.yml appveyor-woa2.yml > appveyor-woa.diff || true
patch -f appveyor-woa.yml < appveyor-woa.diff
rm appveyor-woa2.yml appveyor-woa.diff
git add appveyor-woa.yml
- name: (Optionally) Commit to Branch
if: ${{ env.APPVEYOR_IMAGE_VERSION }}
uses: dsanders11/github-app-commit-action@43de6da2f4d927e997c0784c7a0b61bd19ad6aac # v1.5.0
with:
message: 'build: update appveyor image to latest version'
ref: bump-appveyor-image
token: ${{ steps.generate-token.outputs.token }}
- name: (Optionally) Create Pull Request
if: ${{ env.APPVEYOR_IMAGE_VERSION }}
run: |
printf "This PR updates appveyor.yml to the latest baked image, ${{ env.APPVEYOR_IMAGE_VERSION }}.\n\nNotes: none" | gh pr create --head bump-appveyor-image --label no-backport --label semver/none --title 'build: update appveyor image to latest version' --body-file=-
env:
GITHUB_TOKEN: ${{ steps.generate-token.outputs.token }}

109
.github/workflows/windows-publish.yml vendored Normal file
View File

@@ -0,0 +1,109 @@
name: Publish Windows
on:
workflow_dispatch:
inputs:
build-image-sha:
type: string
description: 'SHA for electron/build image'
default: 'eac3529546ea8f3aa356d31e345715eef342233b'
required: true
upload-to-storage:
description: 'Uploads to Azure storage'
required: false
default: '1'
type: string
run-windows-publish:
description: 'Run the publish jobs vs just the build jobs'
type: boolean
default: false
permissions: {}
jobs:
checkout-windows:
if: github.repository == 'electron/electron'
runs-on: electron-arc-centralus-linux-amd64-32core
permissions:
contents: read
container:
image: ghcr.io/electron/build:${{ inputs.build-image-sha }}
options: --user root --device /dev/fuse --cap-add SYS_ADMIN
volumes:
- /mnt/win-cache:/mnt/win-cache
- /var/run/sas:/var/run/sas
env:
CHROMIUM_GIT_COOKIE_WINDOWS_STRING: ${{ secrets.CHROMIUM_GIT_COOKIE_WINDOWS_STRING }}
GCLIENT_EXTRA_ARGS: '--custom-var=checkout_win=True'
TARGET_OS: 'win'
ELECTRON_DEPOT_TOOLS_WIN_TOOLCHAIN: '1'
outputs:
build-image-sha: ${{ inputs.build-image-sha }}
steps:
- name: Checkout Electron
uses: actions/checkout@de0fac2e4500dabe0009e67214ff5f5447ce83dd
with:
path: src/electron
fetch-depth: 0
- name: Checkout & Sync & Save
uses: ./src/electron/.github/actions/checkout
with:
generate-sas-token: 'true'
target-platform: win
publish-x64-win:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
build-runs-on: electron-arc-centralus-windows-amd64-16core
target-platform: win
target-arch: x64
is-release: true
gn-build-type: release
generate-symbols: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
publish-arm64-win:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
build-runs-on: electron-arc-centralus-windows-amd64-16core
target-platform: win
target-arch: arm64
is-release: true
gn-build-type: release
generate-symbols: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit
publish-x86-win:
uses: ./.github/workflows/pipeline-segment-electron-publish.yml
permissions:
artifact-metadata: write
attestations: write
contents: read
id-token: write
needs: checkout-windows
with:
environment: production-release
build-runs-on: electron-arc-centralus-windows-amd64-16core
target-platform: win
target-arch: x86
is-release: true
gn-build-type: release
generate-symbols: true
upload-to-storage: ${{ inputs.upload-to-storage }}
secrets: inherit

3
.gitignore vendored
View File

@@ -48,9 +48,10 @@ ts-gen
# Used to accelerate CI builds
.depshash
.depshash-target
# Used to accelerate builds after sync
patches/mtime-cache.json
spec/fixtures/logo.png
.yarn/install-state.gz

View File

@@ -1,4 +1 @@
#!/bin/sh
. "$(dirname "$0")/_/husky.sh"
npm run precommit

View File

@@ -1,4 +1 @@
#!/bin/sh
. "$(dirname "$0")/_/husky.sh"
npm run prepack

View File

@@ -1,6 +1,7 @@
{
"config": {
"extends": "@electron/lint-roller/configs/markdownlint.json",
"descriptive-link-text": false,
"link-image-style": {
"autolink": false,
"shortcut": false
@@ -20,12 +21,14 @@
"ul",
"unknown",
"Tabs",
"TabItem"
"TabItem",
"DocCardList",
"kbd"
]
},
"no-newline-in-links": true
},
"customRules": [
"@electron/lint-roller/markdownlint-rules/"
"./node_modules/@electron/lint-roller/markdownlint-rules/index.mjs"
]
}

2
.nvmrc
View File

@@ -1 +1 @@
16
22

View File

@@ -1,6 +0,0 @@
{
"plugins": [
["remark-lint-code-block-style", "fenced"],
["remark-lint-fenced-code-flag"]
]
}

942
.yarn/releases/yarn-4.12.0.cjs vendored Executable file

File diff suppressed because one or more lines are too long

16
.yarnrc.yml Normal file
View File

@@ -0,0 +1,16 @@
enableScripts: false
nmHoistingLimits: workspaces
nodeLinker: node-modules
npmMinimalAgeGate: 10080
npmPreapprovedPackages:
- "@electron/*"
httpProxy: "${HTTP_PROXY:-}"
httpsProxy: "${HTTPS_PROXY:-}"
yarnPath: .yarn/releases/yarn-4.12.0.cjs

317
BUILD.gn
View File

@@ -4,12 +4,12 @@ import("//build/config/win/manifest.gni")
import("//components/os_crypt/sync/features.gni")
import("//components/spellcheck/spellcheck_build_features.gni")
import("//content/public/app/mac_helpers.gni")
import("//content/public/common/features.gni")
import("//extensions/buildflags/buildflags.gni")
import("//pdf/features.gni")
import("//ppapi/buildflags/buildflags.gni")
import("//printing/buildflags/buildflags.gni")
import("//testing/test.gni")
import("//third_party/electron_node/electron_node.gni")
import("//third_party/electron_node/node.gni")
import("//third_party/ffmpeg/ffmpeg_options.gni")
import("//tools/generate_library_loader/generate_library_loader.gni")
import("//tools/grit/grit_rule.gni")
@@ -17,19 +17,19 @@ import("//tools/grit/repack.gni")
import("//tools/v8_context_snapshot/v8_context_snapshot.gni")
import("//v8/gni/snapshot_toolchain.gni")
import("build/asar.gni")
import("build/electron_paks.gni")
import("build/extract_symbols.gni")
import("build/js2c_toolchain.gni")
import("build/npm.gni")
import("build/templated_file.gni")
import("build/tsc.gni")
import("build/webpack/webpack.gni")
import("buildflags/buildflags.gni")
import("electron_paks.gni")
import("filenames.auto.gni")
import("filenames.gni")
import("filenames.hunspell.gni")
import("filenames.libcxx.gni")
import("filenames.libcxxabi.gni")
import("js2c_toolchain.gni")
if (is_mac) {
import("//build/config/mac/rules.gni")
@@ -38,12 +38,13 @@ if (is_mac) {
import("build/rules.gni")
assert(
mac_deployment_target == "10.15",
"Chromium has updated the mac_deployment_target, please update this assert, update the supported versions documentation (docs/tutorial/support.md) and flag this as a breaking change")
mac_deployment_target == "12.0",
"Chromium has updated the mac_deployment_target, please update this assert and flag this as a breaking change (docs/breaking-changes.md)")
}
if (is_linux) {
import("//build/config/linux/pkg_config.gni")
import("//electron/build/linux/strip_binary.gni")
import("//tools/generate_stubs/rules.gni")
pkg_config("gio_unix") {
@@ -84,7 +85,10 @@ if (is_linux) {
# from the gtk library. Function signatures for which stubs are
# required should be declared in the sig files.
generate_stubs("electron_gtk_stubs") {
sigs = [ "shell/browser/ui/electron_gdk_pixbuf.sigs" ]
sigs = [
"shell/browser/ui/electron_gdk.sigs",
"shell/browser/ui/electron_gdk_pixbuf.sigs",
]
extra_header = "shell/browser/ui/electron_gtk.fragment"
output_name = "electron_gtk_stubs"
public_deps = [ "//ui/gtk:gtk_config" ]
@@ -221,11 +225,21 @@ webpack_build("electron_utility_bundle") {
out_file = "$target_gen_dir/js2c/utility_init.js"
}
webpack_build("electron_preload_realm_bundle") {
deps = [ ":build_electron_definitions" ]
inputs = auto_filenames.preload_realm_bundle_deps
config_file = "//electron/build/webpack/webpack.config.preload_realm.js"
out_file = "$target_gen_dir/js2c/preload_realm_bundle.js"
}
action("electron_js2c") {
deps = [
":electron_browser_bundle",
":electron_isolated_renderer_bundle",
":electron_node_bundle",
":electron_preload_realm_bundle",
":electron_renderer_bundle",
":electron_sandboxed_renderer_bundle",
":electron_utility_bundle",
@@ -237,6 +251,7 @@ action("electron_js2c") {
"$target_gen_dir/js2c/browser_init.js",
"$target_gen_dir/js2c/isolated_bundle.js",
"$target_gen_dir/js2c/node_init.js",
"$target_gen_dir/js2c/preload_realm_bundle.js",
"$target_gen_dir/js2c/renderer_init.js",
"$target_gen_dir/js2c/sandbox_bundle.js",
"$target_gen_dir/js2c/utility_init.js",
@@ -300,18 +315,39 @@ asar("default_app_asar") {
}
grit("resources") {
source = "electron_resources.grd"
source = "build/electron_resources.grd"
outputs = [
"grit/electron_resources.h",
"electron_resources.pak",
]
if (translate_genders) {
outputs += [
"electron_resources_MASCULINE.pak",
"electron_resources_FEMININE.pak",
"electron_resources_NEUTER.pak",
]
}
foreach(locale, all_chrome_locales) {
outputs += [ "electron_strings_$locale.pak" ]
if (translate_genders) {
outputs += [
"electron_strings_${locale}_MASCULINE.pak",
"electron_strings_${locale}_FEMININE.pak",
"electron_strings_${locale}_NEUTER.pak",
]
}
}
# Mojo manifest overlays are generated.
grit_flags = [
"-E",
"target_gen_dir=" + rebase_path(target_gen_dir, root_build_dir),
]
if (translate_genders) {
grit_flags += [ "--translate-genders" ]
}
deps = [ ":copy_shell_devtools_discovery_page" ]
@@ -408,7 +444,7 @@ action("electron_generate_node_defines") {
source_set("electron_lib") {
configs += [
"//v8:external_startup_data",
"//third_party/electron_node:node_internals",
"//third_party/electron_node:node_external_config",
]
public_configs = [
@@ -425,18 +461,22 @@ source_set("electron_lib") {
"buildflags",
"chromium_src:chrome",
"chromium_src:chrome_spellchecker",
"shell/common/api:mojo",
"shell/common:mojo",
"shell/common:plugin",
"shell/common:web_contents_utility",
"shell/services/node/public/mojom",
"//base:base_static",
"//base/allocator:buildflags",
"//build/util:chromium_git_revision",
"//chrome:strings",
"//chrome/app:command_ids",
"//chrome/app/resources:platform_locale_settings",
"//chrome/common/notifications",
"//components/autofill/core/common:features",
"//components/certificate_transparency",
"//components/compose:buildflags",
"//components/embedder_support:browser_util",
"//components/input:input",
"//components/embedder_support:user_agent",
"//components/input",
"//components/language/core/browser",
"//components/net_log",
"//components/network_hints/browser",
@@ -463,13 +503,14 @@ source_set("electron_lib") {
"//device/bluetooth",
"//device/bluetooth/public/cpp",
"//gin",
"//gpu/ipc/client",
"//media/capture/mojom:video_capture",
"//media/mojo/mojom",
"//media/mojo/mojom:web_speech_recognition",
"//net:extras",
"//net:net_resources",
"//printing/buildflags",
"//services/device/public/cpp/bluetooth:bluetooth",
"//services/device/public/cpp/bluetooth",
"//services/device/public/cpp/geolocation",
"//services/device/public/cpp/hid",
"//services/device/public/mojom",
@@ -482,7 +523,8 @@ source_set("electron_lib") {
"//third_party/blink/public:blink_devtools_inspector_resources",
"//third_party/blink/public/platform/media",
"//third_party/boringssl",
"//third_party/electron_node:node_lib",
"//third_party/electron_node:libnode",
"//third_party/highway:libhwy",
"//third_party/inspector_protocol:crdtp",
"//third_party/leveldatabase",
"//third_party/libyuv",
@@ -502,10 +544,15 @@ source_set("electron_lib") {
"//v8:v8_libplatform",
]
if (v8_use_external_startup_data && use_v8_context_snapshot) {
deps += [ ":mksnapshot_checksum_gen" ]
}
public_deps = [
"//base",
"//base:i18n",
"//content/public/app",
"//ui/base/unowned_user_data",
]
include_dirs = [
@@ -517,7 +564,10 @@ source_set("electron_lib") {
"//third_party/blink/renderer",
]
defines = [ "V8_DEPRECATION_WARNINGS" ]
defines = [
"BLINK_MOJO_IMPL=1",
"V8_DEPRECATION_WARNINGS",
]
libs = []
if (is_linux) {
@@ -531,7 +581,7 @@ source_set("electron_lib") {
]
}
configs += [ "//electron/build/config:mas_build" ]
deps += [ "//electron/build/config:generate_mas_config" ]
sources = filenames.lib_sources
if (is_win) {
@@ -562,7 +612,14 @@ source_set("electron_lib") {
}
if (is_mac) {
# Disable C++ modules to resolve linking error when including MacOS SDK
# headers from third_party/electron_node/deps/uv/include/uv/darwin.h
# TODO(samuelmaddock): consider revisiting this in the future
use_libcxx_modules = false
deps += [
"//components/os_crypt/async/browser:keychain_key_provider",
"//components/os_crypt/common:keychain_password_mac",
"//components/remote_cocoa/app_shim",
"//components/remote_cocoa/browser",
"//content/browser:mac_helpers",
@@ -584,6 +641,7 @@ source_set("electron_lib") {
"SecurityInterface.framework",
"ServiceManagement.framework",
"StoreKit.framework",
"UserNotifications.framework",
]
weak_frameworks = [ "QuickLookThumbnailing.framework" ]
@@ -624,6 +682,9 @@ source_set("electron_lib") {
":libnotify_loader",
"//build/config/linux/gtk",
"//components/crash/content/browser",
"//components/os_crypt/async/browser:freedesktop_secret_key_provider",
"//components/os_crypt/async/browser:posix_key_provider",
"//components/os_crypt/async/browser:secret_portal_key_provider",
"//dbus",
"//device/bluetooth",
"//third_party/crashpad/crashpad/client",
@@ -631,6 +692,7 @@ source_set("electron_lib") {
"//ui/events/devices/x11",
"//ui/events/platform/x11",
"//ui/gtk:gtk_config",
"//ui/linux:display_server_utils",
"//ui/linux:linux_ui",
"//ui/linux:linux_ui_factory",
"//ui/wm",
@@ -651,6 +713,8 @@ source_set("electron_lib") {
sources += [
"shell/browser/certificate_manager_model.cc",
"shell/browser/certificate_manager_model.h",
"shell/browser/linux/x11_util.cc",
"shell/browser/linux/x11_util.h",
"shell/browser/ui/gtk_util.cc",
"shell/browser/ui/gtk_util.h",
]
@@ -661,7 +725,8 @@ source_set("electron_lib") {
deps += [
"//components/app_launch_prefetch",
"//components/crash/core/app:crash_export_thunks",
"//ui/native_theme:native_theme_browser",
"//components/os_crypt/async/browser:dpapi_key_provider",
"//third_party/libxml:xml_writer",
"//ui/wm",
"//ui/wm/public",
]
@@ -672,22 +737,11 @@ source_set("electron_lib") {
}
if (enable_plugins) {
deps += [ "chromium_src:plugins" ]
sources += [
"shell/browser/electron_plugin_info_host_impl.cc",
"shell/browser/electron_plugin_info_host_impl.h",
"shell/common/plugin_info.cc",
"shell/common/plugin_info.h",
"shell/renderer/electron_renderer_pepper_host_factory.cc",
"shell/renderer/electron_renderer_pepper_host_factory.h",
"shell/renderer/pepper_helper.cc",
"shell/renderer/pepper_helper.h",
]
}
if (enable_ppapi) {
deps += [
"//ppapi/host",
"//ppapi/proxy",
"//ppapi/shared_impl",
]
}
@@ -717,7 +771,7 @@ source_set("electron_lib") {
"shell/common/extensions/api:extensions_features",
"//chrome/browser/resources:component_extension_resources",
"//components/guest_view/common:mojom",
"//components/update_client:update_client",
"//components/update_client",
"//components/zoom",
"//extensions/browser",
"//extensions/browser/api:api_provider",
@@ -739,11 +793,13 @@ source_set("electron_lib") {
if (enable_pdf_viewer) {
deps += [
"//chrome/browser/resources/pdf:resources",
"//chrome/browser/ui:browser_element_identifiers",
"//components/pdf/browser",
"//components/pdf/browser:interceptors",
"//components/pdf/common:constants",
"//components/pdf/common:util",
"//components/pdf/renderer",
"//components/user_education/webui",
"//pdf",
"//pdf:content_restriction",
]
@@ -762,6 +818,18 @@ source_set("electron_lib") {
}
}
action("mksnapshot_checksum_gen") {
script = "build/checksum_header.py"
outputs = [ "$target_gen_dir/snapshot_checksum.h" ]
inputs = [ "$root_out_dir/$v8_context_snapshot_filename" ]
args = rebase_path(inputs)
args += rebase_path(outputs)
deps = [ "//tools/v8_context_snapshot" ]
}
electron_paks("packed_resources") {
if (is_mac) {
output_dir = "$root_gen_dir/electron_repack"
@@ -805,7 +873,7 @@ if (is_mac) {
sources = []
public_deps = []
sources += [ "$root_out_dir/libffmpeg.dylib" ]
public_deps += [ "//third_party/ffmpeg:ffmpeg" ]
public_deps += [ "//third_party/ffmpeg" ]
outputs = [ "{{bundle_contents_dir}}/Libraries/{{source_file_part}}" ]
}
} else {
@@ -875,6 +943,7 @@ if (is_mac) {
":electron_framework_resources",
":electron_swiftshader_library",
":electron_xibs",
"//third_party/electron_node:libnode",
]
if (!is_mas_build) {
deps += [ ":electron_crashpad_helper" ]
@@ -918,17 +987,18 @@ if (is_mac) {
assert(defined(invoker.helper_name_suffix))
output_name = electron_helper_name + invoker.helper_name_suffix
deps = [ ":electron_framework+link" ]
deps = [
":electron_framework+link",
"//electron/build/config:generate_mas_config",
]
if (!is_mas_build) {
deps += [ "//sandbox/mac:seatbelt" ]
}
defines = [ "HELPER_EXECUTABLE" ]
configs += [ "//electron/build/config:mas_build" ]
sources = [
"shell/app/electron_main_mac.cc",
"shell/app/uv_stdio_fix.cc",
"shell/app/uv_stdio_fix.h",
"shell/common/electron_constants.cc",
]
include_dirs = [ "." ]
info_plist = "shell/renderer/resources/mac/Info.plist"
@@ -947,7 +1017,17 @@ if (is_mac) {
}
}
foreach(helper_params, content_mac_helpers) {
# Electron defines its own plugin helper (using CHILD_EMBEDDER_FIRST + 1) to
# allow loading of unsigned or third-party-signed libraries.
_electron_plugin_helper_params = [
"plugin",
".plugin",
" (Plugin)",
]
electron_mac_helpers =
content_mac_helpers + [ _electron_plugin_helper_params ]
foreach(helper_params, electron_mac_helpers) {
_helper_target = helper_params[0]
_helper_bundle_id = helper_params[1]
_helper_suffix = helper_params[2]
@@ -1000,7 +1080,7 @@ if (is_mac) {
":stripped_squirrel_framework",
]
foreach(helper_params, content_mac_helpers) {
foreach(helper_params, electron_mac_helpers) {
sources +=
[ "$root_out_dir/${electron_helper_name}${helper_params[2]}.app" ]
public_deps += [ ":electron_helper_app_${helper_params[0]}" ]
@@ -1079,6 +1159,7 @@ if (is_mac) {
":electron_app_plist",
":electron_app_resources",
":electron_fuses",
"//electron/build/config:generate_mas_config",
"//electron/buildflags",
]
if (is_mas_build) {
@@ -1093,7 +1174,6 @@ if (is_mac) {
"-rpath",
"@executable_path/../Frameworks",
]
configs += [ "//electron/build/config:mas_build" ]
}
if (enable_dsyms) {
@@ -1104,7 +1184,7 @@ if (is_mac) {
deps = [ ":electron_framework" ]
}
foreach(helper_params, content_mac_helpers) {
foreach(helper_params, electron_mac_helpers) {
_helper_target = helper_params[0]
_helper_bundle_id = helper_params[1]
_helper_suffix = helper_params[2]
@@ -1156,7 +1236,7 @@ if (is_mac) {
deps += [ ":crashpad_handler_syms" ]
}
foreach(helper_params, content_mac_helpers) {
foreach(helper_params, electron_mac_helpers) {
_helper_target = helper_params[0]
deps += [ ":electron_helper_syms_${_helper_target}" ]
}
@@ -1197,6 +1277,7 @@ if (is_mac) {
"//components/crash/core/app",
"//content:sandbox_helper_win",
"//electron/buildflags",
"//third_party/electron_node:libnode",
"//ui/strings",
]
@@ -1217,7 +1298,7 @@ if (is_mac) {
}
if (use_v8_context_snapshot) {
public_deps = [ "//tools/v8_context_snapshot:v8_context_snapshot" ]
public_deps = [ "//tools/v8_context_snapshot" ]
}
if (is_linux) {
@@ -1235,7 +1316,7 @@ if (is_mac) {
"//components/crash/core/app:run_as_crashpad_handler",
]
ldflags = []
ldflags = [ "/DELAYLOAD:ffmpeg.dll" ]
libs = [
"comctl32.lib",
@@ -1396,6 +1477,18 @@ dist_zip("electron_dist_zip") {
":licenses",
]
if (is_linux) {
if (is_official_build) {
data_deps += [
":strip_chrome_crashpad_handler",
":strip_chrome_sandbox",
":strip_electron_binary",
":strip_libEGL_shlib",
":strip_libGLESv2_shlib",
":strip_libffmpeg_shlib",
":strip_libvk_swiftshader_shlib",
]
}
data_deps += [ "//sandbox/linux:chrome_sandbox" ]
}
deps = data_deps
@@ -1441,6 +1534,16 @@ group("electron_mksnapshot") {
dist_zip("electron_mksnapshot_zip") {
data_deps = mksnapshot_deps
if (is_linux && is_official_build) {
data_deps += [
":strip_libEGL_shlib",
":strip_libGLESv2_shlib",
":strip_libffmpeg_shlib",
":strip_libvk_swiftshader_shlib",
":strip_mksnapshot_binary",
":strip_v8_context_snapshot_generator_binary",
]
}
deps = data_deps
outputs = [ "$root_build_dir/mksnapshot.zip" ]
}
@@ -1508,21 +1611,8 @@ group("electron") {
##### node_headers
node_dir = "../third_party/electron_node"
node_files = read_file("$node_dir/filenames.json", "json")
node_headers_dir = "$root_gen_dir/node_headers"
header_group_index = 0
header_groups = []
foreach(header_group, node_files.headers) {
copy("node_headers_${header_group_index}") {
sources = rebase_path(header_group.files, ".", node_dir)
outputs =
[ "$node_headers_dir/${header_group.dest_dir}/{{source_file_part}}" ]
}
header_groups += [ ":node_headers_${header_group_index}" ]
header_group_index += 1
}
copy("zlib_headers") {
sources = [
"$node_dir/deps/zlib/zconf.h",
@@ -1543,13 +1633,19 @@ copy("node_gypi_headers") {
action("node_version_header") {
inputs = [ "$node_dir/src/node_version.h" ]
outputs = [ "$node_headers_dir/include/node/node_version.h" ]
script = "script/generate_node_version_header.py"
script = "script/node/generate_node_version_header.py"
args = rebase_path(inputs) + rebase_path(outputs)
if (node_module_version != "") {
args += [ "$node_module_version" ]
}
}
action("generate_node_headers") {
deps = [ ":generate_config_gypi" ]
script = "script/node/generate_node_headers.py"
outputs = [ "$root_gen_dir/node_headers.json" ]
}
action("tar_node_headers") {
deps = [ ":copy_node_headers" ]
outputs = [ "$root_gen_dir/node_headers.tar.gz" ]
@@ -1561,13 +1657,112 @@ action("tar_node_headers") {
}
group("copy_node_headers") {
public_deps = header_groups + [
":node_gypi_headers",
":node_version_header",
":zlib_headers",
]
public_deps = [
":generate_node_headers",
":node_gypi_headers",
":node_version_header",
":zlib_headers",
]
}
group("node_headers") {
public_deps = [ ":tar_node_headers" ]
}
group("testing_build") {
public_deps = [
":electron_dist_zip",
":electron_mksnapshot_zip",
":node_headers",
]
}
group("release_build") {
public_deps = [ ":testing_build" ]
if (is_official_build) {
public_deps += [ ":electron_symbols" ]
}
if (is_linux) {
public_deps += [
":hunspell_dictionaries_zip",
":libcxx_headers_zip",
":libcxx_objects_zip",
":libcxxabi_headers_zip",
]
}
}
if (is_linux && is_official_build) {
strip_binary("strip_electron_binary") {
binary_input = "$root_out_dir/$electron_project_name"
symbol_output = "$root_out_dir/debug/$electron_project_name.debug"
compress_debug_sections = true
deps = [ ":electron_app" ]
}
strip_binary("strip_chrome_crashpad_handler") {
binary_input = "$root_out_dir/chrome_crashpad_handler"
symbol_output = "$root_out_dir/debug/chrome_crashpad_handler.debug"
compress_debug_sections = true
deps = [ "//components/crash/core/app:chrome_crashpad_handler" ]
}
strip_binary("strip_chrome_sandbox") {
binary_input = "$root_out_dir/chrome_sandbox"
symbol_output = "$root_out_dir/debug/chrome-sandbox.debug"
compress_debug_sections = true
deps = [ "//sandbox/linux:chrome_sandbox" ]
}
strip_binary("strip_libEGL_shlib") {
binary_input = "$root_out_dir/libEGL.so"
symbol_output = "$root_out_dir/debug/libEGL.so.debug"
compress_debug_sections = true
deps = [ "//third_party/angle:libEGL" ]
}
strip_binary("strip_libGLESv2_shlib") {
binary_input = "$root_out_dir/libGLESv2.so"
symbol_output = "$root_out_dir/debug/libGLESv2.so.debug"
compress_debug_sections = true
deps = [ "//third_party/angle:libGLESv2" ]
}
strip_binary("strip_libffmpeg_shlib") {
binary_input = "$root_out_dir/libffmpeg.so"
symbol_output = "$root_out_dir/debug/libffmpeg.so.debug"
compress_debug_sections = true
deps = [ "//third_party/ffmpeg" ]
}
strip_binary("strip_libvk_swiftshader_shlib") {
binary_input = "$root_out_dir/libvk_swiftshader.so"
symbol_output = "$root_out_dir/debug/libvk_swiftshader.so.debug"
compress_debug_sections = true
deps = [ "//third_party/swiftshader/src/Vulkan:swiftshader_libvulkan" ]
}
strip_binary("strip_mksnapshot_binary") {
_binary_path = rebase_path(
get_label_info(
":v8_context_snapshot_generator($v8_snapshot_toolchain)",
"root_out_dir") + "/mksnapshot",
root_build_dir)
binary_input = "$root_out_dir/$_binary_path"
symbol_output = "$root_out_dir/debug/${_binary_path}.debug"
compress_debug_sections = true
deps = mksnapshot_deps
}
strip_binary("strip_v8_context_snapshot_generator_binary") {
_binary_path = rebase_path(
get_label_info(
":v8_context_snapshot_generator($v8_snapshot_toolchain)",
"root_out_dir") + "/v8_context_snapshot_generator",
root_build_dir)
binary_input = "$root_out_dir/$_binary_path"
symbol_output = "$root_out_dir/debug/${_binary_path}.debug"
compress_debug_sections = true
deps = mksnapshot_deps
}
}

270
CLAUDE.md Normal file
View File

@@ -0,0 +1,270 @@
# Electron Development Guide
## Project Overview
Electron is a framework for building cross-platform desktop applications using web technologies. It embeds Chromium for rendering and Node.js for backend functionality.
## Directory Structure
```text
electron/ # This repo (run `e` commands here)
├── shell/ # Core C++ application code
│ ├── browser/ # Main process implementation (107+ API modules)
│ ├── renderer/ # Renderer process code
│ ├── common/ # Shared code between processes
│ ├── app/ # Application entry points
│ └── services/ # Node.js service integration
├── lib/ # TypeScript/JavaScript library code
│ ├── browser/ # Main process JS (47 API implementations)
│ ├── renderer/ # Renderer process JS
│ └── common/ # Shared JS modules
├── patches/ # Patches for upstream dependencies
│ ├── chromium/ # ~159 patches to Chromium
│ ├── node/ # ~48 patches to Node.js
│ └── ... # Other targets (v8, boringssl, etc.)
├── spec/ # Test suite (1189+ TypeScript test files)
├── docs/ # API documentation and guides
├── build/ # Build configuration
├── script/ # Build and automation scripts
└── chromium_src/ # Chromium source overrides
../ # Parent directory is Chromium source
```
## Build Tools Setup
Electron uses `@electron/build-tools` for development. The `e` command is the primary CLI.
**Installation:**
```bash
npm i -g @electron/build-tools
```
**Configuration location:** `~/.electron_build_tools/configs/`
## Essential Commands
### Configuration Management
| Command | Purpose |
|---------|---------|
| `e init <name> --root=<path> --bootstrap testing` | Create new build config and sync |
| `e use <name>` | Switch to a different build configuration |
| `e show current` | Display active configuration name |
| `e show configs` | List all available configurations |
### Build & Development Loop
| Command | Purpose |
|---------|---------|
| `e sync` | Fetch/update all source code and apply patches |
| `e sync --3` | Sync with 3-way merge (required for Chromium upgrades) |
| `e build` | Build Electron (runs GN + Ninja) |
| `e build -k 999` | Build and continue on errors (up to 999) |
| `e build -t <target>` | Build specific target (e.g., `electron:node_headers`) |
| `e start` | Run the built Electron executable |
| `e start --version` | Verify Electron launches and print version |
| `e test` | Run the test suite |
| `e debug` | Run Electron in debugger (lldb on macOS, gdb on Linux) |
### Patch Management
| Command | Purpose |
|---------|---------|
| `e patches <target>` | Export patches for a target (chromium, node, v8, etc.) |
| `e patches all` | Export all patches from all targets |
| `e patches --list-targets` | List available patch targets |
## Typical Development Workflow
```bash
# 1. Ensure you're on the right config
e show current
# 2. Sync to get latest code
e sync
# 3. Make your changes in shell/ or lib/ or ../
# 4. Build
e build
# 5. Test your changes (Leave the user to do this, don't run these commands unless asked)
e start
e test
# 6. If you modified patched files in Chromium:
cd .. # Go to Chromium repo
git add <files>
git commit -m "description of change"
cd electron
e patches chromium # Export the patch
```
## Patches System
Electron patches upstream dependencies (Chromium, Node.js, V8, etc.) to add features or modify behavior.
**How patches work:**
```text
patches/{target}/*.patch → [e sync --3] → target repo commits
← [e patches] ←
```
**Patch configuration:** `patches/config.json` maps patch directories to target repos.
**Key rules:**
- Fix existing patches 99% of the time rather than creating new ones
- Preserve original authorship in TODO comments
- Never change TODO assignees (`TODO(name)` must retain original name)
- Each patch file includes commit message explaining its purpose
**Creating/modifying patches:**
1. Make changes in the target repo (e.g., `../` for Chromium)
2. Create a git commit
3. Run `e patches <target>` to export
**Fixing patch conflicts on an existing PR:**
If asked to fix a patch conflict on a branch that already has an open PR, check the PR's failed **Apply Patches** CI run for an `update-patches` artifact before running `e sync` locally. CI has already performed the 3-way merge and exported the resolved patch diff — applying it is much faster than a full local sync.
```bash
# Find the failed Apply Patches run for the PR and download the artifact
gh run list --repo electron/electron --branch <pr-branch> --workflow "Apply Patches" --limit 1
gh run download <run-id> --repo electron/electron --name update-patches
# Apply the CI-generated fix, then push
git am update-patches.patch
git push
```
If no artifact exists (e.g. the 3-way merge itself failed), fall back to `e sync --3` and resolve manually.
## Testing
**Test location:** `spec/` directory
**Running tests:**
```bash
e test # Run full test suite
```
**Test frameworks:** Mocha, Chai, Sinon
## Build Configuration
**GN build arguments:** Located in `build/args/`:
- `testing.gn` - Debug/testing builds
- `release.gn` - Release builds
- `all.gn` - Common arguments for all builds
**Main build file:** `BUILD.gn`
**Feature flags:** `buildflags/buildflags.gni`
## Chromium Upgrade Workflow
When working on the `roller/chromium/main` branch to upgrade Chromium activate the "Electron Chromium Upgrade" skill.
## Pull Requests
PR bodies must always include a `Notes:` section as the **last line** of the body. This is a consumer-facing release note for Electron app developers — describe the user-visible fix or change, not internal implementation details. Use `Notes: none` if there is no user-facing change.
### PR Labeling (write-access only)
When the user has write access to `electron/electron`, add these labels when creating PRs:
**Semver label** — one of:
- `semver/none` — build changes, refactors, CI, or anything with no end-user impact
- `semver/patch` — backwards-compatible bug fixes
- `semver/minor` — backwards-compatible new functionality
- `semver/major` — incompatible API changes
**Backport target labels** — add `target/{N}-x-y` for each supported release branch the change should land on. Default policy:
- **Bug fixes** — backport to all active release lines _except the oldest_
- **Security fixes** — backport to all active release lines _including the oldest_
- **Features (semver/minor) and breaking changes (semver/major)** — no backport labels; main-only by default
To find which release branches are active, check label colors — active `target/*` labels use color `#ad244f`, older/EOL ones use `#ededed`:
```bash
gh label list --repo electron/electron --search target/ --json name,color --jq '.[] | select(.color == "ad244f") | .name'
```
## Code Style
**C++:** Follows Chromium style, enforced by clang-format
**TypeScript/JavaScript:** ESLint configuration in `.eslintrc.json`
**Linting:**
```bash
npm run lint # Run all linters
npm run lint:clang-format # C++ formatting
npm run lint:api-history # Validate API history YAML blocks in docs
```
## Key Files
| File | Purpose |
|------|---------|
| `BUILD.gn` | Main GN build configuration |
| `DEPS` | Dependency versions and checkout paths |
| `patches/config.json` | Patch target configuration |
| `filenames.gni` | Source file lists by platform |
| `package.json` | Node.js dependencies and scripts |
## Environment Variables
| Variable | Purpose |
|----------|---------|
| `GN_EXTRA_ARGS` | Additional GN arguments (useful in CI) |
| `ELECTRON_RUN_AS_NODE=1` | Run Electron as Node.js |
## Useful Git Commands for Chromium
```bash
# Find CL that changed a file
cd ..
git log --oneline -10 -- {file}
git blame -L {start},{end} -- {file}
# Look for Chromium CL reference in commit
git log -1 {commit_sha} # Find "Reviewed-on:" line
# Find which patch affects a file
grep -l "filename.cc" patches/chromium/*.patch
```
## CI/CD
GitHub Actions workflows in `.github/workflows/`:
- `build.yml` - Main build workflow
- `pipeline-electron-lint.yml` - Linting
- `pipeline-segment-electron-test.yml` - Testing
## Common Issues
**Patch conflict during sync:**
- Use `e sync --3` for 3-way merge
- Check if file was renamed/moved upstream
- Verify patch is still needed
**Build error in patched file:**
- Find the patch: `grep -l "filename" patches/chromium/*.patch`
- Match existing patch style (#if 0 guards, BUILDFLAG conditionals, etc.)
**Remote build issues:**
- Try `e build --no-remote` to build locally
- Check reclient/siso configuration in your build config

View File

@@ -71,4 +71,4 @@ See [Coding Style](https://electronjs.org/docs/development/coding-style) for inf
## Further Reading
For more in-depth guides on developing Electron, see
[/docs/development](/docs/development/README.md)
[/docs/development](/docs/development/README.md).

19
DEPS
View File

@@ -2,17 +2,17 @@ gclient_gn_args_from = 'src'
vars = {
'chromium_version':
'128.0.6613.186',
'148.0.7741.0',
'node_version':
'v20.18.1',
'v24.14.0',
'nan_version':
'e14bdcd1f72d62bca1d541b66da43130384ec213',
'675cefebca42410733da8a454c8d9391fcebfbc2',
'squirrel.mac_version':
'0e5d146ba13101a1302d59ea6e6e0b3cace4ae38',
'reactiveobjc_version':
'74ab5baccc6f7202c8ac69a8d1e152c29dc1ea76',
'mantle_version':
'78d3966b3c331292ea29ec38661b25df0a245948',
'2a8e2123a3931038179ee06105c9e6ec336b12ea',
'engflow_reclient_configs_version':
'955335c30a752e9ef7bff375baab5e0819b6c00d',
@@ -30,9 +30,6 @@ vars = {
# The path of the sysroots.json file.
'sysroots_json_path': 'electron/script/sysroots.json',
# KEEP IN SYNC WITH utils.js FILE
'yarn_version': '1.15.2',
# To be able to build clean Chromium from sources.
'apply_patches': True,
@@ -62,10 +59,6 @@ vars = {
'checkout_nacl':
False,
'checkout_libaom':
True,
'checkout_oculus_sdk':
False,
'checkout_openxr':
False,
'build_with_chromium':
@@ -74,8 +67,6 @@ vars = {
False,
'checkout_android_native_support':
False,
'checkout_google_benchmark':
False,
'checkout_clang_tidy':
True,
}
@@ -161,7 +152,7 @@ hooks = [
'action': [
'python3',
'-c',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["python3", "script/lib/npx.py", "yarn@' + (Var("yarn_version")) + '", "install", "--frozen-lockfile"]);',
'import os, subprocess; os.chdir(os.path.join("src", "electron")); subprocess.check_call(["node", ".yarn/releases/yarn-4.12.0.cjs", "install", "--immutable"]);',
],
},
{

View File

@@ -1,7 +1,6 @@
[![Electron Logo](https://electronjs.org/images/electron-logo.svg)](https://electronjs.org)
[![GitHub Actions Build Status](https://github.com/electron/electron/actions/workflows/build.yml/badge.svg)](https://github.com/electron/electron/actions/workflows/build.yml)
[![AppVeyor Build Status](https://ci.appveyor.com/api/projects/status/4lggi9dpjc1qob7k/branch/main?svg=true)](https://ci.appveyor.com/project/electron-bot/electron-ljo26/branch/main)
[![Electron Discord Invite](https://img.shields.io/discord/745037351163527189?color=%237289DA&label=chat&logo=discord&logoColor=white)](https://discord.gg/electronjs)
:memo: Available Translations: 🇨🇳 🇧🇷 🇪🇸 🇯🇵 🇷🇺 🇫🇷 🇺🇸 🇩🇪.
@@ -38,36 +37,24 @@ For more installation options and troubleshooting tips, see
Each Electron release provides binaries for macOS, Windows, and Linux.
* macOS (Catalina and up): Electron provides 64-bit Intel and ARM binaries for macOS. Apple Silicon support was added in Electron 11.
* macOS (Monterey and up): Electron provides 64-bit Intel and Apple Silicon / ARM binaries for macOS.
* Windows (Windows 10 and up): Electron provides `ia32` (`x86`), `x64` (`amd64`), and `arm64` binaries for Windows. Windows on ARM support was added in Electron 5.0.8. Support for Windows 7, 8 and 8.1 was [removed in Electron 23, in line with Chromium's Windows deprecation policy](https://www.electronjs.org/blog/windows-7-to-8-1-deprecation-notice).
* Linux: The prebuilt binaries of Electron are built on Ubuntu 20.04. They have also been verified to work on:
* Linux: The prebuilt binaries of Electron are built on Ubuntu 22.04. They have also been verified to work on:
* Ubuntu 18.04 and newer
* Fedora 32 and newer
* Debian 10 and newer
## Quick start & Electron Fiddle
## Electron Fiddle
Use [`Electron Fiddle`](https://github.com/electron/fiddle)
to build, run, and package small Electron experiments, to see code examples for all of Electron's APIs, and
to try out different versions of Electron. It's designed to make the start of your journey with
Electron easier.
Alternatively, clone and run the
[electron/electron-quick-start](https://github.com/electron/electron-quick-start)
repository to see a minimal Electron app in action:
```sh
git clone https://github.com/electron/electron-quick-start
cd electron-quick-start
npm install
npm start
```
## Resources for learning Electron
* [electronjs.org/docs](https://electronjs.org/docs) - All of Electron's documentation
* [electron/fiddle](https://github.com/electron/fiddle) - A tool to build, run, and package small Electron experiments
* [electron/electron-quick-start](https://github.com/electron/electron-quick-start) - A very basic starter Electron app
* [electronjs.org/community#boilerplates](https://electronjs.org/community#boilerplates) - Sample starter apps created by the community
## Programmatic usage

View File

@@ -8,6 +8,12 @@ The Electron team will send a response indicating the next steps in handling you
Report security bugs in third-party modules to the person or team maintaining the module. You can also report a vulnerability through the [npm contact form](https://www.npmjs.com/support) by selecting "I'm reporting a security vulnerability".
## Escalation
If you do not receive an acknowledgement of your report within 6 business days, or if you cannot find a private security contact for the project, you may escalate to the OpenJS Foundation CNA at `security@lists.openjsf.org`.
If the project acknowledges your report but does not provide any further response or engagement within 14 days, escalation is also appropriate.
## The Electron Security Notification Process
For context on Electron's security notification process, please see the [Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md#notifications) section of the Security WG's [Membership and Notifications](https://github.com/electron/governance/blob/main/wg-security/membership-and-notifications.md) Governance document.

View File

@@ -1,107 +0,0 @@
# The config is used to bake appveyor images, not for running CI jobs.
# The config expects the following environment variables to be set:
# - "APPVEYOR_BAKE_IMAGE" e.g. 'electron-99.0.4767.0'. Name of the image to be baked.
# Typically named after the Chromium version on which the image is built.
# This can be set dynamically in the prepare-appveyor script.
version: 1.0.{build}
build_cloud: electronhq-16-core
image: base-bake-image
environment:
GIT_CACHE_PATH: C:\Users\appveyor\libcc_cache
ELECTRON_OUT_DIR: Default
ELECTRON_ENABLE_STACK_DUMPING: 1
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: mocha-appveyor-reporter, tap
DEPOT_TOOLS_WIN_TOOLCHAIN: 0
PYTHONIOENCODING: UTF-8
# The following lines are needed when baking from a completely new image (eg MicrosoftWindowsServer:WindowsServer:2019-Datacenter:latest via image: base-windows-server2019)
# init:
# - ps: $blockRdp = $true; iex ((new-object net.webclient).DownloadString('https://raw.githubusercontent.com/appveyor/ci/master/scripts/enable-rdp.ps1'))
# - appveyor version
# - ps: $ErrorActionPreference = 'Stop'
# - ps: 'Write-Host "OS Build: $((Get-CimInstance Win32_OperatingSystem).BuildNumber)"'
# clone_folder: '%USERPROFILE%\image-bake-scripts'
# clone_script:
# - ps: Invoke-WebRequest "https://github.com/appveyor/build-images/archive/1f90d94e74c8243c909a09b994e527584dfcb838.zip" -OutFile "$env:temp\scripts.zip"
# - ps: Expand-Archive -Path "$env:temp\scripts.zip" -DestinationPath "$env:temp\scripts" -Force
# - ps: Copy-Item -Path "$env:temp\scripts\build-images-1f90d94e74c8243c909a09b994e527584dfcb838\scripts\Windows\*" -Destination $env:APPVEYOR_BUILD_FOLDER -Recurse
build_script:
# The following lines are needed when baking from a completely new image (eg MicrosoftWindowsServer:WindowsServer:2019-Datacenter:latest via image: base-windows-server2019)
# - ps: .\init_server.ps1
# - ps: .\extend_system_volume.ps1
# # Restart VM
# - ps: Start-Sleep -s 5; Restart-Computer
# - ps: Start-Sleep -s 5
# - appveyor version
# - ps: .\install_path_utils.ps1
# - ps: .\install_powershell_core.ps1
# - ps: .\install_powershell_get.ps1
# - ps: .\install_7zip.ps1
# - ps: .\install_chocolatey.ps1
# - ps: .\install_webpi.ps1
# - ps: .\install_nuget.ps1
# - ps: .\install_pstools.ps1
# - ps: .\install_git.ps1
# - ps: .\install_git_lfs.ps1
# # Restart VM
# - ps: Start-Sleep -s 5; Restart-Computer
# - ps: Start-Sleep -s 5
# END LINES FOR COMPLETELY NEW IMAGE
- git config --global core.longpaths true
- ps: >-
if (-not (Test-Path -Path C:\projects\src)) {
New-Item -Path C:\projects\src -ItemType Directory
}
- cd C:\projects\
- git clone -q --branch=%APPVEYOR_REPO_BRANCH% https://github.com/electron/electron.git C:\projects\src\electron
- git clone --depth=1 https://chromium.googlesource.com/chromium/tools/depot_tools.git
- ps: $env:PATH="$pwd\depot_tools;$env:PATH"
- update_depot_tools.bat
# Uncomment the following line if windows deps change
# - src\electron\script\setup-win-for-dev.bat
- >-
gclient config
--name "src\electron"
--unmanaged
%GCLIENT_EXTRA_ARGS%
"https://github.com/electron/electron"
- ps: cd src\electron
- ps: node script\generate-deps-hash.js
- ps: $depshash = Get-Content .\.depshash -Raw
- ps: Copy-Item -path .\.depshash -destination ..\.depshash
- ps: cd ..\..
- gclient sync --with_branch_heads --with_tags --nohooks
- ps: regsvr32 /s "C:\Program Files\Microsoft Visual Studio\2022\Community\DIA SDK\bin\amd64\msdia140.dll"
- ps: set vs2022_install="C:\Program Files\Microsoft Visual Studio\2022\Community"
# The following lines are needed when baking from a completely new image (eg MicrosoftWindowsServer:WindowsServer:2019-Datacenter:latest via image: base-windows-server2019)
# # Restart VM
# - ps: Start-Sleep -s 5; Restart-Computer
# - ps: Start-Sleep -s 5
# - cd %USERPROFILE%\image-bake-scripts
# - appveyor version
# - ps: .\optimize_dotnet_runtime.ps1
# - ps: .\disable_windows_background_services.ps1
# - ps: .\enforce_windows_firewall.ps1
# - ps: .\cleanup_windows.ps1
# END LINES FOR COMPLETELY NEW IMAGE
on_image_bake:
- ps: >-
echo "Baking image: $env:APPVEYOR_BAKE_IMAGE at dir $PWD"
- ps: Remove-Item -Recurse -Force C:\projects\depot_tools
- ps: Remove-Item -Recurse -Force C:\projects\src\electron
# Uncomment these lines and set APPVEYOR_RDP_PASSWORD in project settings to enable RDP after bake is done
# # on_finish:
# - ps: >-
# $blockRdp = $true; iex ((new-object net.webclient).DownloadString('https://raw.githubusercontent.com/appveyor/ci/master/scripts/enable-rdp.ps1'))

View File

@@ -1,342 +0,0 @@
# NOTE IF CHANGING THIS FILE, ALSO APPLY THE CHANGE TO appveyor.yml
# IF APPLICABLE!!!!
#
#
# The config expects the following environment variables to be set:
# - "GN_CONFIG" Build type. One of {'testing', 'release'}.
# - "GN_EXTRA_ARGS" Additional gn arguments for a build config,
# e.g. 'target_cpu="x86"' to build for a 32bit platform.
# https://gn.googlesource.com/gn/+/main/docs/reference.md#var_target_cpu
# Don't forget to set up "NPM_CONFIG_ARCH" and "TARGET_ARCH" accordingly
# if you pass a custom value for 'target_cpu'.
# - "ELECTRON_RELEASE" Set it to '1' upload binaries on success.
# - "NPM_CONFIG_ARCH" E.g. 'x86'. Is used to build native Node.js modules.
# Must match 'target_cpu' passed to "GN_EXTRA_ARGS" and "TARGET_ARCH" value.
# - "TARGET_ARCH" Choose from {'ia32', 'x64', 'arm', 'arm64'}.
# Is used in some publishing scripts, but does NOT affect the Electron binary.
# Must match 'target_cpu' passed to "GN_EXTRA_ARGS" and "NPM_CONFIG_ARCH" value.
# - "UPLOAD_TO_STORAGE" Set it to '1' upload a release to the Azure bucket.
# Otherwise the release will be uploaded to the GitHub Releases.
# (The value is only checked if "ELECTRON_RELEASE" is defined.)
#
# The publishing scripts expect access tokens to be defined as env vars,
# but those are not covered here.
#
# AppVeyor docs on variables:
# https://www.appveyor.com/docs/environment-variables/
# https://www.appveyor.com/docs/build-configuration/#secure-variables
# https://www.appveyor.com/docs/build-configuration/#custom-environment-variables
version: 1.0.{build}
build_cloud: electronhq-16-core
image: e-131.0.6734.0
environment:
GIT_CACHE_PATH: C:\Users\appveyor\libcc_cache
ELECTRON_OUT_DIR: Default
ELECTRON_ENABLE_STACK_DUMPING: 1
ELECTRON_ALSO_LOG_TO_STDERR: 1
MOCHA_REPORTER: mocha-multi-reporters
MOCHA_MULTI_REPORTERS: "@marshallofsound/mocha-appveyor-reporter, mocha-junit-reporter, tap"
DEPOT_TOOLS_WIN_TOOLCHAIN: 1
DEPOT_TOOLS_WIN_TOOLCHAIN_BASE_URL: "https://dev-cdn.electronjs.org/windows-toolchains/_"
GYP_MSVS_HASH_7393122652: 3ba76c5c20
PYTHONIOENCODING: UTF-8
matrix:
- job_name: Build Arm on X64 Windows
- job_name: Test On Windows On Arm Hardware
job_depends_on: Build Arm on X64 Windows
APPVEYOR_BUILD_WORKER_IMAGE: base-woa
APPVEYOR_BUILD_WORKER_CLOUD: electronhq-woa
clone_script:
- ps: git clone -q $("--branch=" + $Env:APPVEYOR_REPO_BRANCH) $("https://github.com/" + $Env:APPVEYOR_REPO_NAME + ".git") $Env:APPVEYOR_BUILD_FOLDER
- ps: if (!$Env:APPVEYOR_PULL_REQUEST_NUMBER) {$("git checkout -qf " + $Env:APPVEYOR_REPO_COMMIT)}
- ps: if ($Env:APPVEYOR_PULL_REQUEST_NUMBER) {git fetch -q origin +refs/pull/$($Env:APPVEYOR_PULL_REQUEST_NUMBER)/head; git checkout -qf FETCH_HEAD}
clone_folder: C:\projects\src\electron
skip_branch_with_pr: true
# the first failed job cancels other jobs and fails entire build
matrix:
fast_finish: true
for:
- matrix:
only:
- job_name: Build Arm on X64 Windows
build_script:
# TODO: Remove --ignore-engines once WOA image is up to node 20
- ps: |
node script/yarn.js install --frozen-lockfile --ignore-engines
node script/doc-only-change.js --prNumber=$env:APPVEYOR_PULL_REQUEST_NUMBER
$env:SHOULD_SKIP_ARTIFACT_VALIDATION = "false"
if ($LASTEXITCODE -eq 0) {
Write-warning "Skipping build for doc-only change"
$env:SHOULD_SKIP_ARTIFACT_VALIDATION = "true"
Exit-AppveyorBuild
} else {
$global:LASTEXITCODE = 0
}
- cd ..
- ps: Write-Host "Building $env:GN_CONFIG build"
- git config --global core.longpaths true
- ps: >-
if (Test-Path -Path "$pwd\depot_tools") {
Remove-Item -Recurse -Force $pwd\depot_tools
}
- ps: >-
if (Test-Path -Path "$pwd\build-tools") {
Remove-Item -Recurse -Force $pwd\build-tools
}
- git clone --depth=1 https://chromium.googlesource.com/chromium/tools/depot_tools.git
- ps: New-Item -Name depot_tools\.disable_auto_update -ItemType File
- depot_tools\bootstrap\win_tools.bat
- ps: |
Set-Content -Path $pwd\depot_tools\build_telemetry.cfg -Value '{"user": "info@electronjs.org", "status": "opt-out", "countdown": 10, "version": 1}'
- ps: $env:PATH="$pwd\depot_tools;$env:PATH"
- ps: >-
if (Test-Path -Path "$pwd\src\electron") {
Remove-Item -Recurse -Force $pwd\src\electron
}
- git clone https://github.com/electron/build-tools.git
- cd build-tools
- npx yarn --ignore-engines
- mkdir third_party
- ps: >-
node -e "require('./src/utils/reclient.js').downloadAndPrepare({})"
- ps: $env:RECLIENT_HELPER = node -p "require('./src/utils/reclient.js').helperPath({})"
- ps: >-
& $env:RECLIENT_HELPER login
- ps: >-
$env:RBE_service = node -e "console.log(require('./src/utils/reclient.js').serviceAddress)"
- ps: >-
$env:RBE_experimental_credentials_helper = $env:RECLIENT_HELPER
- ps: >-
$env:RBE_experimental_credentials_helper_args = "print"
- ps: >-
if ($env:ELECTRON_RBE_JWT -eq '') {
$env:RBE_fail_early_min_action_count = "0"
$env:RBE_fail_early_min_fallback_ratio = "0"
}
- cd ..\..
- ps: $env:CHROMIUM_BUILDTOOLS_PATH="$pwd\src\buildtools"
- ps: >-
if ($env:GN_CONFIG -ne 'release') {
$env:NINJA_STATUS="[%r processes, %f/%t @ %o/s : %es] "
}
- gclient config --name "src\electron" --unmanaged %GCLIENT_EXTRA_ARGS% "https://github.com/electron/electron"
# Patches are applied in the image bake. Check depshash to see if patches have changed.
- ps: $env:RUN_GCLIENT_SYNC="false"
- ps: $depshash_baked = Get-Content .\src\.depshash -Raw
- ps: cd src\electron
- ps: node script\generate-deps-hash.js
- ps: $depshash = Get-Content .\.depshash -Raw
- ps: cd ..\..
- ps: >-
if ($depshash_baked -ne $depshash) {
$env:RUN_GCLIENT_SYNC="true"
}
- if "%RUN_GCLIENT_SYNC%"=="true" ( gclient sync --with_branch_heads --with_tags ) else ( gclient runhooks )
- cd src
- ps: $env:PATH="$pwd\third_party\ninja;$env:PATH"
- set BUILD_CONFIG_PATH=//electron/build/args/%GN_CONFIG%.gn
- gn gen out/Default "--args=import(\"%BUILD_CONFIG_PATH%\") use_remoteexec=true %GN_EXTRA_ARGS% "
- gn check out/Default //electron:electron_lib
- gn check out/Default //electron:electron_app
- gn check out/Default //electron/shell/common/api:mojo
- autoninja -j 300 -C out/Default electron:electron_app
- if "%GN_CONFIG%"=="testing" ( python C:\depot_tools\post_build_ninja_summary.py -C out\Default )
- gn gen out/ffmpeg "--args=import(\"//electron/build/args/ffmpeg.gn\") use_remoteexec=true %GN_EXTRA_ARGS%"
- autoninja -C out/ffmpeg electron:electron_ffmpeg_zip
- autoninja -C out/Default electron:electron_dist_zip
- gn desc out/Default v8:run_mksnapshot_default args > out/Default/default_mksnapshot_args
# Remove unused args from mksnapshot_args
- ps: >-
Get-Content out/Default/default_mksnapshot_args | Where-Object { -not $_.Contains('--turbo-profiling-input') -And -not $_.Contains('builtins-pgo') -And -not $_.Contains('The gn arg use_goma=true') } | Set-Content out/Default/mksnapshot_args
- autoninja -C out/Default electron:electron_mksnapshot_zip
- cd out\Default
- 7z a mksnapshot.zip mksnapshot_args gen\v8\embedded.S
- cd ..\..
- autoninja -C out/Default electron:hunspell_dictionaries_zip
- autoninja -C out/Default electron:electron_chromedriver_zip
- autoninja -C out/Default electron:node_headers
- ps: >-
Get-CimInstance -Namespace root\cimv2 -Class Win32_product | Select vendor, description, @{l='install_location';e='InstallLocation'}, @{l='install_date';e='InstallDate'}, @{l='install_date_2';e='InstallDate2'}, caption, version, name, @{l='sku_number';e='SKUNumber'} | ConvertTo-Json | Out-File -Encoding utf8 -FilePath .\installed_software.json
- python3 electron/build/profile_toolchain.py --output-json=out/Default/windows_toolchain_profile.json
- 7z a node_headers.zip out\Default\gen\node_headers
- 7z a nan.zip third_party\nan
- ps: >-
if ($env:GN_CONFIG -eq 'release') {
# Needed for msdia140.dll on 64-bit windows
$env:Path += ";$pwd\third_party\llvm-build\Release+Asserts\bin"
}
- if "%GN_CONFIG%"=="release" ( autoninja -C out/Default electron:electron_symbols )
- ps: >-
if ($env:GN_CONFIG -eq 'release') {
python3 electron\script\zip-symbols.py
appveyor-retry appveyor PushArtifact out/Default/symbols.zip
} else {
# It's useful to have pdb files when debugging testing builds that are
# built on CI.
7z a pdb.zip out\Default\*.pdb
}
- ps: |
$manifest_file = "electron/script/zip_manifests/dist_zip.win.$env:TARGET_ARCH.manifest"
python3 electron/script/zip_manifests/check-zip-manifest.py out/Default/dist.zip $manifest_file
if ($LASTEXITCODE -ne 0) {
throw "Zip contains files not listed in the manifest $manifest_file"
}
- ps: |
cd C:\projects\src
$missing_artifacts = $false
if ($env:SHOULD_SKIP_ARTIFACT_VALIDATION -eq 'true') {
Write-warning "Skipping artifact validation for doc-only $env:APPVEYOR_PROJECT_NAME"
} else {
$artifacts_to_validate = 'dist.zip','windows_toolchain_profile.json','chromedriver.zip','ffmpeg.zip','node_headers.zip','mksnapshot.zip','electron.lib','hunspell_dictionaries.zip','nan.zip'
foreach($artifact_name in $artifacts_to_validate) {
if ($artifact_name -eq 'ffmpeg.zip') {
$artifact_file = "out\ffmpeg\ffmpeg.zip"
} elseif (
$artifact_name -eq 'node_headers.zip') {
$artifact_file = $artifact_name
} elseif (
$artifact_name -eq 'nan.zip') {
$artifact_file = $artifact_name
} else {
$artifact_file = "out\Default\$artifact_name"
}
if (-not(Test-Path $artifact_file)) {
Write-warning "$artifact_name is missing and cannot be added to artifacts"
$missing_artifacts = $true
}
}
}
if ($missing_artifacts) {
throw "Build failed due to missing artifacts"
}
deploy_script:
- cd electron
- ps: >-
if (Test-Path Env:\ELECTRON_RELEASE) {
if (Test-Path Env:\UPLOAD_TO_STORAGE) {
Write-Output "Uploading Electron release distribution to azure"
& python3 script\release\uploaders\upload.py --verbose --upload_to_storage
} else {
Write-Output "Uploading Electron release distribution to github releases"
& python3 script\release\uploaders\upload.py --verbose
}
}
on_finish:
# Uncomment this lines to enable RDP
# - ps: $blockRdp = $true; iex ((new-object net.webclient).DownloadString('https://raw.githubusercontent.com/appveyor/ci/master/scripts/enable-rdp.ps1'))
- cd C:\projects\src
- if exist out\Default\windows_toolchain_profile.json ( appveyor-retry appveyor PushArtifact out\Default\windows_toolchain_profile.json )
- if exist out\Default\dist.zip (appveyor-retry appveyor PushArtifact out\Default\dist.zip)
- if exist out\Default\chromedriver.zip (appveyor-retry appveyor PushArtifact out\Default\chromedriver.zip)
- if exist out\ffmpeg\ffmpeg.zip (appveyor-retry appveyor PushArtifact out\ffmpeg\ffmpeg.zip)
- if exist node_headers.zip (appveyor-retry appveyor PushArtifact node_headers.zip)
- if exist nan.zip (appveyor-retry appveyor PushArtifact nan.zip)
- if exist out\Default\mksnapshot.zip (appveyor-retry appveyor PushArtifact out\Default\mksnapshot.zip)
- if exist out\Default\hunspell_dictionaries.zip (appveyor-retry appveyor PushArtifact out\Default\hunspell_dictionaries.zip)
- if exist out\Default\electron.lib (appveyor-retry appveyor PushArtifact out\Default\electron.lib)
- ps: >-
if ((Test-Path "pdb.zip") -And ($env:GN_CONFIG -ne 'release')) {
appveyor-retry appveyor PushArtifact pdb.zip
}
- matrix:
only:
- job_name: Test On Windows On Arm Hardware
environment:
IGNORE_YARN_INSTALL_ERROR: 1
ELECTRON_TEST_RESULTS_DIR: C:\projects\src\electron\junit
MOCHA_MULTI_REPORTERS: "@marshallofsound/mocha-appveyor-reporter, mocha-junit-reporter, tap"
MOCHA_REPORTER: mocha-multi-reporters
ELECTRON_SKIP_NATIVE_MODULE_TESTS: true
DD_ENV: ci
DD_SERVICE: electron
DD_CIVISIBILITY_LOGS_ENABLED: true
DD_GIT_REPOSITORY_URL: "https://github.com/electron/electron.git"
build_script:
- ps: |
node script/yarn.js install --frozen-lockfile --ignore-engines
node script/doc-only-change.js --prNumber=$env:APPVEYOR_PULL_REQUEST_NUMBER
if ($LASTEXITCODE -eq 0) {
Write-warning "Skipping build for doc only change"
Exit-AppveyorBuild
} else {
$global:LASTEXITCODE = 0
}
- ps: Invoke-WebRequest -Uri "https://github.com/DataDog/datadog-ci/releases/latest/download/datadog-ci_win-x64" -OutFile "C:\projects\src\electron\datadog-ci.exe"
- cd ..
- mkdir out\Default
- cd ..
- ps: |
# Download build artifacts
$apiUrl = 'https://ci.appveyor.com/api'
$build_info = Invoke-RestMethod -Method Get -Uri "$apiUrl/projects/$env:APPVEYOR_ACCOUNT_NAME/$env:APPVEYOR_PROJECT_SLUG/builds/$env:APPVEYOR_BUILD_ID"
$artifacts_to_download = @('dist.zip','ffmpeg.zip','node_headers.zip','electron.lib', 'nan.zip')
foreach ($job in $build_info.build.jobs) {
if ($job.name -eq "Build Arm on X64 Windows") {
$jobId = $job.jobId
foreach($artifact_name in $artifacts_to_download) {
if ($artifact_name -eq 'electron.lib') {
$outfile = "src\out\Default\$artifact_name"
} else {
$outfile = $artifact_name
}
Invoke-RestMethod -Method Get -Uri "$apiUrl/buildjobs/$jobId/artifacts/$artifact_name" -OutFile $outfile
}
# Uncomment the following lines to download the pdb.zip to show real stacktraces when crashes happen during testing
Invoke-RestMethod -Method Get -Uri "$apiUrl/buildjobs/$jobId/artifacts/pdb.zip" -OutFile pdb.zip
7z x -y -osrc pdb.zip
}
}
- ps: |
$out_default_zips = @('dist.zip')
foreach($zip_name in $out_default_zips) {
7z x -y -osrc\out\Default $zip_name
}
- ps: 7z x -y -osrc\out\ffmpeg ffmpeg.zip
- ps: 7z x -y -osrc node_headers.zip
- ps: 7z x -y -osrc nan.zip
test_script:
# Workaround for https://github.com/appveyor/ci/issues/2420
- set "PATH=%PATH%;C:\Program Files\Git\mingw64\libexec\git-core"
- ps: |
cd src
New-Item .\out\Default\gen\node_headers\Release -Type directory
Copy-Item -path .\out\Default\electron.lib -destination .\out\Default\gen\node_headers\Release\node.lib
- set npm_config_nodedir=%cd%\out\Default\gen\node_headers
- set npm_config_arch=arm64
- cd electron
# Explicitly set npm_config_arch because the .env doesn't persist
- ps: >-
if ($env:TARGET_ARCH -eq 'ia32') {
$env:npm_config_arch = "ia32"
}
- echo Running main test suite & node script/yarn test --runners=main --enable-logging --disable-features=CalculateNativeWinOcclusion
- cd ..
- echo Verifying non proprietary ffmpeg & python electron\script\verify-ffmpeg.py --build-dir out\Default --source-root %cd% --ffmpeg-path out\ffmpeg
on_finish:
# Uncomment these lines to enable RDP
# - ps: $blockRdp = $true; iex ((new-object net.webclient).DownloadString('https://raw.githubusercontent.com/appveyor/ci/master/scripts/enable-rdp.ps1'))
- if exist electron\junit\test-results-main.xml ( appveyor-retry appveyor PushArtifact electron\junit\test-results-main.xml )
- ps: |
if ($env:DD_API_KEY) {
$env:DD_GIT_COMMIT_SHA = $env:APPVEYOR_REPO_COMMIT
$env:DD_GIT_BRANCH = $env:APPVEYOR_PULL_REQUEST_HEAD_REPO_BRANCH
$env:DD_TAGS = "os.architecture:$env:TARGET_ARCH,os.family:windows,os.platform:win32"
if (Test-Path -Path "C:\projects\src\electron\junit\test-results-main.xml") {
C:\projects\src\electron\datadog-ci.exe junit upload --verbose C:\projects\src\electron\junit\test-results-main.xml
}
}

Some files were not shown because too many files have changed in this diff Show More